Early growth response protein 1

Overview
NameEarly growth response protein 1
Smed IDSMED30013207
Length (bp)1587
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Early growth response protein 1 (SMED30013207) t-SNE clustered cells

Violin plots show distribution of expression levels for Early growth response protein 1 (SMED30013207) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Early growth response protein 1 (SMED30013207) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Early growth response protein 1 (SMED30013207) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013207

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013207SMESG000019723.1 SmedASXL_069199SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Early growth response protein 1 vs. Ensembl Human
Match: EGR3 (early growth response 3 [Source:HGNC Symbol;Acc:HGNC:3240])

HSP 1 Score: 121.324 bits (303), Expect = 1.682e-29
Identity = 53/89 (59.55%), Postives = 63/89 (70.79%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R   C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C FC + F RSDE+ RH KIH +  +K
Sbjct:  273 RPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEK 361          
BLAST of Early growth response protein 1 vs. Ensembl Human
Match: EGR3 (early growth response 3 [Source:HGNC Symbol;Acc:HGNC:3240])

HSP 1 Score: 120.553 bits (301), Expect = 1.918e-29
Identity = 53/89 (59.55%), Postives = 63/89 (70.79%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R   C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C FC + F RSDE+ RH KIH +  +K
Sbjct:  235 RPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEK 323          
BLAST of Early growth response protein 1 vs. Ensembl Human
Match: EGR1 (early growth response 1 [Source:HGNC Symbol;Acc:HGNC:3238])

HSP 1 Score: 122.094 bits (305), Expect = 4.838e-29
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:  336 RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR 420          
BLAST of Early growth response protein 1 vs. Ensembl Human
Match: EGR2 (early growth response 2 [Source:HGNC Symbol;Acc:HGNC:3239])

HSP 1 Score: 120.168 bits (300), Expect = 1.545e-28
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C +C + F RSDE+ RH KIH R
Sbjct:  338 RPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLR 422          

HSP 2 Score: 63.1586 bits (152), Expect = 6.134e-10
Identity = 29/57 (50.88%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1148 ERPFKCSI--CSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            ERP+ C    C R+FSRSD    HIR HTG KP+ C  C ++F+RSD  T H + HT
Sbjct:  337 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHT 393          
BLAST of Early growth response protein 1 vs. Ensembl Human
Match: EGR2 (early growth response 2 [Source:HGNC Symbol;Acc:HGNC:3239])

HSP 1 Score: 120.168 bits (300), Expect = 1.545e-28
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C +C + F RSDE+ RH KIH R
Sbjct:  338 RPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLR 422          

HSP 2 Score: 63.1586 bits (152), Expect = 6.134e-10
Identity = 29/57 (50.88%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1148 ERPFKCSI--CSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            ERP+ C    C R+FSRSD    HIR HTG KP+ C  C ++F+RSD  T H + HT
Sbjct:  337 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHT 393          
BLAST of Early growth response protein 1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 115.546 bits (288), Expect = 1.671e-30
Identity = 52/86 (60.47%), Postives = 65/86 (75.58%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRS 1318
            R + C    C++ F R+DEL RH+RIHTG++PF+C IC R+FSRSDH  TH+RTHTGEKPY+C  C K F R DE+TRH KIH +S
Sbjct:   11 RPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKS 96          
BLAST of Early growth response protein 1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 120.553 bits (301), Expect = 1.943e-30
Identity = 52/86 (60.47%), Postives = 65/86 (75.58%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRS 1318
            R + C    C++ F R+DEL RH+RIHTG++PF+C IC R+FSRSDH  TH+RTHTGEKPY+C  C K F R DE+TRH KIH +S
Sbjct:  176 RPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKS 261          
BLAST of Early growth response protein 1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 119.783 bits (299), Expect = 4.162e-30
Identity = 52/86 (60.47%), Postives = 65/86 (75.58%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRS 1318
            R + C    C++ F R+DEL RH+RIHTG++PF+C IC R+FSRSDH  TH+RTHTGEKPY+C  C K F R DE+TRH KIH +S
Sbjct:  176 RPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKS 261          
BLAST of Early growth response protein 1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 114.39 bits (285), Expect = 4.756e-30
Identity = 52/86 (60.47%), Postives = 65/86 (75.58%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRS 1318
            R + C    C++ F R+DEL RH+RIHTG++PF+C IC R+FSRSDH  TH+RTHTGEKPY+C  C K F R DE+TRH KIH +S
Sbjct:   11 RPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKS 96          

HSP 2 Score: 55.8398 bits (133), Expect = 2.266e-9
Identity = 23/52 (44.23%), Postives = 32/52 (61.54%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKP 1240
            +C R F R+D L  H+R HTGE+P+ C IC ++F+R D R  H + H    P
Sbjct:   47 ICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKSGP 98          
BLAST of Early growth response protein 1 vs. Ensembl Celegans
Match: egrh-1 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:Q18250])

HSP 1 Score: 117.087 bits (292), Expect = 5.841e-28
Identity = 50/86 (58.14%), Postives = 63/86 (73.26%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRS 1318
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  TH+RTHTGEKP++C  C + F RSDE+ RH K+H  S
Sbjct:  372 RPYKCPRDGCDRRFSRSDELTRHIRIHTGQKPFQCRICMRAFSRSDHLTTHVRTHTGEKPFSCDICGRKFARSDERKRHTKVHKTS 457          
BLAST of Early growth response protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0083542)

HSP 1 Score: 126.716 bits (317), Expect = 2.526e-30
Identity = 51/85 (60.00%), Postives = 63/85 (74.12%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP++C  C + F RSDEK RH K+H +
Sbjct: 1034 RPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLK 1118          

HSP 2 Score: 70.8626 bits (172), Expect = 1.758e-12
Identity = 26/51 (50.98%), Postives = 36/51 (70.59%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEK 1237
            +C RSF R+D L  H+R HTGE+PF C IC R+F+RSD +K H + H  ++
Sbjct: 1070 ICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 1120          
BLAST of Early growth response protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0330050)

HSP 1 Score: 126.331 bits (316), Expect = 4.225e-30
Identity = 51/85 (60.00%), Postives = 63/85 (74.12%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP++C  C + F RSDEK RH K+H +
Sbjct: 1034 RPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLK 1118          

HSP 2 Score: 70.4774 bits (171), Expect = 2.304e-12
Identity = 26/51 (50.98%), Postives = 36/51 (70.59%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEK 1237
            +C RSF R+D L  H+R HTGE+PF C IC R+F+RSD +K H + H  ++
Sbjct: 1070 ICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 1120          
BLAST of Early growth response protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0301615)

HSP 1 Score: 120.553 bits (301), Expect = 1.642e-28
Identity = 51/85 (60.00%), Postives = 63/85 (74.12%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP++C  C + F RSDEK RH K+H +
Sbjct:  565 RPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLK 649          
BLAST of Early growth response protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0344633)

HSP 1 Score: 120.553 bits (301), Expect = 2.082e-28
Identity = 51/85 (60.00%), Postives = 63/85 (74.12%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP++C  C + F RSDEK RH K+H +
Sbjct:  754 RPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLK 838          
BLAST of Early growth response protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0083543)

HSP 1 Score: 120.553 bits (301), Expect = 2.082e-28
Identity = 51/85 (60.00%), Postives = 63/85 (74.12%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP++C  C + F RSDEK RH K+H +
Sbjct:  754 RPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLK 838          
BLAST of Early growth response protein 1 vs. Ensembl Zebrafish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:30498])

HSP 1 Score: 123.25 bits (308), Expect = 1.146e-29
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:  309 RPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMR 393          
BLAST of Early growth response protein 1 vs. Ensembl Zebrafish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:30498])

HSP 1 Score: 123.25 bits (308), Expect = 1.146e-29
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:  309 RPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMR 393          
BLAST of Early growth response protein 1 vs. Ensembl Zebrafish
Match: egr2a (early growth response 2a [Source:ZFIN;Acc:ZDB-GENE-030723-6])

HSP 1 Score: 117.472 bits (293), Expect = 1.557e-29
Identity = 53/85 (62.35%), Postives = 63/85 (74.12%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP++C FC + F RSDE+ RH KIH R
Sbjct:  146 RPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTKIHQR 230          

HSP 2 Score: 62.003 bits (149), Expect = 2.170e-10
Identity = 26/51 (50.98%), Postives = 34/51 (66.67%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEK 1237
            +C RSF R+D L  H+R HTGE+PF C  C R+F+RSD R+ H + H   K
Sbjct:  182 ICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTKIHQRHK 232          

HSP 3 Score: 62.003 bits (149), Expect = 2.712e-10
Identity = 29/57 (50.88%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1148 ERPFKCSI--CSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            ERP+ C    C R+FSRSD    H+R HTG KP+ C  C +SF+RSD  T H + HT
Sbjct:  145 ERPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHT 201          
BLAST of Early growth response protein 1 vs. Ensembl Zebrafish
Match: egr2a (early growth response 2a [Source:ZFIN;Acc:ZDB-GENE-030723-6])

HSP 1 Score: 117.472 bits (293), Expect = 1.557e-29
Identity = 53/85 (62.35%), Postives = 63/85 (74.12%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP++C FC + F RSDE+ RH KIH R
Sbjct:  146 RPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTKIHQR 230          

HSP 2 Score: 62.003 bits (149), Expect = 2.170e-10
Identity = 26/51 (50.98%), Postives = 34/51 (66.67%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEK 1237
            +C RSF R+D L  H+R HTGE+PF C  C R+F+RSD R+ H + H   K
Sbjct:  182 ICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTKIHQRHK 232          

HSP 3 Score: 62.003 bits (149), Expect = 2.712e-10
Identity = 29/57 (50.88%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1148 ERPFKCSI--CSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            ERP+ C    C R+FSRSD    H+R HTG KP+ C  C +SF+RSD  T H + HT
Sbjct:  145 ERPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHT 201          
BLAST of Early growth response protein 1 vs. Ensembl Zebrafish
Match: egr2b (early growth response 2b [Source:NCBI gene;Acc:30190])

HSP 1 Score: 120.939 bits (302), Expect = 2.400e-29
Identity = 53/85 (62.35%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C FC + F RSDE+ RH KIH R
Sbjct:  297 RPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTKIHLR 381          

HSP 2 Score: 63.1586 bits (152), Expect = 3.653e-10
Identity = 29/57 (50.88%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1148 ERPFKCSI--CSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            ERP+ C    C R+FSRSD    HIR HTG KP+ C  C ++F+RSD  T H + HT
Sbjct:  296 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHT 352          
BLAST of Early growth response protein 1 vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 122.094 bits (305), Expect = 2.496e-29
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:  278 RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR 362          
BLAST of Early growth response protein 1 vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 122.479 bits (306), Expect = 2.551e-29
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:  305 RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR 389          
BLAST of Early growth response protein 1 vs. Ensembl Xenopus
Match: tbl1x (transducin beta like 1 X-linked [Source:Xenbase;Acc:XB-GENE-982285])

HSP 1 Score: 119.398 bits (298), Expect = 9.502e-29
Identity = 52/89 (58.43%), Postives = 64/89 (71.91%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R + C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C +C + F RSDE+ RH KIH R  ++
Sbjct:  259 RPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKER 347          

HSP 2 Score: 62.3882 bits (150), Expect = 6.659e-10
Identity = 29/57 (50.88%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1148 ERPFKCSI--CSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            ERP+ C    C R+FSRSD    HIR HTG KP+ C  C ++F+RSD  T H + HT
Sbjct:  258 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHT 314          
BLAST of Early growth response protein 1 vs. Ensembl Xenopus
Match: serpinb4 (serpin peptidase inhibitor, clade B (ovalbumin), member 4 [Source:Xenbase;Acc:XB-GENE-5787878])

HSP 1 Score: 119.013 bits (297), Expect = 9.720e-29
Identity = 52/83 (62.65%), Postives = 60/83 (72.29%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIH 1309
            R   C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C FC + F RSDE+ RH KIH
Sbjct:  270 RPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHAKIH 352          
BLAST of Early growth response protein 1 vs. Ensembl Xenopus
Match: usp31 (ubiquitin specific peptidase 31 [Source:Xenbase;Acc:XB-GENE-920956])

HSP 1 Score: 117.472 bits (293), Expect = 1.759e-27
Identity = 52/83 (62.65%), Postives = 61/83 (73.49%), Query Frame = 2
Query: 1067 FVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            F C    C RSF R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP++C  C + F RSDEK RH K+H +
Sbjct:  440 FACPVESCIRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHIRTHTGEKPFSCDLCGRRFARSDEKKRHGKVHMK 522          

HSP 2 Score: 63.1586 bits (152), Expect = 6.627e-10
Identity = 25/51 (49.02%), Postives = 36/51 (70.59%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEK 1237
            +C R+F R+D L  H+R HTGE+PF C +C R+F+RSD +K H + H  +K
Sbjct:  474 ICLRNFSRSDHLTTHIRTHTGEKPFSCDLCGRRFARSDEKKRHGKVHMKQK 524          
BLAST of Early growth response protein 1 vs. Ensembl Mouse
Match: Egr3 (early growth response 3 [Source:MGI Symbol;Acc:MGI:1306780])

HSP 1 Score: 121.324 bits (303), Expect = 1.090e-29
Identity = 53/89 (59.55%), Postives = 63/89 (70.79%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R   C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C FC + F RSDE+ RH KIH +  +K
Sbjct:  273 RPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEK 361          
BLAST of Early growth response protein 1 vs. Ensembl Mouse
Match: Egr3 (early growth response 3 [Source:MGI Symbol;Acc:MGI:1306780])

HSP 1 Score: 120.168 bits (300), Expect = 1.510e-29
Identity = 53/89 (59.55%), Postives = 63/89 (70.79%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R   C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C FC + F RSDE+ RH KIH +  +K
Sbjct:  235 RPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEK 323          
BLAST of Early growth response protein 1 vs. Ensembl Mouse
Match: Egr1 (early growth response 1 [Source:MGI Symbol;Acc:MGI:95295])

HSP 1 Score: 122.094 bits (305), Expect = 3.713e-29
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:  334 RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR 418          
BLAST of Early growth response protein 1 vs. Ensembl Mouse
Match: Egr1 (early growth response 1 [Source:MGI Symbol;Acc:MGI:95295])

HSP 1 Score: 122.094 bits (305), Expect = 3.713e-29
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:  334 RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR 418          
BLAST of Early growth response protein 1 vs. Ensembl Mouse
Match: Egr2 (early growth response 2 [Source:MGI Symbol;Acc:MGI:95296])

HSP 1 Score: 120.168 bits (300), Expect = 8.556e-29
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C +C + F RSDE+ RH KIH R
Sbjct:  335 RPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLR 419          

HSP 2 Score: 63.1586 bits (152), Expect = 3.675e-10
Identity = 29/57 (50.88%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1148 ERPFKCSI--CSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            ERP+ C    C R+FSRSD    HIR HTG KP+ C  C ++F+RSD  T H + HT
Sbjct:  334 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHT 390          
BLAST of Early growth response protein 1 vs. UniProt/SwissProt
Match: sp|P43300|EGR3_MOUSE (Early growth response protein 3 OS=Mus musculus OX=10090 GN=Egr3 PE=2 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 7.622e-29
Identity = 53/89 (59.55%), Postives = 63/89 (70.79%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R   C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C FC + F RSDE+ RH KIH +  +K
Sbjct:  273 RPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEK 361          
BLAST of Early growth response protein 1 vs. UniProt/SwissProt
Match: sp|Q06889|EGR3_HUMAN (Early growth response protein 3 OS=Homo sapiens OX=9606 GN=EGR3 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 8.079e-29
Identity = 53/89 (59.55%), Postives = 63/89 (70.79%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R   C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C FC + F RSDE+ RH KIH +  +K
Sbjct:  273 RPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEK 361          
BLAST of Early growth response protein 1 vs. UniProt/SwissProt
Match: sp|P43301|EGR3_RAT (Early growth response protein 3 OS=Rattus norvegicus OX=10116 GN=Egr3 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 8.481e-29
Identity = 53/89 (59.55%), Postives = 63/89 (70.79%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R   C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C FC + F RSDE+ RH KIH +  +K
Sbjct:  273 RPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKEK 361          
BLAST of Early growth response protein 1 vs. UniProt/SwissProt
Match: sp|P26632|EGR1_DANRE (Early growth response protein 1 OS=Danio rerio OX=7955 GN=egr1 PE=2 SV=2)

HSP 1 Score: 123.25 bits (308), Expect = 8.654e-29
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:  309 RPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMR 393          
BLAST of Early growth response protein 1 vs. UniProt/SwissProt
Match: sp|O73693|EGR1_TAEGU (Early growth response protein 1 (Fragment) OS=Taeniopygia guttata OX=59729 GN=EGR1 PE=3 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.080e-28
Identity = 50/76 (65.79%), Postives = 59/76 (77.63%), Query Frame = 2
Query: 1088 CERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR 76          

HSP 2 Score: 65.855 bits (159), Expect = 3.793e-11
Identity = 27/51 (52.94%), Postives = 36/51 (70.59%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEK 1237
            +C R+F R+D L  H+R HTGE+PF C IC R+F+RSD RK H + H  +K
Sbjct:   28 ICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 78          
BLAST of Early growth response protein 1 vs. TrEMBL
Match: V9LAP2 (E3 SUMO-protein ligase EGR2 (Fragment) OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.480e-28
Identity = 58/101 (57.43%), Postives = 71/101 (70.30%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK*VLTNSERFVLN 1363
            R + C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP++C FC + F RSDE+ RH KIH R  +K +  N+ER   N
Sbjct:   88 RPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHTKIHLRQKEKKI--NTERAPAN 186          
BLAST of Early growth response protein 1 vs. TrEMBL
Match: A0A4Y5FCE7 (Early growth response 1 (Fragment) OS=Acipenser sinensis OX=61970 GN=egr1 PE=4 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 6.846e-28
Identity = 53/89 (59.55%), Postives = 65/89 (73.03%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R + C   +C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R  +K
Sbjct:   19 RPYACPMEICDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHLRQKEK 107          
BLAST of Early growth response protein 1 vs. TrEMBL
Match: A0A4W3KIQ3 (Uncharacterized protein OS=Callorhinchus milii OX=7868 GN=egr2 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.543e-27
Identity = 58/101 (57.43%), Postives = 71/101 (70.30%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK*VLTNSERFVLN 1363
            R + C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP++C FC + F RSDE+ RH KIH R  +K +  N+ER   N
Sbjct:  302 RPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHTKIHLRQKEKKI--NTERAPAN 400          
BLAST of Early growth response protein 1 vs. TrEMBL
Match: A0A4Y5FCJ6 (Early growth response 1 (Fragment) OS=Acipenser stellatus OX=7903 GN=egr1 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.053e-27
Identity = 53/89 (59.55%), Postives = 64/89 (71.91%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R  +K
Sbjct:   19 RPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHLRQKEK 107          
BLAST of Early growth response protein 1 vs. TrEMBL
Match: A0A4Y5FDL8 (Early growth response 1 (Fragment) OS=Acipenser schrenckii OX=111304 GN=egr1 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 3.053e-27
Identity = 53/89 (59.55%), Postives = 64/89 (71.91%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R  +K
Sbjct:   19 RPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHLRQKEK 107          
BLAST of Early growth response protein 1 vs. Ensembl Cavefish
Match: egr2b (early growth response 2 [Source:NCBI gene;Acc:103046494])

HSP 1 Score: 121.709 bits (304), Expect = 1.114e-29
Identity = 57/102 (55.88%), Postives = 70/102 (68.63%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK---*VLTNSERFV 1357
            R + C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C FC + F RSDE+ RH KIH R  ++      +NSER +
Sbjct:  294 RPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTKIHLRQKERKSSAAPSNSERSI 395          

HSP 2 Score: 62.7734 bits (151), Expect = 3.379e-10
Identity = 29/57 (50.88%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1148 ERPFKCSI--CSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            ERP+ C    C R+FSRSD    HIR HTG KP+ C  C ++F+RSD  T H + HT
Sbjct:  293 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHT 349          
BLAST of Early growth response protein 1 vs. Ensembl Cavefish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:103036296])

HSP 1 Score: 122.094 bits (305), Expect = 2.358e-29
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:  316 RPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHLR 400          
BLAST of Early growth response protein 1 vs. Ensembl Cavefish
Match: egr3 (early growth response 3 [Source:NCBI gene;Acc:103035480])

HSP 1 Score: 119.398 bits (298), Expect = 8.850e-29
Identity = 51/85 (60.00%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R   C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP++C FC + F RSDE+ RH K+H +
Sbjct:  300 RPHACPAENCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLK 384          
BLAST of Early growth response protein 1 vs. Ensembl Cavefish
Match: EGR2 (early growth response protein 2b-like [Source:NCBI gene;Acc:103032442])

HSP 1 Score: 117.857 bits (294), Expect = 1.753e-28
Identity = 50/89 (56.18%), Postives = 62/89 (69.66%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R + C    C+R F R+DEL RH+R+HTG +PF+C IC R F RSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R  ++
Sbjct:  275 RPYPCPAEGCDRRFSRSDELARHVRVHTGHKPFQCRICMRSFGRSDHLTTHIRTHTGEKPFACDLCGRKFARSDERRRHAKIHQRQSER 363          

HSP 2 Score: 63.5438 bits (153), Expect = 1.940e-10
Identity = 29/57 (50.88%), Postives = 35/57 (61.40%), Query Frame = 2
Query: 1148 ERPFKCSI--CSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            ERP+ C    C R+FSRSD    H+R HTG KP+ C  C +SF RSD  T H + HT
Sbjct:  274 ERPYPCPAEGCDRRFSRSDELARHVRVHTGHKPFQCRICMRSFGRSDHLTTHIRTHT 330          
BLAST of Early growth response protein 1 vs. Ensembl Cavefish
Match: egr4 (early growth response protein 1-B [Source:NCBI gene;Acc:103025429])

HSP 1 Score: 115.161 bits (287), Expect = 6.320e-28
Identity = 48/85 (56.47%), Postives = 63/85 (74.12%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            + F C    CER F R+DEL RH+R+HTG RPF+C +CSR+F RSDH  TH+RTHTGEKP++C  C + F RSDE+ RH ++H +
Sbjct:  235 KPFPCPVENCERRFSRSDELNRHVRVHTGHRPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHARVHIK 319          
BLAST of Early growth response protein 1 vs. Ensembl Sea Lamprey
Match: egr4 (early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-080204-90])

HSP 1 Score: 116.316 bits (290), Expect = 1.591e-29
Identity = 51/86 (59.30%), Postives = 60/86 (69.77%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRS 1318
            R F C    C+R F R DEL RH+RIHTG +PF C IC R FSRSDH  TH+RTHTGEKP+ C FC + F RSDE+ RH +IH + 
Sbjct:  170 RPFPCPAEGCDRRFSRTDELTRHIRIHTGHKPFTCRICMRSFSRSDHLTTHVRTHTGEKPFACDFCGRRFARSDERKRHGRIHLKG 255          
BLAST of Early growth response protein 1 vs. Ensembl Sea Lamprey
Match: wt1a (WT1 transcription factor a [Source:ZFIN;Acc:ZDB-GENE-980526-558])

HSP 1 Score: 93.9745 bits (232), Expect = 1.485e-21
Identity = 49/97 (50.52%), Postives = 64/97 (65.98%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGE---RPFKCSICSRQFSRSDHRKTHIRTHTG---EKPYNCLF--CSKSFTRSDEKTRHEKIHTRSIQK 1327
            R + C++  C R F R+D+LKRH R HTG    +PF+C +C R+F+RSDH KTH RTHTG   EKP+ C +  C K F RSDE  RH  +H R++ K
Sbjct:  199 RPYQCDYKDCGRRFSRSDQLKRHQRRHTGVTGVKPFQCKMCDRKFARSDHLKTHTRTHTGKPSEKPFVCRWPNCQKKFARSDELVRHHNMHQRNVAK 295          
BLAST of Early growth response protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006002.1 (pep scaffold:Pmarinus_7.0:GL479218:16696:34135:-1 gene:ENSPMAG00000005404.1 transcript:ENSPMAT00000006002.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 2.103e-21
Identity = 43/77 (55.84%), Postives = 50/77 (64.94%), Query Frame = 2
Query: 1088 CERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRS 1318
            C R F R+D LK HMRIHTGE+P++C  C R FS+S   KTH R HTGEKPY C  C + F +S    RH K HT S
Sbjct:   10 CGREFVRSDALKAHMRIHTGEKPYRCGACGRAFSQSSGLKTHQRVHTGEKPYRCGVCGRVFAQSSHCNRHRKAHTVS 86          

HSP 2 Score: 72.4034 bits (176), Expect = 1.071e-14
Identity = 33/77 (42.86%), Postives = 46/77 (59.74%), Query Frame = 2
Query: 1058 FRHFVCNHP----LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTR 1276
            FR  +C  P    +C R+F      +RH R HTG+RP++C  C R FS+  + K H R+H GEKP+ C  C++ FTR
Sbjct:  136 FRANICERPFRCDVCSRAFAEYSNYRRHTRTHTGQRPYRCEACGRAFSKRSNMKRHQRSHKGEKPFGCDVCAQGFTR 212          

HSP 3 Score: 63.1586 bits (152), Expect = 1.742e-11
Identity = 26/65 (40.00%), Postives = 41/65 (63.08%), Query Frame = 2
Query: 1115 ELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIH 1309
            E + H R +  ERPF+C +CSR F+   + + H RTHTG++PY C  C ++F++     RH++ H
Sbjct:  131 EFRVHFRANICERPFRCDVCSRAFAEYSNYRRHTRTHTGQRPYRCEACGRAFSKRSNMKRHQRSH 195          

HSP 4 Score: 60.077 bits (144), Expect = 1.803e-10
Identity = 25/56 (44.64%), Postives = 37/56 (66.07%), Query Frame = 2
Query: 1145 GERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            G + ++C  C R+F RSD  K H+R HTGEKPY C  C ++F++S     H+++HT
Sbjct:    1 GRQQYECRQCGREFVRSDALKAHMRIHTGEKPYRCGACGRAFSQSSGLKTHQRVHT 56          

HSP 5 Score: 56.225 bits (134), Expect = 3.773e-9
Identity = 23/59 (38.98%), Postives = 38/59 (64.41%), Query Frame = 2
Query: 1088 CERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSK 1264
            C R+F ++  LK H R+HTGE+P++C +C R F++S H   H + HT    ++C  C++
Sbjct:   38 CGRAFSQSSGLKTHQRVHTGEKPYRCGVCGRVFAQSSHCNRHRKAHTVSHMHSCRQCTR 96          

HSP 6 Score: 52.7582 bits (125), Expect = 5.630e-8
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 2
Query: 1088 CERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNC 1249
            C R+F +   +KRH R H GE+PF C +C++ F+R  + K H+  H GE P  C
Sbjct:  178 CGRAFSKRSNMKRHQRSHKGEKPFGCDVCAQGFTRLCNLKVHLLKHAGEFPQIC 231          
BLAST of Early growth response protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007831.1 (pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 gene:ENSPMAG00000007084.1 transcript:ENSPMAT00000007831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 2.212e-21
Identity = 37/73 (50.68%), Postives = 52/73 (71.23%), Query Frame = 2
Query: 1082 PLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHE 1300
            PLC ++F ++ +L+ H R HTGE+PFKCS+C + FS+S + K H RTHTGEKP+ C  C K+FT S    +H+
Sbjct:   35 PLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTHTGEKPFKCTVCEKAFTESSPLRKHQ 107          

HSP 2 Score: 73.559 bits (179), Expect = 2.390e-16
Identity = 31/76 (40.79%), Postives = 52/76 (68.42%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            +CE++F ++  L  H+R HT  +PF+C +C + F++S   ++H RTHTGEKP+ C  C K+F++S    +H++ HT
Sbjct:   10 VCEKAFAQSSYLTIHLRTHT--KPFRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTHT 83          

HSP 3 Score: 60.077 bits (144), Expect = 1.298e-11
Identity = 25/57 (43.86%), Postives = 39/57 (68.42%), Query Frame = 2
Query: 1142 TGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            TGE+PFKC++C + F++S +   H+RTHT  KP+ C  C K+F +S +   H++ HT
Sbjct:    1 TGEKPFKCTVCEKAFAQSSYLTIHLRTHT--KPFRCPLCGKAFAKSSDLQSHQRTHT 55          
BLAST of Early growth response protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009831.1 (pep scaffold:Pmarinus_7.0:GL485667:2222:3316:-1 gene:ENSPMAG00000008891.1 transcript:ENSPMAT00000009831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.4261 bits (215), Expect = 4.011e-20
Identity = 34/77 (44.16%), Postives = 53/77 (68.83%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            +C ++F R + L  H R+H GE+P++CS+C   F+R++H ++H RTHTGEKP+ C  C K+F      + H++IHTR
Sbjct:   91 VCGKAFARPEALLSHQRVHMGEKPYRCSVCGMDFTRAEHLRSHHRTHTGEKPFRCATCGKAFAHPGTLSIHQRIHTR 167          

HSP 2 Score: 68.9366 bits (167), Expect = 7.824e-14
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTR-HEKIHTR 1315
            +C   F RA+ L+ H R HTGE+PF+C+ C + F+       H R HT E+PY C  C K+F  S      H+++H R
Sbjct:  119 VCGMDFTRAEHLRSHHRTHTGEKPFRCATCGKAFAHPGTLSIHQRIHTRERPYECGACGKAFAESSGALLVHQRVHAR 196          

HSP 3 Score: 57.3806 bits (137), Expect = 8.860e-10
Identity = 32/106 (30.19%), Postives = 42/106 (39.62%), Query Frame = 2
Query: 1082 PLCERSFQRADELKRHMRIHTGERPF-----------------------------KCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            PLC     +   L  H R H GE+PF                             KC +C + F+R +   +H R H GEKPY C  C   FTR++    H + HT
Sbjct:   33 PLCPYETDKPVALIGHQRTHVGEKPFECRACGEAFARSADLRAHQETAHGDGEAHKCDVCGKAFARPEALLSHQRVHMGEKPYRCSVCGMDFTRAEHLRSHHRTHT 138          
BLAST of Early growth response protein 1 vs. Ensembl Yeast
Match: MIG3 (Transcriptional regulator; partially nonfunctional in S288C strains but has a major role in catabolite repression and ethanol response in some other strains; involved in response to toxic agents; phosphorylation by Snf1p or the Mec1p pathway inactivates Mig3p, allowing induction of damage response genesenvironment [Source:SGD;Acc:S000000830])

HSP 1 Score: 79.7221 bits (195), Expect = 1.582e-16
Identity = 35/62 (56.45%), Postives = 45/62 (72.58%), Query Frame = 2
Query: 1148 ERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLF--CSKSFTRSDEKTRHEKIHTRSIQK 1327
            +RPF+C ICSR F R +H+K H RTHTGEKP+ C    C KSF+RSDE  RH + HT+ +Q+
Sbjct:   14 QRPFRCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQR 75          

HSP 2 Score: 62.003 bits (149), Expect = 7.779e-11
Identity = 30/58 (51.72%), Postives = 37/58 (63.79%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSI--CSRQFSRSDHRKTHIRTHT 1228
            R F C   +C R F R +  KRH R HTGE+P KC++  C + FSRSD  K H+RTHT
Sbjct:   15 RPFRCE--ICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHT 70          
BLAST of Early growth response protein 1 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 80.4925 bits (197), Expect = 2.472e-16
Identity = 35/76 (46.05%), Postives = 48/76 (63.16%), Query Frame = 2
Query: 1088 CERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            C+R F   + L +H R H+GE+P+KC IC+++F+ S   K HIRTHTGEKP  C  C K F  S   ++H K H +
Sbjct:  773 CKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQK 848          

HSP 2 Score: 69.707 bits (169), Expect = 5.327e-13
Identity = 31/75 (41.33%), Postives = 44/75 (58.67%), Query Frame = 2
Query: 1088 CERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            C R+F +  +L RH+++H+  +P+KC  C R FS  +    H RTH+GEKPY C  C+K F  S     H + HT
Sbjct:  745 CHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHT 819          

HSP 3 Score: 61.6178 bits (148), Expect = 1.984e-10
Identity = 28/62 (45.16%), Postives = 40/62 (64.52%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSF 1270
            +C + F  +  LK H+R HTGE+P +C IC ++F+ S +   HI+TH  +K Y C  CSKSF
Sbjct:  800 ICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTH--QKKYKCSDCSKSF 859          
BLAST of Early growth response protein 1 vs. Ensembl Yeast
Match: MIG2 (Zinc finger transcriptional repressor; cooperates with Mig1p in glucose-induced gene repression; under low glucose conditions relocalizes to mitochondrion, where it interacts with Ups1p, antagonizes mitochondrial fission factor Dnm1p, indicative of a role in mitochondrial fusion or regulating morphology; regulates filamentous growth in response to glucose depletion; activated in stochastic pulses of nuclear localization in response to low glucose [Source:SGD;Acc:S000003177])

HSP 1 Score: 76.2554 bits (186), Expect = 1.904e-15
Identity = 34/61 (55.74%), Postives = 43/61 (70.49%), Query Frame = 2
Query: 1151 RPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLF--CSKSFTRSDEKTRHEKIHTRSIQK 1327
            RPF+C  C R F R +H+K H+RTHTGEKP++C F  C KSF+RSDE  RH + HT   Q+
Sbjct:   15 RPFRCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQSQR 75          

HSP 2 Score: 63.5438 bits (153), Expect = 2.667e-11
Identity = 36/85 (42.35%), Postives = 44/85 (51.76%), Query Frame = 2
Query:  986 KWQEKFEKGNENIAXXXXXXXXXXFRHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSI--CSRQFSRSDHRKTHIRTHTGE 1234
            K Q  F   NEN             R F C+   C R F R +  KRH+R HTGE+P  C+   C + FSRSD  K H+RTHTG+
Sbjct:    3 KKQTNFPVDNEN-------------RPFRCD--TCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTHTGQ 72          
BLAST of Early growth response protein 1 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 75.0998 bits (183), Expect = 1.294e-14
Identity = 32/78 (41.03%), Postives = 45/78 (57.69%), Query Frame = 2
Query: 1082 PLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            P C R F +A  L+ H+R H G +PF C  C ++F++  + +TH R HTGEKPY+C  C K F+R      H   H +
Sbjct:  596 PYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQK 673          

HSP 2 Score: 68.5514 bits (166), Expect = 1.212e-12
Identity = 30/83 (36.14%), Postives = 49/83 (59.04%), Query Frame = 2
Query: 1058 FRHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLF--CSKSFTRSDEKTRHE 1300
            ++ FVC++  C + F +   L+ H R+HTGE+P+ C IC ++FSR  +   H+ TH   KP+ C    C+K+FT+      H+
Sbjct:  618 YKPFVCDY--CGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQ 698          

HSP 3 Score: 53.9138 bits (128), Expect = 4.141e-8
Identity = 21/51 (41.18%), Postives = 32/51 (62.75%), Query Frame = 2
Query: 1160 KCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            +C  C R FS++ H + H+R+H G KP+ C +C K FT+      HE++HT
Sbjct:  594 ECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHT 644          
BLAST of Early growth response protein 1 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 73.1738 bits (178), Expect = 4.213e-14
Identity = 39/92 (42.39%), Postives = 48/92 (52.17%), Query Frame = 2
Query: 1064 HFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNC---------LFCSKSFTRSDEKTRHEKIHT 1312
            +F C+  +C + F R   LK H+R HT ERPF CSIC + F+R   RK H   HTG+K Y C           C K F RSD   RH K  +
Sbjct:  568 NFACD--VCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTES 657          
BLAST of Early growth response protein 1 vs. Ensembl Nematostella
Match: EDO49112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGT8])

HSP 1 Score: 109.768 bits (273), Expect = 3.756e-29
Identity = 52/85 (61.18%), Postives = 60/85 (70.59%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C R F R+DEL RHMR HTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:    2 RPYACPVETCPRRFSRSDELTRHMRTHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRFARSDERRRHMKIHLR 86          

HSP 2 Score: 58.5362 bits (140), Expect = 4.586e-11
Identity = 25/50 (50.00%), Postives = 35/50 (70.00%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGE 1234
            +C R+F R+D L  H+R HTGE+PF C  C R+F+RSD R+ H++ H  E
Sbjct:   38 ICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRFARSDERRRHMKIHLRE 87          
BLAST of Early growth response protein 1 vs. Ensembl Nematostella
Match: EDO47692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLH7])

HSP 1 Score: 87.4261 bits (215), Expect = 1.281e-20
Identity = 38/76 (50.00%), Postives = 52/76 (68.42%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            +C +SF +A  L  H RIH+GE+PF+C +C RQFS+S    TH+RTH GE+PY C  C+K+F  S   T+H + HT
Sbjct:   26 VCLKSFTQAANLTAHFRIHSGEKPFRCRVCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSSTLTKHVRTHT 101          

HSP 2 Score: 82.0333 bits (201), Expect = 8.938e-19
Identity = 34/75 (45.33%), Postives = 49/75 (65.33%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIH 1309
            +C R F ++  +  HMR H GERP+KC +C++ F+ S     H+RTHTGEKPY C  C + F++S    RH++IH
Sbjct:   54 VCGRQFSQSSSVTTHMRTHNGERPYKCKVCNKAFADSSTLTKHVRTHTGEKPYQCEICHQRFSQSGNMNRHKRIH 128          

HSP 3 Score: 67.0106 bits (162), Expect = 1.664e-13
Identity = 26/71 (36.62%), Postives = 44/71 (61.97%), Query Frame = 2
Query: 1097 SFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIH 1309
            S+ R   L+ HMR H+G +P++C +C + F+++ +   H R H+GEKP+ C  C + F++S   T H + H
Sbjct:    2 SYARLSTLRLHMRTHSGVKPYQCMVCLKSFTQAANLTAHFRIHSGEKPFRCRVCGRQFSQSSSVTTHMRTH 72          

HSP 4 Score: 45.4394 bits (106), Expect = 5.424e-6
Identity = 19/43 (44.19%), Postives = 29/43 (67.44%), Query Frame = 2
Query: 1184 FSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            ++R    + H+RTH+G KPY C+ C KSFT++   T H +IH+
Sbjct:    3 YARLSTLRLHMRTHSGVKPYQCMVCLKSFTQAANLTAHFRIHS 45          
BLAST of Early growth response protein 1 vs. Ensembl Nematostella
Match: EDO45259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTG0])

HSP 1 Score: 86.2705 bits (212), Expect = 4.520e-20
Identity = 40/76 (52.63%), Postives = 51/76 (67.11%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
             C ++FQ    L+RHMR HTGE P+KC+ CSR F RS   + H+R HTGEKPY C  CS++F RS +  RH + HT
Sbjct:   39 FCSKAFQYPCYLRRHMRSHTGESPYKCTQCSRAFVRSTDLQRHLRNHTGEKPYKCKECSRAFARSTDLKRHMRTHT 114          

HSP 2 Score: 85.8853 bits (211), Expect = 4.746e-20
Identity = 40/74 (54.05%), Postives = 52/74 (70.27%), Query Frame = 2
Query: 1088 CERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIH 1309
            C R+F R+ +L+RH+R HTGE+P+KC  CSR F+RS   K H+RTHTGEKPY C  CSK+F++S     H   H
Sbjct:   68 CSRAFVRSTDLQRHLRNHTGEKPYKCKECSRAFARSTDLKRHMRTHTGEKPYKCWQCSKAFSQSGSLQTHLHTH 141          

HSP 3 Score: 56.225 bits (134), Expect = 1.055e-9
Identity = 32/79 (40.51%), Postives = 45/79 (56.96%), Query Frame = 2
Query: 1088 CERSFQRADELKRHMRI----HTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            C + F     L RH++      TG R +KCS CS+ F    + + H+R+HTGE PY C  CS++F RS +  RH + HT
Sbjct:    9 CGKIFAYQSYLDRHVKYVCPDKTG-RTWKCSFCSKAFQYPCYLRRHMRSHTGESPYKCTQCSRAFVRSTDLQRHLRNHT 86          
BLAST of Early growth response protein 1 vs. Ensembl Nematostella
Match: EDO43181 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ74])

HSP 1 Score: 85.8853 bits (211), Expect = 5.223e-20
Identity = 36/77 (46.75%), Postives = 50/77 (64.94%), Query Frame = 2
Query: 1082 PLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            P+C R F ++  L+ H R+HTG++P+KC +C R FS S   K H+RTHTGEKP+ C  C+K F       +HE+ HT
Sbjct:   25 PICGRPFAQSSGLESHKRVHTGQKPYKCEVCERGFSHSSAVKNHMRTHTGEKPFQCPICNKKFADQSTVKKHERTHT 101          

HSP 2 Score: 77.7962 bits (190), Expect = 3.146e-17
Identity = 34/73 (46.58%), Postives = 46/73 (63.01%), Query Frame = 2
Query: 1094 RSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            + + RA  LK H R+HTGE+PFKC IC R F++S   ++H R HTG+KPY C  C + F+ S     H + HT
Sbjct:    1 KKYARAFTLKTHQRVHTGEKPFKCPICGRPFAQSSGLESHKRVHTGQKPYKCEVCERGFSHSSAVKNHMRTHT 73          

HSP 3 Score: 72.0182 bits (175), Expect = 3.955e-15
Identity = 32/71 (45.07%), Postives = 44/71 (61.97%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRH 1297
            +CER F  +  +K HMR HTGE+PF+C IC+++F+     K H RTHTG KP+ C  C   FT+     +H
Sbjct:   54 VCERGFSHSSAVKNHMRTHTGEKPFQCPICNKKFADQSTVKKHERTHTGIKPFTCPECGLKFTQIGNMNKH 124          
BLAST of Early growth response protein 1 vs. Ensembl Nematostella
Match: EDO49116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU6])

HSP 1 Score: 84.3445 bits (207), Expect = 3.168e-19
Identity = 38/75 (50.67%), Postives = 52/75 (69.33%), Query Frame = 2
Query: 1088 CERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            C ++F  A  LK H RIHTGE+P+ C+ICSR F++  + + HI THTGEKP+ C +C K+F  S +  RH +IHT
Sbjct:   37 CPKAFALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVRIHT 111          

HSP 2 Score: 79.7221 bits (195), Expect = 1.415e-17
Identity = 36/74 (48.65%), Postives = 50/74 (67.57%), Query Frame = 2
Query: 1088 CERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIH 1309
            C ++F  + +L+RH+RIHTGERP+KC  CS+ F+ S + ++HI THTGEKPY C  C+  F  S     H +IH
Sbjct:   93 CPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFTTSGNLQSHILTHTGEKPYKCSICNWKFISSSNLRTHIRIH 166          

HSP 3 Score: 75.8702 bits (185), Expect = 2.735e-16
Identity = 35/82 (42.68%), Postives = 48/82 (58.54%), Query Frame = 2
Query: 1067 FVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            + C H  C + F R+   +RH+ IHTG++P+KC  C + F+ + H K H R HTGEKPY C  CS+ F +     RH   HT
Sbjct:    4 YTCQH--CSKVFTRSWNFQRHVLIHTGQKPYKCQKCPKAFALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRHILTHT 83          

HSP 4 Score: 75.0998 bits (183), Expect = 5.067e-16
Identity = 36/82 (43.90%), Postives = 48/82 (58.54%), Query Frame = 2
Query: 1067 FVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            + CN  +C R F +   L+RH+  HTGE+P KC+ C + F  S   + H+R HTGE+PY C  CSK+FT S     H   HT
Sbjct:   60 YTCN--ICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFTTSGNLQSHILTHT 139          

HSP 5 Score: 49.6766 bits (117), Expect = 3.089e-7
Identity = 22/55 (40.00%), Postives = 34/55 (61.82%), Query Frame = 2
Query: 1148 ERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            ++P+ C  CS+ F+RS + + H+  HTG+KPY C  C K+F  +     H +IHT
Sbjct:    1 DKPYTCQHCSKVFTRSWNFQRHVLIHTGQKPYKCQKCPKAFALAAHLKIHNRIHT 55          
BLAST of Early growth response protein 1 vs. Ensembl Medaka
Match: ENSORLT00000000940.2 (early growth response protein 1 [Source:NCBI gene;Acc:101160576])

HSP 1 Score: 121.324 bits (303), Expect = 2.034e-29
Identity = 53/85 (62.35%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R  VC    CER F R+DEL RH+R+HTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:  281 RPHVCPADGCERRFSRSDELTRHVRVHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFPCSECGRKFARSDERKRHAKIHQR 365          
BLAST of Early growth response protein 1 vs. Ensembl Medaka
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100272163])

HSP 1 Score: 122.094 bits (305), Expect = 2.194e-29
Identity = 52/85 (61.18%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG++PF+C IC R FSRSDH  THIRTHTGEKP+ C  C + F RSDE+ RH KIH R
Sbjct:  311 RPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHLR 395          
BLAST of Early growth response protein 1 vs. Ensembl Medaka
Match: ENSORLT00000034291.1 (early growth response protein 2b [Source:NCBI gene;Acc:101164744])

HSP 1 Score: 119.783 bits (299), Expect = 3.256e-29
Identity = 53/89 (59.55%), Postives = 64/89 (71.91%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R + C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP++C  C + F RSDE+ RH KIH R  +K
Sbjct:  302 RPYPCPAESCDRRFSRSDELSRHLRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFSCQQCGRKFARSDERRRHMKIHLRQKEK 390          

HSP 2 Score: 61.2326 bits (147), Expect = 1.067e-9
Identity = 27/57 (47.37%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1148 ERPFKCSI--CSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            +RP+ C    C R+FSRSD    H+R HTG KP+ C  C ++F+RSD  T H + HT
Sbjct:  301 QRPYPCPAESCDRRFSRSDELSRHLRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHT 357          
BLAST of Early growth response protein 1 vs. Ensembl Medaka
Match: egr2b (early growth response 2 [Source:NCBI gene;Acc:101170128])

HSP 1 Score: 120.168 bits (300), Expect = 5.223e-29
Identity = 53/85 (62.35%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R + C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP+ C FC + F RSDE+ RH KIH R
Sbjct:  328 RPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTKIHLR 412          

HSP 2 Score: 64.3142 bits (155), Expect = 1.245e-10
Identity = 26/51 (50.98%), Postives = 35/51 (68.63%), Query Frame = 2
Query: 1085 LCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEK 1237
            +C R+F R+D L  H+R HTGE+PF C  C R+F+RSD RK H + H  +K
Sbjct:  364 ICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTKIHLRQK 414          

HSP 3 Score: 62.7734 bits (151), Expect = 4.310e-10
Identity = 29/57 (50.88%), Postives = 36/57 (63.16%), Query Frame = 2
Query: 1148 ERPFKCSI--CSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHT 1312
            ERP+ C    C R+FSRSD    HIR HTG KP+ C  C ++F+RSD  T H + HT
Sbjct:  327 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHT 383          
BLAST of Early growth response protein 1 vs. Ensembl Medaka
Match: egr3 (early growth response 3 [Source:NCBI gene;Acc:100272164])

HSP 1 Score: 119.013 bits (297), Expect = 8.652e-29
Identity = 51/85 (60.00%), Postives = 62/85 (72.94%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            R   C    C+R F R+DEL RH+RIHTG +PF+C IC R FSRSDH  THIRTHTGEKP++C FC + F RSDE+ RH K+H +
Sbjct:  294 RPHACPAENCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLK 378          
BLAST of Early growth response protein 1 vs. Planmine SMEST
Match: SMESG000019723.1 (SMESG000019723.1)

HSP 1 Score: 442.195 bits (1136), Expect = 1.418e-150
Identity = 226/229 (98.69%), Postives = 227/229 (99.13%), Query Frame = 2
Query:  650 MKNESLTNIDMELIDVGNASFDYFIDSQSIYSTCSWFDELLISSTNIVDDIDVEKLLDFEIEDQKNSFKSTDDTSLRYSNSCPASYCYSPNCFGSDSPVFDKIINSERSNQTKWQEKFEKGNENIAXXXXXXXXXXFRHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK*VL 1336
            MKNESLTNIDMELIDVGNASFDYFIDSQSIYSTCSWFDELLISSTNIVDDIDVEKLLDFEIEDQKNSFKSTDDTSLRYSNSCPASYCYSPNCFGSDS VFDKIINSERSNQTKWQEKFEKGNENIAKKLRNKKIKKFRHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK V+
Sbjct:    1 MKNESLTNIDMELIDVGNASFDYFIDSQSIYSTCSWFDELLISSTNIVDDIDVEKLLDFEIEDQKNSFKSTDDTSLRYSNSCPASYCYSPNCFGSDSSVFDKIINSERSNQTKWQEKFEKGNENIAKKLRNKKIKKFRHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQKNVV 229          
BLAST of Early growth response protein 1 vs. Planmine SMEST
Match: SMESG000005384.1 (SMESG000005384.1)

HSP 1 Score: 119.398 bits (298), Expect = 5.080e-29
Identity = 53/83 (63.86%), Postives = 62/83 (74.70%), Query Frame = 2
Query: 1067 FVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTR 1315
            + CN   C ++F R+DEL RH RIH+GE+PFKCS C R FSRSDH  THIRTHTGEKPY C  C K F RSDE+ RH KIH++
Sbjct:  243 YQCNEKNCSKTFSRSDELTRHKRIHSGEKPFKCSKCERCFSRSDHLATHIRTHTGEKPYFCSICDKRFARSDERKRHLKIHSK 325          
BLAST of Early growth response protein 1 vs. Planmine SMEST
Match: SMESG000004840.1 (SMESG000004840.1)

HSP 1 Score: 115.161 bits (287), Expect = 4.784e-28
Identity = 48/86 (55.81%), Postives = 63/86 (73.26%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRS 1318
            + F+CN+  C R F R+DEL RH+R+H+G +P+ C  C ++F+RSDH KTH RTHTGE+P+ C  C K F RSDEK+RH K HTR 
Sbjct:  211 KQFICNYESCRRKFNRSDELNRHLRVHSGIKPYTCEFCFKKFARSDHLKTHRRTHTGERPFECEVCHKKFARSDEKSRHVKTHTRG 296          
BLAST of Early growth response protein 1 vs. Planmine SMEST
Match: SMESG000028801.1 (SMESG000028801.1)

HSP 1 Score: 110.153 bits (274), Expect = 1.413e-26
Identity = 52/89 (58.43%), Postives = 61/89 (68.54%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R+F C    C   F R DELKRH +IH+GE+P  C  C + F RSDHR THIRTHTGEKPY+C  CSK F RSDEK RH++IH +   K
Sbjct:  176 RNFPCE--FCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKRIHLKEKSK 262          
BLAST of Early growth response protein 1 vs. Planmine SMEST
Match: SMESG000028801.1 (SMESG000028801.1)

HSP 1 Score: 110.153 bits (274), Expect = 1.998e-26
Identity = 52/89 (58.43%), Postives = 61/89 (68.54%), Query Frame = 2
Query: 1061 RHFVCNHPLCERSFQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNCLFCSKSFTRSDEKTRHEKIHTRSIQK 1327
            R+F C    C   F R DELKRH +IH+GE+P  C  C + F RSDHR THIRTHTGEKPY+C  CSK F RSDEK RH++IH +   K
Sbjct:  201 RNFPCE--FCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKRIHLKEKSK 287          
The following BLAST results are available for this feature:
BLAST of Early growth response protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EGR31.682e-2959.55early growth response 3 [Source:HGNC Symbol;Acc:HG... [more]
EGR31.918e-2959.55early growth response 3 [Source:HGNC Symbol;Acc:HG... [more]
EGR14.838e-2961.18early growth response 1 [Source:HGNC Symbol;Acc:HG... [more]
EGR21.545e-2861.18early growth response 2 [Source:HGNC Symbol;Acc:HG... [more]
EGR21.545e-2861.18early growth response 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Early growth response protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egrh-21.671e-3060.47EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-21.943e-3060.47EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-24.162e-3060.47EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-24.756e-3060.47EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-15.841e-2858.14EGR (Early Growth factor Response factor) Homolog ... [more]
back to top
BLAST of Early growth response protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sr2.526e-3060.00gene:FBgn0003499 transcript:FBtr0083542[more]
sr4.225e-3060.00gene:FBgn0003499 transcript:FBtr0330050[more]
sr1.642e-2860.00gene:FBgn0003499 transcript:FBtr0301615[more]
sr2.082e-2860.00gene:FBgn0003499 transcript:FBtr0344633[more]
sr2.082e-2860.00gene:FBgn0003499 transcript:FBtr0083543[more]
back to top
BLAST of Early growth response protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr11.146e-2961.18early growth response 1 [Source:NCBI gene;Acc:3049... [more]
egr11.146e-2961.18early growth response 1 [Source:NCBI gene;Acc:3049... [more]
egr2a1.557e-2962.35early growth response 2a [Source:ZFIN;Acc:ZDB-GENE... [more]
egr2a1.557e-2962.35early growth response 2a [Source:ZFIN;Acc:ZDB-GENE... [more]
egr2b2.400e-2962.35early growth response 2b [Source:NCBI gene;Acc:301... [more]
back to top
BLAST of Early growth response protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr12.496e-2961.18early growth response 1 [Source:NCBI gene;Acc:1000... [more]
egr12.551e-2961.18early growth response 1 [Source:NCBI gene;Acc:1000... [more]
tbl1x9.502e-2958.43transducin beta like 1 X-linked [Source:Xenbase;Ac... [more]
serpinb49.720e-2962.65serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
usp311.759e-2762.65ubiquitin specific peptidase 31 [Source:Xenbase;Ac... [more]
back to top
BLAST of Early growth response protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Egr31.090e-2959.55early growth response 3 [Source:MGI Symbol;Acc:MGI... [more]
Egr31.510e-2959.55early growth response 3 [Source:MGI Symbol;Acc:MGI... [more]
Egr13.713e-2961.18early growth response 1 [Source:MGI Symbol;Acc:MGI... [more]
Egr13.713e-2961.18early growth response 1 [Source:MGI Symbol;Acc:MGI... [more]
Egr28.556e-2961.18early growth response 2 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Early growth response protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P43300|EGR3_MOUSE7.622e-2959.55Early growth response protein 3 OS=Mus musculus OX... [more]
sp|Q06889|EGR3_HUMAN8.079e-2959.55Early growth response protein 3 OS=Homo sapiens OX... [more]
sp|P43301|EGR3_RAT8.481e-2959.55Early growth response protein 3 OS=Rattus norvegic... [more]
sp|P26632|EGR1_DANRE8.654e-2961.18Early growth response protein 1 OS=Danio rerio OX=... [more]
sp|O73693|EGR1_TAEGU1.080e-2865.79Early growth response protein 1 (Fragment) OS=Taen... [more]
back to top
BLAST of Early growth response protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V9LAP25.480e-2857.43E3 SUMO-protein ligase EGR2 (Fragment) OS=Callorhi... [more]
A0A4Y5FCE76.846e-2859.55Early growth response 1 (Fragment) OS=Acipenser si... [more]
A0A4W3KIQ32.543e-2757.43Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A4Y5FCJ63.053e-2759.55Early growth response 1 (Fragment) OS=Acipenser st... [more]
A0A4Y5FDL83.053e-2759.55Early growth response 1 (Fragment) OS=Acipenser sc... [more]
back to top
BLAST of Early growth response protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr2b1.114e-2955.88early growth response 2 [Source:NCBI gene;Acc:1030... [more]
egr12.358e-2961.18early growth response 1 [Source:NCBI gene;Acc:1030... [more]
egr38.850e-2960.00early growth response 3 [Source:NCBI gene;Acc:1030... [more]
EGR21.753e-2856.18early growth response protein 2b-like [Source:NCBI... [more]
egr46.320e-2856.47early growth response protein 1-B [Source:NCBI gen... [more]
back to top
BLAST of Early growth response protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr41.591e-2959.30early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
wt1a1.485e-2150.52WT1 transcription factor a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000006002.12.103e-2155.84pep scaffold:Pmarinus_7.0:GL479218:16696:34135:-1 ... [more]
ENSPMAT00000007831.12.212e-2150.68pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 g... [more]
ENSPMAT00000009831.14.011e-2044.16pep scaffold:Pmarinus_7.0:GL485667:2222:3316:-1 ge... [more]
back to top
BLAST of Early growth response protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MIG31.582e-1656.45Transcriptional regulator; partially nonfunctional... [more]
ZAP12.472e-1646.05Zinc-regulated transcription factor; binds to zinc... [more]
MIG21.904e-1555.74Zinc finger transcriptional repressor; cooperates ... [more]
AZF11.294e-1441.03Zinc-finger transcription factor; involved in diau... [more]
CRZ14.213e-1442.39Transcription factor, activates transcription of s... [more]
back to top
BLAST of Early growth response protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491123.756e-2961.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476921.281e-2050.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452594.520e-2052.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431815.223e-2046.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491163.168e-1950.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Early growth response protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000940.22.034e-2962.35early growth response protein 1 [Source:NCBI gene;... [more]
egr12.194e-2961.18early growth response 1 [Source:NCBI gene;Acc:1002... [more]
ENSORLT00000034291.13.256e-2959.55early growth response protein 2b [Source:NCBI gene... [more]
egr2b5.223e-2962.35early growth response 2 [Source:NCBI gene;Acc:1011... [more]
egr38.652e-2960.00early growth response 3 [Source:NCBI gene;Acc:1002... [more]
back to top
BLAST of Early growth response protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019723.11.418e-15098.69SMESG000019723.1[more]
SMESG000005384.15.080e-2963.86SMESG000005384.1[more]
SMESG000004840.14.784e-2855.81SMESG000004840.1[more]
SMESG000028801.11.413e-2658.43SMESG000028801.1[more]
SMESG000028801.11.998e-2658.43SMESG000028801.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013207 ID=SMED30013207|Name=Early growth response protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1587bp
CAGGTCTGAAGGGGTTAAAAATGATGAGACTTTAACGTTTGAACTTTTGA
ATAGGATTTGAAATATGTGTGAAGGACTTAGTAAATAACAGTTTTTCATT
TAGGCCATCTAAATCTCAAAAGTCATCAATTACTAACAAAAATATTTACA
AACTTCTCGTGATAAAAAATACCACAAAATAGAATAGAAATTTACTAAAC
ACCCCCGTGCTAATTTTATAGAGTACATTTATTTTCCCTCATTCTATGAT
GGCATTATCTCGGCAAACAGACTGGCGAATGCCTGTACAGAAACAGCCCC
ATGACGCCAACCCCGTTGAAAGAATACGAAATGAACTCAAATTCATAAAA
TAACAAGCTGACTGATGGAAATATTTTCTCATTCAAATATCATTTCTCTT
CAAAATATTTATTATTTTTCTTCGAATTTTCTTTTTCAATTTAAGAGAAT
CAAATTTCCCCACTACAAATAGTCAAACTGAATAAAGTGTATCGCTGAAT
AGTTTTCATTCATTGACTATTGTTGTAAATTTCTATTGGACACCGAGTTA
ATCATGTCTTTATTTGGACATAACTGATTCTAAATTTAGTAACTATACGA
TTGTAGTATTTATTAATGTTATTCGAAAATCTCCATCATTCCTAAAAACA
TGAAGAACGAAAGTCTGACAAACATTGACATGGAATTAATTGATGTCGGA
AATGCCAGTTTTGACTATTTCATAGACAGTCAATCTATTTATTCGACATG
TAGCTGGTTTGACGAGCTGTTGATTTCTTCAACCAATATTGTCGACGACA
TAGACGTTGAAAAACTTCTGGACTTTGAAATTGAAGATCAGAAAAACAGT
TTCAAATCAACTGACGATACTTCATTGCGATATTCAAACAGTTGCCCAGC
TTCGTATTGTTATAGCCCGAACTGTTTCGGTTCTGACTCCCCTGTATTTG
ATAAAATTATCAATTCAGAAAGAAGCAATCAAACCAAATGGCAGGAAAAA
TTTGAGAAAGGAAACGAAAATATCGCCAAAAAATTAAGAAATAAAAAAAT
CAAGAAATTTCGACATTTTGTTTGCAATCATCCCCTTTGTGAAAGGTCAT
TTCAGAGAGCTGATGAATTAAAGCGACATATGAGAATACATACTGGTGAA
AGACCATTCAAATGTTCAATTTGTTCGCGGCAATTTTCTCGCAGTGATCA
CAGAAAGACACATATTCGTACACATACTGGGGAAAAACCATACAATTGTT
TATTTTGTTCAAAATCTTTCACCCGGTCTGATGAGAAGACACGCCATGAA
AAGATCCATACAAGATCCATTCAGAAGTAAGTGCTAACCAACTCAGAAAG
GTTTGTTCTTAACATCTAGTGAAAAATAGTAATATTTATTAATTTGCAAA
TATTTAAAAAATTTTCAAATCAAATTTGTTATTTTTATGAAGATTTTGGT
ATTTTTTTTAAATCATGACTAAATTGTATCATCTTGCAATATTTTTACTC
GGAATGAATTTTTGTGTTATTTTAAACGAAAATATGTATTTGTCTGTGTT
TTTATTTTACATTTGGTAATTATTATATTTATAAATA
back to top

protein sequence of SMED30013207-orf-1

>SMED30013207-orf-1 ID=SMED30013207-orf-1|Name=SMED30013207-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=227bp
MKNESLTNIDMELIDVGNASFDYFIDSQSIYSTCSWFDELLISSTNIVDD
IDVEKLLDFEIEDQKNSFKSTDDTSLRYSNSCPASYCYSPNCFGSDSPVF
DKIINSERSNQTKWQEKFEKGNENIAKKLRNKKIKKFRHFVCNHPLCERS
FQRADELKRHMRIHTGERPFKCSICSRQFSRSDHRKTHIRTHTGEKPYNC
LFCSKSFTRSDEKTRHEKIHTRSIQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003677DNA binding
GO:0008270zinc ion binding
GO:0010385double-stranded methylated DNA binding
GO:0043565sequence-specific DNA binding
GO:0044729hemi-methylated DNA-binding
GO:1990841promoter-specific chromatin binding
Vocabulary: biological process
TermDefinition
GO:0032922circadian regulation of gene expression
GO:0045893positive regulation of transcription, DNA-templated
GO:0048511rhythmic process
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0043010camera-type eye development
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0048703embryonic viscerocranium morphogenesis
GO:0060059embryonic retina morphogenesis in camera-type eye
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 140..164
e-value: 0.0042
score: 26.3
coord: 170..192
e-value: 0.015
score: 24.5
coord: 198..220
e-value: 0.058
score: 22.5
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 140..164
e-value: 4.8E-5
score: 23.6
coord: 170..192
e-value: 4.2E-4
score: 20.6
coord: 198..220
e-value: 0.013
score: 16.0
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 200..220
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 172..192
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 142..164
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 170..197
score: 15.625
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 140..169
score: 16.186
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 198..225
score: 11.115
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 169..192
e-value: 4.3E-15
score: 57.2
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 193..222
e-value: 7.6E-12
score: 47.0
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 138..168
e-value: 2.4E-12
score: 48.4
NoneNo IPR availablePANTHERPTHR23235:SF60STRIPE, ISOFORM Dcoord: 140..223
NoneNo IPR availablePANTHERPTHR23235TRANSCRIPTION FACTOR SP3coord: 140..223
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 140..173
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 164..216