TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30013205
Length (bp)11006
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30013205) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30013205) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30013205) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30013205) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013205

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30013205 SmedASXL_016888SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30013205 SmedASXL_078771SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30013205SMESG000077214.1 SmedASXL_018653SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30013205SMESG000035332.1 SMESG000031365.1 SMESG000077214.1 SMESG000075241.1 SMESG000075191.1 dd_Smed_v4_168_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013205SMESG000035332.1 SMESG000031365.1 SMESG000077214.1 SMESG000075241.1 SMESG000075191.1 dd_Smed_v4_168_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013205SMESG000035332.1 SMESG000031365.1 SMESG000077214.1 SMESG000075241.1 SMESG000075191.1 dd_Smed_v4_168_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013205SMESG000035332.1 SMESG000031365.1 SMESG000077214.1 SMESG000075241.1 SMESG000075191.1 dd_Smed_v4_168_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013205SMESG000035332.1 SMESG000031365.1 SMESG000077214.1 SMESG000075241.1 SMESG000075191.1 dd_Smed_v4_168_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013205SMESG000035332.1 SMESG000031365.1 SMESG000077214.1 SMESG000075241.1 SMESG000075191.1 dd_Smed_v4_168_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013205SMESG000035332.1 SMESG000031365.1 SMESG000077214.1 SMESG000075241.1 SMESG000075191.1 dd_Smed_v4_168_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013205SMESG000035332.1 SMESG000031365.1 SMESG000077214.1 SMESG000075241.1 SMESG000075191.1 dd_Smed_v4_168_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013205SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 SMESG000037745.1 Contig43287uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013205SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 SMESG000037745.1 Contig43287newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013205 Contig47359newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013205 Contig47359uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013205 Contig45152uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013205 Contig45152newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 156.377 bits (394), Expect = 3.629e-39
Identity = 129/456 (28.29%), Postives = 218/456 (47.81%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHL-NQCRYKRKPCEK--CQQPISESEEKQH-ENVCEERRTRCEYCN-----ITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXX---XXXXXXEIESHKILMTEIFNTRESF-ELAR-IGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPY----IWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM---SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            +E + +C  C  +L  P+QTECG R C  C+  L  +   +C  C+E+ +    +  +D    REI+ ++I C N  + C  +  +     HL N C ++  PC +  C++ +   + + H E  C+ R   C +C      I      +Q E  +V++ K       +    C  E EIE ++   R +  +I                  +Q V ++  E LK     ++   Q       +K  +ES +  +TE+ +  +S  ++AR  G+ E++ +  ++M  L  H  +L       +    A Y    IW+I ++ R+ Q A  G  +S+ S PFY+   GYK+  RVY NGDG GK TH+S+FFV+++GE+D L  WPF  K+   +M   S++    +  KPD  +  + KPT ++  A G P  + Q V+    Y++ DT+F+K  V
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKD--KVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQVSLLQNE--SVEKNKSIQSLHNQI---CSFEIEIERQKEMLRNNESKIL----------------HLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQM--LSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 477          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 150.599 bits (379), Expect = 3.919e-37
Identity = 123/493 (24.95%), Postives = 220/493 (44.62%), Query Frame = 2
Query: 1394 QIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEI----ASLGETQE---DRAASREIMNMRIKCPNKPCNWEGKIREASA---------------------------HL-NQCRYKRKPCEKCQQPISESEEKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCP-NKCGVEEEIE-----------LKEHWERCSRKRIEC-PM----AKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXE--IESHKI--LMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM--SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPR---IMRQNVMWEYLEGDTLFVKWSV 2686
            ++EA+  C AC  +L+ P Q +CG R C+ C+  +  +GP+ C  C    I     S+ E+     D AA RE+ ++   CP+  C W+G ++E  +                           HL ++C  +   C  C+ P   ++ K H  VC +    C+ C   +  ++  Q+HV     K C + R  C  +  G  E +E           L+EH        +E  P+    +  G ++ + R E+++    T E  + +    ++ +         +  ++  KI  L +++     S  L  + M++ E+ V            ++ + T  G       +IW+I +F RK Q A  G   +I SP FY+ + GYK+ +R+Y NGDG G+ TH+S+FFV++KG  D L  WPF+ K+   ++  + ++  ++  +PD  +  + +P  D+  A G P    + +      Y+  D +F+K  V
Sbjct:   27 KLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHV-----KTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSEL-LQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKV-----------LEMEASTYDGV------FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 143.665 bits (361), Expect = 1.815e-34
Identity = 124/511 (24.27%), Postives = 224/511 (43.84%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHL-NQCRYKRKPCEK--CQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEI-------ELKEHWERCSRKRIECPMAKWGC----KIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETE--KNVENEMKRLREHYQKLRSYTPTGE---------------------------------NPPIAPYIWRIEEFTRKWQ-------------RARD----------GTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM---SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            +E + +C  C  +L  P+QTECG R C  C+  L  +   +C  C+E+ +    +  +D    REI+ ++I C N  + C  +  +     HL N C ++  PC +  C++ +   + + H E  C+ R   C +C       Q+    +   E+  C      CP+KC V+  +       ++K H    + + +   + +W      K+ +L+ E+++  +     H +I               +IEIE  K ++    N  +   L R+  S+ E  K ++ E++  R+++++  S   + E                                 +  ++ +  R+ +   ++Q             + RD          G  +S+ S PFY+   GYK+  RVY NGDG GK TH+S+FFV+++GE+D L  WPF  K+   +M   S++    +  KPD  +  + KPT ++  A G P  + Q V+    Y++ DT+F+K  V
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKD--KVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCK-----SQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNL-LKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQIC------------SFEIEIERQKEMLRN--NESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 535          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 143.665 bits (361), Expect = 1.815e-34
Identity = 124/511 (24.27%), Postives = 224/511 (43.84%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHL-NQCRYKRKPCEK--CQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEI-------ELKEHWERCSRKRIECPMAKWGC----KIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETE--KNVENEMKRLREHYQKLRSYTPTGE---------------------------------NPPIAPYIWRIEEFTRKWQ-------------RARD----------GTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM---SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            +E + +C  C  +L  P+QTECG R C  C+  L  +   +C  C+E+ +    +  +D    REI+ ++I C N  + C  +  +     HL N C ++  PC +  C++ +   + + H E  C+ R   C +C       Q+    +   E+  C      CP+KC V+  +       ++K H    + + +   + +W      K+ +L+ E+++  +     H +I               +IEIE  K ++    N  +   L R+  S+ E  K ++ E++  R+++++  S   + E                                 +  ++ +  R+ +   ++Q             + RD          G  +S+ S PFY+   GYK+  RVY NGDG GK TH+S+FFV+++GE+D L  WPF  K+   +M   S++    +  KPD  +  + KPT ++  A G P  + Q V+    Y++ DT+F+K  V
Sbjct:   47 VEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKD--KVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCK-----SQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNL-LKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQIC------------SFEIEIERQKEMLRN--NESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 535          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 133.65 bits (335), Expect = 3.460e-31
Identity = 119/518 (22.97%), Postives = 223/518 (43.05%), Query Frame = 2
Query: 1394 QIEARLRCGACTKLLKEPRQTECGCRLCTECIIEL-TLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRI-----------------------------KCPNKPCNWEGKIREASAHLN-QCRYKRKPC----------------------------EKCQQPISESEEKQHENVCEERRTRCEY----CNITETWKQIQQ-------EHV------NVK-EEKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGC---KIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM--SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPRIMRQNVMWE----YLEGDTLFVKWSV 2686
            ++E R +C  C  +L  P QT CG R C  CI+ L  LN    CP   + E+    E  +D    RE++N+ +                             +C N+ C      ++   HL+  C+++++ C                              C + I ++E  +H  VC E    C +    C +T+  + +QQ       EH+      NV+ EE+I D  +     +  +++  E  +  E+   K+      K G     I++      +     A+ H  + M   +     +  +   +++ K  +T + N  +   +     ++ + ++     +L ++ ++ +    T  N  +   IW++ ++  K + A DG  VSI S  FY+ + GY+L  R Y NGDG+G+ +H+S++FV+++GE+D L  WPF  ++   ++  S K   +E  KPD  +  + +P  ++  A G PR +  +V+      Y++ DTLF+K +V
Sbjct:   38 RLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICP--VDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEK-EFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTCYNGKL---IWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMETFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAV 549          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 129.798 bits (325), Expect = 7.610e-31
Identity = 98/446 (21.97%), Postives = 182/446 (40.81%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGET-QEDRAASREIMNMRIKCP--NKPCNWEGKIREASAHLNQCRYKRK-PCEKCQQPISESEEKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEE--IELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHVERLK----------PDGAPCYNKPTADVGTAIGSPRIMRQNVMWEYLEGDTLFVKWSV 2686
            + A   C  C + L++P +  C    C +C          + P C   +     E  Q DRA  ++I+ + + C   +  C W+G++     HL++C +K    CEKC +  ++++ ++H   CE  R  C +CN  +T +   +E    +  K C +    CP +CG+ +   +E++ H   C      CP   +GC     +E   QH+ +    HL                          L  EI + + ++EL           +E +M    +   ++ S   T         IW+I++  ++   A+ G + +I S PF S + GYK+       GDG+     +S++ +L+KGE+D    WPF   +  +++       +R+                   +P  +   A GS       ++  Y++ D ++V+  V
Sbjct:   12 LPADCTCPICEQALRDPIKLNCDHHYCRQC-----FENENRTPGCAACQTIIQPELCQHDRAKQKQILALPVVCTFESSGCPWDGQLGTLHDHLSECTFKSSLKCEKCGRQFAKNDLEKHRAKCELNRAVCSFCN--KTIRDSDRE----RHPKTCPQVIISCPFQCGLTDRPRLEIEAHCPSCPNVDNVCPFVPYGCTFAGGKESIQQHLSDEPVRHLMY------------------------LCDEITDLKGTYEL-----------MERDMGSFNDRQTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAILQNYVKDDKIYVQIDV 411          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: rpl-35 (60S ribosomal protein L35 [Source:UniProtKB/Swiss-Prot;Acc:P34662])

HSP 1 Score: 92.8189 bits (229), Expect = 1.696e-21
Identity = 51/107 (47.66%), Postives = 75/107 (70.09%), Query Frame = 2
Query:   80 MVKLRASELTKKNKADLEKQLHQLKTELAELRVAKVTGAGGTKLGKIRVLRKSIARVMTVMHTKQKDSLRQYYQHRKLKPQGIRTKATRAMRRQLTDNQKNKKTVRQ 400
            M KL+   L  + K  L+K+L + KTELA LRV+KVTG   +KL KIRV+RK+IAR++TV++  QK  LR++Y   K KP  +R K TRA+RR+LT ++ + ++ +Q
Sbjct:    1 MTKLKCKSLRGEKKDALQKKLDEQKTELATLRVSKVTGGAASKLSKIRVVRKNIARLLTVINQTQKQELRKFYADHKYKPIDLRLKKTRAIRRRLTAHELSLRSAKQ 107          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: rpl-35 (60S ribosomal protein L35 [Source:UniProtKB/Swiss-Prot;Acc:P34662])

HSP 1 Score: 92.8189 bits (229), Expect = 1.696e-21
Identity = 51/107 (47.66%), Postives = 75/107 (70.09%), Query Frame = 2
Query:   80 MVKLRASELTKKNKADLEKQLHQLKTELAELRVAKVTGAGGTKLGKIRVLRKSIARVMTVMHTKQKDSLRQYYQHRKLKPQGIRTKATRAMRRQLTDNQKNKKTVRQ 400
            M KL+   L  + K  L+K+L + KTELA LRV+KVTG   +KL KIRV+RK+IAR++TV++  QK  LR++Y   K KP  +R K TRA+RR+LT ++ + ++ +Q
Sbjct:    1 MTKLKCKSLRGEKKDALQKKLDEQKTELATLRVSKVTGGAASKLSKIRVVRKNIARLLTVINQTQKQELRKFYADHKYKPIDLRLKKTRAIRRRLTAHELSLRSAKQ 107          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: rpl-35 (60S ribosomal protein L35 [Source:UniProtKB/Swiss-Prot;Acc:P34662])

HSP 1 Score: 92.8189 bits (229), Expect = 1.696e-21
Identity = 51/107 (47.66%), Postives = 75/107 (70.09%), Query Frame = 2
Query:   80 MVKLRASELTKKNKADLEKQLHQLKTELAELRVAKVTGAGGTKLGKIRVLRKSIARVMTVMHTKQKDSLRQYYQHRKLKPQGIRTKATRAMRRQLTDNQKNKKTVRQ 400
            M KL+   L  + K  L+K+L + KTELA LRV+KVTG   +KL KIRV+RK+IAR++TV++  QK  LR++Y   K KP  +R K TRA+RR+LT ++ + ++ +Q
Sbjct:    1 MTKLKCKSLRGEKKDALQKKLDEQKTELATLRVSKVTGGAASKLSKIRVVRKNIARLLTVINQTQKQELRKFYADHKYKPIDLRLKKTRAIRRRLTAHELSLRSAKQ 107          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 63.5438 bits (153), Expect = 9.849e-10
Identity = 49/195 (25.13%), Postives = 81/195 (41.54%), Query Frame = 2
Query: 1943 IECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRA-RDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMS 2524
            I+CP  + GC  K    E  +HV++    HL +                   +S   + T+I   + ++    +GM +     E+  ++    +                   +RI +      +A ++ +  SI S PFYS   GYK+     P GDG     + SVF  L+KGEWD++  WPF   + F+I+S
Sbjct:   84 IDCPFKEHGCHKKGENSEVKRHVRDDRNLHLVLL-----------------CQSLNPIRTKINIQQSAYVDKYVGMLQYMSIAESAFEKYGSQHT------------------FRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILS 243          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: RpL35 (gene:FBgn0029785 transcript:FBtr0070801)

HSP 1 Score: 119.783 bits (299), Expect = 8.221e-31
Identity = 62/122 (50.82%), Postives = 89/122 (72.95%), Query Frame = 2
Query:   80 MVKLRASELTKKNKADLEKQLHQLKTELAELRVAKVTGAGGTKLGKIRVLRKSIARVMTVMHTKQKDSLRQYYQHRKLKPQGIRTKATRAMRRQLTDNQKNKKTVRQIRLDRAWPEIIYAIK 445
            MVK++ SEL  K+K +L KQL +LK EL  LRVAKVTG   +KL KIRV+RK+IARV  VMH KQK++LR+ ++++K KP  +R K TRA+R+ L+    N+KT+++IR    +P+  +A+K
Sbjct:    1 MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQKENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANRKTLKEIRKRSVFPQRKFAVK 122          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: RpL35 (gene:FBgn0029785 transcript:FBtr0345788)

HSP 1 Score: 119.783 bits (299), Expect = 8.221e-31
Identity = 62/122 (50.82%), Postives = 89/122 (72.95%), Query Frame = 2
Query:   80 MVKLRASELTKKNKADLEKQLHQLKTELAELRVAKVTGAGGTKLGKIRVLRKSIARVMTVMHTKQKDSLRQYYQHRKLKPQGIRTKATRAMRRQLTDNQKNKKTVRQIRLDRAWPEIIYAIK 445
            MVK++ SEL  K+K +L KQL +LK EL  LRVAKVTG   +KL KIRV+RK+IARV  VMH KQK++LR+ ++++K KP  +R K TRA+R+ L+    N+KT+++IR    +P+  +A+K
Sbjct:    1 MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQKENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANRKTLKEIRKRSVFPQRKFAVK 122          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: RpL35 (gene:FBgn0029785 transcript:FBtr0070800)

HSP 1 Score: 119.783 bits (299), Expect = 8.221e-31
Identity = 62/122 (50.82%), Postives = 89/122 (72.95%), Query Frame = 2
Query:   80 MVKLRASELTKKNKADLEKQLHQLKTELAELRVAKVTGAGGTKLGKIRVLRKSIARVMTVMHTKQKDSLRQYYQHRKLKPQGIRTKATRAMRRQLTDNQKNKKTVRQIRLDRAWPEIIYAIK 445
            MVK++ SEL  K+K +L KQL +LK EL  LRVAKVTG   +KL KIRV+RK+IARV  VMH KQK++LR+ ++++K KP  +R K TRA+R+ L+    N+KT+++IR    +P+  +A+K
Sbjct:    1 MVKVKCSELRIKDKKELTKQLDELKNELLSLRVAKVTGGAPSKLSKIRVVRKAIARVYIVMHQKQKENLRKVFKNKKYKPLDLRKKKTRAIRKALSPRDANRKTLKEIRKRSVFPQRKFAVK 122          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 115.161 bits (287), Expect = 9.369e-26
Identity = 96/432 (22.22%), Postives = 166/432 (38.43%), Query Frame = 2
Query: 1586 REIMNMRIKCPN--KPCNWEGKIREASAHLNQCRYKRKPC-EKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKI------------------------------------------------CDRFRGKCPNKC--GVEEEIELKEHW-ERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLR-SYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM-----SAKDAHVERLKPDGA-PCYNKPTADVG-TAIGSPRIMRQNVMWE--YLEGDTLFVKWSV 2686
            + IM   + C +  + C W  ++R+   HLN C++    C  KC   I       H +  C  RRTRCE+C    +   +++ + +  +E +                                                C R    CP +C  G     EL+ H  + C    + C   + GC+ K  R+    H++  A  HL +                                          M         +++ L+    KL  +YT T         +W+I +++ K   AR    + + SPPFY+ + GYKL+  ++ NG+G G++THVSV+  ++ GE+D L  WPFS+ + FT+      S +    E   PD     + +P+ +      G PR +   ++    +++GDT+F++  V
Sbjct:   88 KHIMGSLVFCIHHKQGCKWSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEHNGSCGQEPVYCEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSL------------------------------------------MVALSSRQGQQIQMLKSAVSKLSINYTGT--------LLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 104.76 bits (260), Expect = 2.517e-22
Identity = 84/345 (24.35%), Postives = 145/345 (42.03%), Query Frame = 2
Query: 1697 CE-KCQQPISESEEKQHENV-CEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKC--GVEEEIELKEHW-ERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLR-SYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM-----SAKDAHVERLKPDGA-PCYNKPTADVG-TAIGSPRIMRQNVMWE--YLEGDTLFVKWSV 2686
            CE KC Q I       H++  C +R  RC +C      ++   + + +   + C R    CP +C  G     EL+ H  + C    + C   + GC+ K  R+    H++  A  HL +                                          M         +++ L+    KL  +YT T         +W+I +++ K   AR    + + SPPFY+ + GYKL+  ++ NG+G G++THVSV+  ++ GE+D L  WPFS+ + FT+      S +    E   PD     + +P+ +      G PR +   ++    +++GDT+F++  V
Sbjct:  190 CEAKCGQRILRGRMTLHKSKDCAKRLRRCAHCQ-----REFSADTLPLHAAQ-CPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSL------------------------------------------MVALSSRQGQQIQMLKSAVSKLSINYTGT--------LLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKV 478          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 139.428 bits (350), Expect = 8.231e-34
Identity = 111/501 (22.16%), Postives = 206/501 (41.12%), Query Frame = 2
Query: 1406 RLRCGACTKLLKEPRQ-TECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHLNQCRYKRKPC-EKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKI------------------------------------------------CDRFRGKCPNKCGVEEEI--ELKEHW-ERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTR--ESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHV-------ERLKPDG------APCYNKPTADVGT-AIGSPRIMRQNVMWE--YLEGDTLFVKWSV 2686
            R +C  C+K ++EP Q + CG R C  C+ E    G  +CP+  +       +   D    ++I+ + I+C +  + C W G++++  +H + C +   PC  +C   ++  +  +H ++ C +R+ +CE+C    T +  +       +E +                                                C RF  +CPN+CG       +L  H  E C    + CP  + GCK +  +    +H++E+ + HL                          +M  +   +  E  EL R            EM+ L   +  +               IW++ +++RK Q A+        SPPFY+ + GYKL++  + NG+G+G+ +H+S++  ++ GE+D L  WPFS K+ F+I+   D  +       E   PD        PC ++ + D  T   G P+ +    + +  Y+  +++F+K S+
Sbjct:   15 RFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE--DQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAYENHQGICPQESVYCENKCGARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHL-------------------------TMMCSLVGRQRQEILELRR------------EMEELSVSHDGV--------------LIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKKRNYIRDNSIFLKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 139.428 bits (350), Expect = 8.231e-34
Identity = 111/501 (22.16%), Postives = 206/501 (41.12%), Query Frame = 2
Query: 1406 RLRCGACTKLLKEPRQ-TECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHLNQCRYKRKPC-EKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKI------------------------------------------------CDRFRGKCPNKCGVEEEI--ELKEHW-ERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTR--ESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHV-------ERLKPDG------APCYNKPTADVGT-AIGSPRIMRQNVMWE--YLEGDTLFVKWSV 2686
            R +C  C+K ++EP Q + CG R C  C+ E    G  +CP+  +       +   D    ++I+ + I+C +  + C W G++++  +H + C +   PC  +C   ++  +  +H ++ C +R+ +CE+C    T +  +       +E +                                                C RF  +CPN+CG       +L  H  E C    + CP  + GCK +  +    +H++E+ + HL                          +M  +   +  E  EL R            EM+ L   +  +               IW++ +++RK Q A+        SPPFY+ + GYKL++  + NG+G+G+ +H+S++  ++ GE+D L  WPFS K+ F+I+   D  +       E   PD        PC ++ + D  T   G P+ +    + +  Y+  +++F+K S+
Sbjct:   15 RFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE--DQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAYENHQGICPQESVYCENKCGARMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHL-------------------------TMMCSLVGRQRQEILELRR------------EMEELSVSHDGV--------------LIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKKRNYIRDNSIFLKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 132.109 bits (331), Expect = 7.617e-31
Identity = 112/438 (25.57%), Postives = 200/438 (45.66%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQ--PISESEEKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEE-EIELKEHWER-CSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKI---WXXXXXXXXXXXXXXXXEIESHKILMT-----------EIFNTRESF-----ELARIGM--------SETEKNVENEMKR----LREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGK-DTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDA--HVERL--KPDGAPCYNKPTA 2590
            +E++  C  C   L+   QT CG R C  CI +   +  ++CP   + E+    +   D  A REI+++ +KC N  C+ + ++R+   HL+QCR+   PC +CQ+  PIS  +E + ++ C +R   C  C  +  +  ++Q H     E+ C  F       C +E    +L  H +  C +  + C  + +GC+ K+ R E  QH+QE  + H++    ++ +    +  M      + S     +           E+ N RE+       L R           ++T+KN   E++R    L E  ++L +    G       Y+WR+E F+   +    G  + + SPPFY+ + GYKL +R++     A +    +S+F   ++GE+D   SWP    +   ++   +   H+E +  KPD    + +PT 
Sbjct:   65 LESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCP--VDNEVLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQH-CLQRIMTCPDCAGSFVYA-VKQNH-----EQFCP-FANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQG------IYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVMETKPD-LQAFQRPTV 485          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 132.109 bits (331), Expect = 7.617e-31
Identity = 112/438 (25.57%), Postives = 200/438 (45.66%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQ--PISESEEKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEE-EIELKEHWER-CSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKI---WXXXXXXXXXXXXXXXXEIESHKILMT-----------EIFNTRESF-----ELARIGM--------SETEKNVENEMKR----LREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGK-DTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDA--HVERL--KPDGAPCYNKPTA 2590
            +E++  C  C   L+   QT CG R C  CI +   +  ++CP   + E+    +   D  A REI+++ +KC N  C+ + ++R+   HL+QCR+   PC +CQ+  PIS  +E + ++ C +R   C  C  +  +  ++Q H     E+ C  F       C +E    +L  H +  C +  + C  + +GC+ K+ R E  QH+QE  + H++    ++ +    +  M      + S     +           E+ N RE+       L R           ++T+KN   E++R    L E  ++L +    G       Y+WR+E F+   +    G  + + SPPFY+ + GYKL +R++     A +    +S+F   ++GE+D   SWP    +   ++   +   H+E +  KPD    + +PT 
Sbjct:   65 LESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCP--VDNEVLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQH-CLQRIMTCPDCAGSFVYA-VKQNH-----EQFCP-FANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQG------IYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVMETKPD-LQAFQRPTV 485          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 132.109 bits (331), Expect = 7.617e-31
Identity = 112/438 (25.57%), Postives = 200/438 (45.66%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQ--PISESEEKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEE-EIELKEHWER-CSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKI---WXXXXXXXXXXXXXXXXEIESHKILMT-----------EIFNTRESF-----ELARIGM--------SETEKNVENEMKR----LREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGK-DTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDA--HVERL--KPDGAPCYNKPTA 2590
            +E++  C  C   L+   QT CG R C  CI +   +  ++CP   + E+    +   D  A REI+++ +KC N  C+ + ++R+   HL+QCR+   PC +CQ+  PIS  +E + ++ C +R   C  C  +  +  ++Q H     E+ C  F       C +E    +L  H +  C +  + C  + +GC+ K+ R E  QH+QE  + H++    ++ +    +  M      + S     +           E+ N RE+       L R           ++T+KN   E++R    L E  ++L +    G       Y+WR+E F+   +    G  + + SPPFY+ + GYKL +R++     A +    +S+F   ++GE+D   SWP    +   ++   +   H+E +  KPD    + +PT 
Sbjct:   65 LESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCP--VDNEVLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQH-CLQRIMTCPDCAGSFVYA-VKQNH-----EQFCP-FANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQG------IYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVMETKPD-LQAFQRPTV 485          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 149.058 bits (375), Expect = 2.592e-36
Identity = 129/496 (26.01%), Postives = 226/496 (45.56%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHL-NQCRYKRKPCEK--CQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEI-------ELKEHWERCSRKRIECPMAKWG----CKIKILREET--------IQHVQETA-----EEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPI--------------------------APY----IWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDA--HV-ERLKPD-GAPCYNKPTADVGTAIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            +E + +C  C  +L  PRQTECG R C  C+  +  +   QC  C++    +  +  +D    RE++ +++ C N  + C     +     HL + C+++   C +  C++ +   +   H E  C+ R T C++C       ++Q+      E+  C      CP+ C V+  +       ++K H    + + +   M +W      K+ +L+ E+        I H Q  +     E H +   +    + Q+   I+ + +  K L  EI N R++ + A  GM    ++++N + +L    +   S+ P      I                          A Y    IW+I ++ R+ Q A  G  +S+ S PFY+   GYK+  RVY NGDG GK TH+S+FFV+++GE+D L  WPF  K++  +M    +  H+ +  KPD  +  + KPT ++  A G P  + Q V+    Y++ DT+F+K  V
Sbjct:   42 VEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDN--ITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKH-----EDVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNL-MKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEAD-GMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 528          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 145.976 bits (367), Expect = 3.397e-35
Identity = 135/520 (25.96%), Postives = 227/520 (43.65%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHL-NQCRYKRKPCEK--CQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEI--ELKEHW-------ERCSRKRIECP----------------------MAKWG----CKIKILREET--------IQHVQETA-----EEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPI--------------------------APY----IWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDA--HV-ERLKPD-GAPCYNKPTADVGTAIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            +E + +C  C  +L  PRQTECG R C  C+  +  +   QC  C++    +  +  +D    RE++ +++ C N  + C     +     HL + C+++   C +  C++ +   +   H E  C+ R T C++C       ++Q+      E+  C      CP+ C V+  +  EL  H          CS KR  C                       M +W      K+ +L+ E+        I H Q  +     E H +   +    + Q+   I+ + +  K L  EI N R++ + A  GM    ++++N + +L    +   S+ P      I                          A Y    IW+I ++ R+ Q A  G  +S+ S PFY+   GYK+  RVY NGDG GK TH+S+FFV+++GE+D L  WPF  K++  +M    +  H+ +  KPD  +  + KPT ++  A G P  + Q V+    Y++ DT+F+K  V
Sbjct:   42 VEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDN--ITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKH-----EDVDCPSVVISCPHMCSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTFKGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEAD-GMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 553          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 139.813 bits (351), Expect = 9.049e-34
Identity = 112/503 (22.27%), Postives = 200/503 (39.76%), Query Frame = 2
Query: 1394 QIEARLRCGACTKLLKEPRQ-TECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHLNQCRYKRKPC-EKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKI------------------------------------------------CDRFRGKCPNKCGVEEEI--ELKEHW-ERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHV-------ERLKPDGA-PCYNKPTADVGT------AIGSPRIMRQNVMWE--YLEGDTLFVKWSV 2686
            ++  +  C  C K ++EP Q + CG R C  C+ E    G  +CP+  +       +   DR    ++M + I+C +  + C W G++++   HLN C +   PC  +C   +   +  +H ++ C +R+ RCE+C    T +  +       +E +                                                C R+   CPN+CG+      +L  H  + CS   + CP    GCK +  +    +H++E    HL +                                          MS        E+  LR+  ++L S +  G        IW+I +++RK Q A+        SPPFY+ K GYKL++  + NG+G+G+ +++SV+  ++ GE+D L  WPFS ++ F+++   D  +       E   PD     + KPT    +        G P+ +    + +  Y+  + +F++ SV
Sbjct:   11 KLRRKFLCPLCGKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE--DQLPLDYAKIYPDRDLETQVMGLSIRCIHSEEGCRWSGQLKQLQPHLNICAFNVIPCPNRCSTKLIRRDLPEHMQHDCPKRKVRCEFCGADFTGEAYEDHQGCCPQESVYCENKCGARMMRRVLSQHSLVECPKRTQPCPYCNKEFVFDTIQSHQYQCPRYPTPCPNQCGIASIAREDLSNHLKDSCSSALVLCPFKDSGCKHRGPKITISRHLEENMRAHLSM------------------------------------------MSSLVSRQRQEILELRKQVEEL-SVSSEGV------LIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNFQKPTGSRNSLDESTLGFGYPKFISHEDIRKRNYVRDNAIFLRASV 462          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 135.961 bits (341), Expect = 1.412e-32
Identity = 112/466 (24.03%), Postives = 193/466 (41.42%), Query Frame = 2
Query: 1394 QIEARLRCGACTKLLKEPRQTECGCRLCTECI------IELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTP-----TGENPPIAP-----------------YIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM--SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSP---RIMRQNVMWEYLEGDTLFVKWSV 2686
            ++E +  C  C  LL+ P Q +CG R C+ C+      +     G  +CP   E                               +W G +     H  +C Y   PC  C+  I  +    H E  C ER+  C YC ++  +  I+        ++IC +F   C   CG ++    K     C    + C  A  GC   +  ++ ++H  ++  EHL     +             ++    +    +     +FE     +S   + VE       E  ++LR+         G+   I                   +IW+I EF +K Q A +G   ++ SPPFY+ K GYK+ +R+Y NGDG G++TH+S+FFV++KG  D L  WPF+ K+   ++  + ++  ++  +PD  +  + +P +++  A G P   ++ +      Y+  DT+FVK  V
Sbjct:   30 KLEVKYLCSDCKNLLRRPLQAQCGHRYCSHCLNKIIRWVARNWGGVPECPAVCERS-----------------------------DWTGALISV-GHEGKCPYLLAPCPACKTIIRAANRDLHSERECPERKLNCRYCKLSFYFPDIKAH------DEICPKFPMTCEG-CGRKKIPREKVRLFVC----MPCRYAAVGCTEMVENDKCLEHENKSLAEHLA--KGSPAPPANAPPNNSAKVAEMLLKFDTLDKKNTTFENI---VSVLNREVERSSHAAEELARQLRAADTRLERTLGQKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 449          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 129.028 bits (323), Expect = 8.204e-30
Identity = 124/514 (24.12%), Postives = 221/514 (43.00%), Query Frame = 2
Query: 1394 QIEARLRCGACTKLLKEPRQTECGCRLCTECIIELT-LNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKP-----------------CNWEGKI------------REASAHL-NQCRYKRKPCEKCQQPISESEEKQHENV------------CEERRTRCEY----CNITETWKQIQQEHVNVKEEK---ICDRFRGKCPNKCGVEEEIELKEHWERCSRKRI-----EC------------------PMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM--SAKDAHVE---RLKPDGAPCYNKPTADVGTAIGSPRIMRQNVMWE-----YLEGDTLFVKWSV 2686
            Q++ R +C +C  +L  P QT CG R C +CI  L  L+   QCP   + E     E  +D    RE++N+ + C N P                 C +E  +            +E   HL ++C+ +++ C  C+Q +S + E  ++ +            C E   +C +    CN+     ++++       +    + +R          V + ++LKEH  +     +     EC                   +A +  K   L E+ IQ V   ++EH ++ +  + +  +   Q    +E++K     I N    F+   + +S       N   ++  + ++ R    T  N  +   IW+I ++ RK + A +G  VSI S  FY+   GY+L  R Y NGDG+GK + +S++FV++KGE+D +  WPF  K+   ++  S K  H+    R  P+ +  + +P +++  A G PR      +       Y++ DTLF+K  V
Sbjct:   37 QLQDRYKCASCHLVLHNPHQTGCGHRFCEKCISNLIELSETPQCP--IDMENIKSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQCLYEMTLCSNDGCHDQMIRKELKGHLESECKLRQEACIYCKQTMSFNHENNYKKIFFSFQLDKHLCECPEAELQCTFSNYGCNVMVKRGKVKEHEDTFLRDHMLYVLNRNMKLEEQVLSVLQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSMWLEEQVIQLV---SKEHSRLDLRPILDTLESTKQRLSTLEAYK---DRIDNLDGQFKKHDVLLS-------NHKMQMTSNEERFRLVEGTSYNGKL---IWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRADPNSSS-FKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVV 531          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 174.866 bits (442), Expect = 2.328e-45
Identity = 129/485 (26.60%), Postives = 223/485 (45.98%), Query Frame = 2
Query: 1394 QIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDC-----KETEIASLGETQE--DRAASREIMNMRIKCPNKPCNWEGKIREA-SAHLNQCRYKRKPCEKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVK-EEKICDRFRGKCPNKCGVEEEI---ELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXX---------EIESHKILMTEIFNTRESFELARIGMS-----------------------ETEKNV---ENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM--SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPR---IMRQNVMWEYLEGDTLFVKWSV 2686
            ++EA+  C AC  +L+ P Q +CG R C+ C+  +  +GP+ C  C      E  I+ L  +    D AA RE+ ++   CPN  C W+G ++E  S H   C +    C  C+  +  SE++ H E  C +R   C++C       +    HV+++   ++C +F   C + CG +++I     ++H   CS+ R+ C     GC   +  E    H  +   EHL + + +          +           +I   KI   E      + E+ R+ ++                       + E+++   +  M  L +   +L   T  G       +IW+I +FTRK Q A  G   +I SP FY+ + GYK+ +RVY NGDG G+ TH+S+FFV++KG  D L  WPF+ K+   ++  + ++  ++  +PD  +  + +P +D+  A G P    + +      Y+  D +F+K  V
Sbjct:   27 RLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHC-------RAPCSHVDLEVHYEVCPKFPLTC-DGCG-KKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGV------FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 169.474 bits (428), Expect = 1.644e-43
Identity = 130/492 (26.42%), Postives = 224/492 (45.53%), Query Frame = 2
Query: 1394 QIEARLRCGACTKLLKEPRQTECGCRLCTECIIE-------LTLNGPKQCPDC-----KETEIASLGETQE--DRAASREIMNMRIKCPNKPCNWEGKIREA-SAHLNQCRYKRKPCEKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVK-EEKICDRFRGKCPNKCGVEEEI---ELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXX---------EIESHKILMTEIFNTRESFELARIGMS-----------------------ETEKNV---ENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM--SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPR---IMRQNVMWEYLEGDTLFVKWSV 2686
            ++EA+  C AC  +L+ P Q +CG R C+ C+         L+ +GP+ C  C      E  I+ L  +    D AA RE+ ++   CPN  C W+G ++E  S H   C +    C  C+  +  SE++ H E  C +R   C++C       +    HV+++   ++C +F   C + CG +++I     ++H   CS+ R+ C     GC   +  E    H  +   EHL + + +          +           +I   KI   E      + E+ R+ ++                       + E+++   +  M  L +   +L   T  G       +IW+I +FTRK Q A  G   +I SP FY+ + GYK+ +RVY NGDG G+ TH+S+FFV++KG  D L  WPF+ K+   ++  + ++  ++  +PD  +  + +P +D+  A G P    + +      Y+  D +F+K  V
Sbjct:   27 RLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILRCASILSSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHC-------RAPCSHVDLEVHYEVCPKFPLTC-DGCG-KKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGV------FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 503          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 144.05 bits (362), Expect = 9.781e-35
Identity = 124/511 (24.27%), Postives = 227/511 (44.42%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHL-NQCRYKRKPCEK--CQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEI-------ELKEHWERCSRKRIECPMAKWGC----KIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETE--KNVENEMKRLREHYQKLRSYTPTGE---------------------------------NPPIAPYIWRIEEFTRKWQ-------------RARD----------GTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM---SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            +E + +C  C  +L  P+QTECG R C  C+  L  +   +C  C+E+ I    +  +D    REI+ +++ C N  + C  +  +     HL N+C+++  PC +  C++ +   + + H E  C+ R   C +C       ++Q+      E+  C      CP+KC V+  +       ++K H    + + +   + +W      K+ +L+ E+++  +     H +I               +IEIE  K ++    N  +   L R+  S+ E  K ++ E++  R+++++  S   + E                                 +  ++ +  R+ +   ++Q             + RD          G  +S+ S PFY+   GYK+  RVY NGDG GK TH+S+FFV+++GE+D L  WPF  K+   +M   S++    +  KPD  +  + KPT ++  A G P  + Q V+    Y++ DT+F+K  V
Sbjct:   46 VEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKD--KVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKH-----EDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNL-LKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQIC------------SFEIEIERQKEMLRN--NESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 534          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 144.05 bits (362), Expect = 9.781e-35
Identity = 124/511 (24.27%), Postives = 227/511 (44.42%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHL-NQCRYKRKPCEK--CQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEI-------ELKEHWERCSRKRIECPMAKWGC----KIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETE--KNVENEMKRLREHYQKLRSYTPTGE---------------------------------NPPIAPYIWRIEEFTRKWQ-------------RARD----------GTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM---SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            +E + +C  C  +L  P+QTECG R C  C+  L  +   +C  C+E+ I    +  +D    REI+ +++ C N  + C  +  +     HL N+C+++  PC +  C++ +   + + H E  C+ R   C +C       ++Q+      E+  C      CP+KC V+  +       ++K H    + + +   + +W      K+ +L+ E+++  +     H +I               +IEIE  K ++    N  +   L R+  S+ E  K ++ E++  R+++++  S   + E                                 +  ++ +  R+ +   ++Q             + RD          G  +S+ S PFY+   GYK+  RVY NGDG GK TH+S+FFV+++GE+D L  WPF  K+   +M   S++    +  KPD  +  + KPT ++  A G P  + Q V+    Y++ DT+F+K  V
Sbjct:   46 VEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKD--KVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKH-----EDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNL-LKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQIC------------SFEIEIERQKEMLRN--NESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV 534          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 137.502 bits (345), Expect = 1.475e-32
Identity = 127/520 (24.42%), Postives = 212/520 (40.77%), Query Frame = 2
Query: 1394 QIEARLRCGACTKLLKEPRQTECGCRLCTECIIELT-LNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKP-CNWEGKIREASAHLNQ-----------------------------CRYKRKPCEKCQQPISESEEKQHE-NVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNK---CGVE---------EEIELKEHWERCSRK------RIECPMAKWGCKIKILREET-IQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRES-FEL---------------------ARIGMSETEKNVEN--------EMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM--SAKDAH-VERLKPD-GAPCYNKPTADVGTAIGSPRIMRQNVMWE----YLEGDTLFVKWSV 2686
            Q+E R +C  C  +L  P QT CG R C +CI  L  LN    CP   + E+    E  +D    RE++N+ + C N P CN    +     HL                               CR++ + C  C++ I  +  + HE N C      C    +    +    EH+ V     C      CP K   C V+         E   L++H      K      R+   ++    K K+   ++ IQH          I+    +            +E+    + +I N + S  +L                      R+ + E E +  +        ++ +  E +++L     +G+       IW++ ++  K + A +G  VS+ S PFY+ + GY+L  R Y NGDG+GK TH+S++FV+++GE+D L  WPF  ++   ++  S K  H VE  K D  +  + +P  ++  A G PR +  + +      Y++ DTLF+K +V
Sbjct:   38 QLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICP--VDKEVIKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTV-----CPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRVNALLSSLERKKKMAAADSAIQHATNPMSRFQDIFSFLYRKALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGK------LIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 544          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.628e-44
Identity = 129/485 (26.60%), Postives = 223/485 (45.98%), Query Frame = 2
Query: 1394 QIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDC-----KETEIASLGETQE--DRAASREIMNMRIKCPNKPCNWEGKIREA-SAHLNQCRYKRKPCEKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVK-EEKICDRFRGKCPNKCGVEEEI---ELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXX---------EIESHKILMTEIFNTRESFELARIGMS-----------------------ETEKNV---ENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM--SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPR---IMRQNVMWEYLEGDTLFVKWSV 2686
            ++EA+  C AC  +L+ P Q +CG R C+ C+  +  +GP+ C  C      E  I+ L  +    D AA RE+ ++   CPN  C W+G ++E  S H   C +    C  C+  +  SE++ H E  C +R   C++C       +    HV+++   ++C +F   C + CG +++I     ++H   CS+ R+ C     GC   +  E    H  +   EHL + + +          +           +I   KI   E      + E+ R+ ++                       + E+++   +  M  L +   +L   T  G       +IW+I +FTRK Q A  G   +I SP FY+ + GYK+ +RVY NGDG G+ TH+S+FFV++KG  D L  WPF+ K+   ++  + ++  ++  +PD  +  + +P +D+  A G P    + +      Y+  D +F+K  V
Sbjct:   27 RLEAKYLCSACKNILRRPFQAQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPNDGCTWKGTLKEYESCHEGLCPFLLTECPACKGLVRLSEKEHHTEQECPKRSLSCQHC-------RAPCSHVDLEVHYEVCPKFPLTC-DGCG-KKKIPRETFQDHVRACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIVCVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGV------FIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDHNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 150.599 bits (379), Expect = 1.882e-36
Identity = 123/493 (24.95%), Postives = 220/493 (44.62%), Query Frame = 2
Query: 1394 QIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEI----ASLGETQE---DRAASREIMNMRIKCPNKPCNWEGKIREASA---------------------------HL-NQCRYKRKPCEKCQQPISESEEKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCP-NKCGVEEEIE-----------LKEHWERCSRKRIEC-PM----AKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXE--IESHKI--LMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM--SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPR---IMRQNVMWEYLEGDTLFVKWSV 2686
            ++EA+  C AC  +L+ P Q +CG R C+ C+  +  +GP+ C  C    I     S+ E+     D AA RE+ ++   CP+  C W+G ++E  +                           HL ++C  +   C  C+ P   ++ K H  VC +    C+ C   +  ++  Q+HV     K C + R  C  +  G  E +E           L+EH        +E  P+    +  G ++ + R E+++    T E  + +    ++ +         +  ++  KI  L +++     S  L  + M++ E+ V            ++ + T  G       +IW+I +F RK Q A  G   +I SP FY+ + GYK+ +R+Y NGDG G+ TH+S+FFV++KG  D L  WPF+ K+   ++  + ++  ++  +PD  +  + +P  D+  A G P    + +      Y+  D +F+K  V
Sbjct:   27 KLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHV-----KTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSEL-LQRCESLEKKTATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKV-----------LEMEASTYDGV------FIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 6.335e-32
Identity = 120/480 (25.00%), Postives = 203/480 (42.29%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESE-EKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWER-CSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIE-----------------------SHKILMTEIFNTRESFE-----LAR--------IGMSETEKNVENEMKR-LREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGK-DTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDA-------HVERLKPDGAPCYNKPTADVGT-AIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            +E++  C  C   L+E  QT CG R C  CI++   +   +CP   + EI    +   D  A REI+++++KCP++ C    ++R    HL QC++    C +CQ    +S  EK  E+ C  R+  C+ C +   ++ +         E IC      C          ++  H+   C+   I C   ++GC  K+ R +  +H+Q+  + H+++   T+++          +I                        SH+    E  N RE+ E     L R        I   ET+    NE+K  +R    KL        N     +IW+I+ F+   +   +   V I SP FY+ K GYKL +R++     A +   ++S+F   ++GE+D L  WP    +  +I+   +         V   KPD    + +PT        G    M  N +   +Y++ DTLFV+ +V
Sbjct:   66 LESKYECPICLMALREAVQTPCGHRFCKACIVKSLRDAGHKCP--VDNEILMENQLFPDNFAKREILSLKVKCPSQGCTETMELRHLERHLGQCQFASVECSQCQGSFPKSRLEKHMEHECGRRKIFCDNCGLAMAYEDMS------GHELICPLAYVTCEYCQTNLIREQMPSHYSMDCTMAPIPCMYYEFGCTEKMQRNDLARHLQDFTQAHMRMMFQTLRSFSTTPTSHISDISFCDPNQFEPVPLSVAPAHPSHMPSHQDCSQETRNLRETIEQLEGRLVRQDHQIRELIAKMETQCTYVNELKHTIRSLEDKLLDVDGHHCN---GVFIWKIKGFSGLQKTQEEEKPVVIHSPGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLHGTIRLSILDQSEGAIIQDQEEVMDTKPDLL-AFQRPTTQRNPKGFGYVTFMHLNTLKQRQYVKNDTLFVRCAV 533          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q3MV19|TRF6A_XENLA (TNF receptor-associated factor 6-A OS=Xenopus laevis OX=8355 GN=traf6-a PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 3.101e-31
Identity = 124/484 (25.62%), Postives = 205/484 (42.36%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIE-LKEHWER-CSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIE-----------------------SHKILMTEIFNTRESFE-----LAR--------IGMSETEKNVENEMKR----LREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGK-DTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM-----SAKDAHVERL--KPDGAPCYNKPTADVGT-AIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            +E++  C  C   L+E  QT CG R C  CI++   N   +CP   + EI    +   D  A REI+++R+KCPN  C    ++R    HL QC++    C +CQ    +    +H E+ C  RRT C+ C +   ++           E IC      C + C      E +  H+   C+   I C   ++GC+ K+ R     H+Q+  + H+++   T+++          +I                        S +    E  N RE+ E     L R        I   ET+    NE+K     L +    + ++   G       +IWRI+ F+   +   +   V I SP FY+   GYKL +R++     A +   ++S+F   ++G++D L  WP    +  +I+     +A+   VE +  KPD    + +PTA       G    M  N +   +Y++ DTL V+ SV
Sbjct:   66 LESKYECPICLMALREAVQTPCGHRFCKACILKSLRNAGHKCP--VDNEILMEKQLFPDNFAKREILSLRVKCPNLGCTDTMELRHLEHHLVQCQFASVECSQCQGSFLKLLLDKHMEHECGRRRTFCDNCGLAMAYED------KSGHELICPMAYVTC-DYCQTNLIREQMPAHYSMDCTMAPIPCMYCEFGCREKMQRHNLAGHLQDFTQAHMRMMAQTLRSFSTTPTSHISDISFCDPNQFEPVPLSVAPAHPSHMPSQQDCSQETRNLRETVEQLEGRLVRQDHQIRELIAKMETQCTYVNELKHTIHSLEDKVADMDAHRCNGV------FIWRIKGFSGLQKSQEEEKPVVIHSPGFYTGDPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGDYDSLLPWPLQGTIRLSILDQSESTARQDQVEVMDTKPDLL-AFQRPTAPRNPKGFGYVTFMHLNTLKQRQYVKNDTLLVRCSV 533          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q61382|TRAF4_MOUSE (TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 4.751e-31
Identity = 114/499 (22.85%), Postives = 195/499 (39.08%), Query Frame = 2
Query: 1406 RLRCGACTKLLKEPRQ-TECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHLNQCRYKRKPC-EKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKI------------------------------------------------CDRFRGKCPNKCGVEEEI--ELKEHW-ERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMS------AKDAHV-ERLKPDGA-PCYNKPTADVGT------AIGSPRIMRQNVMWE--YLEGDTLFVKWSV 2686
            RL C  C K ++EP Q + CG R C  C+ E    G  +CP+  +       +   D     +++ + I+C +  + C W G +R    HLN C +   PC  +C   +S  +   H ++ C +RR +CE+C    + +  +       +E +                                                C R    CPN+CGV      +L  H  + CS   + CP  + GCK +  +    +HV+E+ + HL +                                          M         E++ LR   ++L      G +      IW+I  + R+ Q A+    +   SP FY+ K GYKL++  + NG+G+G+ TH+S++  ++ G +D L  WPF+ ++ F+++       AK  HV E   PD     + KP    G+        G P+ +    + +  Y+  D +F++ SV
Sbjct:   15 RLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE--DQLPLDYAKIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLKDSCSTAFVLCPFKESGCKHRCPKLAMGRHVEESVKPHLAM------------------------------------------MCALVSRQRQELQELRRELEELS----IGSD---GVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASV 462          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: D5JG60 (TNF receptor-associated factor-2-like protein B OS=Dugesia japonica OX=6161 GN=TRAF-2B PE=2 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 2.409e-66
Identity = 143/445 (32.13%), Postives = 227/445 (51.01%), Query Frame = 2
Query: 1376 RKQTQIQIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLRE---HYQKLRSYTPTGENPPI---APYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDA---HVERLKPDG-APCYNKPTADVGTAIGSPRIMRQNVMWE-YLEGDTLFV 2674
            +K     I   L+C  C++LL E  QT+CGCR C EC+ E    G  +C          LG    D A +REI  + +KC    C     +++   HL+ C ++   C+ C + +++ E K+H E  C  R   C +C     +  + + H+NV  EK+C +  GKCP KC   +E+ L +H + CS+K + C  ++ GC   + +E+ I+H  E + +H ++ M               EI + K  ++E+      F + +I  S+ +  + +++K L +   H     S   + E   +     +IW+IE F+     A  G  +SITS  FY+ + GYK+ M++YP GDG GK TH+SVFF L++GE+D+L  WPF NK+  TI+  K+    H +  KPD  + CY +PT D   A GSP+ +  + + E YL    LF 
Sbjct:   17 KKHFPFNISDNLKCIICSQLLLEALQTDCGCRYCKECLKEYQAKGKTKCL---TDGCGDLGNIIPDNAVNREIGKLTVKCLFPGCEHSELLKDIGDHLDSCIHQTINCKSCNEELTKIELKEHTEKKCPMRLVSCTHCGEEMEYSNLTELHLNVHTEKLCAKLVGKCPYKCDNGKEVNLLDHRKSCSKKPVTCLFSEIGCNRVMTKEDLIKHNNEESLQHSRLLMK--------------EIITMKNDISELKMKTLEFNILKIEFSKFQSEILDKIKSLEKIPRHTSPSTSSVRSSEEKTVYRNGVFIWKIERFSELKSEAERGNRISITSDYFYTKEFGYKMSMKIYPAGDGVGKGTHLSVFFTLMRGEFDDLLQWPFKNKVTLTILDQKNKTNDHSDTFKPDVRSTCYQQPTDDYNIASGSPKFITFSQLDEIYLXXXILFF 444          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 3.327e-60
Identity = 130/443 (29.35%), Postives = 224/443 (50.56%), Query Frame = 2
Query: 1388 QIQIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCP----DCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEH-LKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMS--AKDAHV-ERLKPD-GAPCYNKPTADVGTAIGSPRIMRQNVMWEYLEGDTLFVKWSV 2686
            +  I   L+C  C  +L +  QT+CGCR C ECI     NG K+C     DC+    + +     DRA ++EI  +++KC  + C +E  ++    HL+ C Y+ + C  C       EE  H  N C  R   C+YC    T+K+  + H+  +   +C ++   CP  C  E ++ L  H + C  K +ECP+  + CK  I +++  +H+  ++ EH L I  +  K   Q         E   IL+ E    + + E+ ++ + +   ++  +    R +    R+            Y+W+I+ F++  + A  G   +I S  FY+   GYK+ M++YP GDG GK TH+S+FFV++KG++D++  WPF NK+  TI    +K  ++ +  KPD  + CY +P  +   A GSP+ +  + +  +L+ DTL+++ +V
Sbjct:   22 RFTINDNLKCVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCRSVITSYI----YDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMCSLCGMEYIIKEESNHLANECLLREVLCQYCRTLLTFKEYNESHLCFESRDLCGKYEAICPYGCTGESKVNLLHHRKSCENKPLECPLHVFDCKQLIPKDQMTEHLNTSSYEHTLTIVTELRKLEKQNKHME----ERMNILIEENQLLKATLEVMKLDLPKNSGSISRDTSLKRANKTIFRN----------GKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSDTFKPDPKSICYQRPEEEYNIASGSPKFISFSELKNFLKKDTLYIQINV 446          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A4W5P175 (TNF receptor-associated factor OS=Hucho hucho OX=62062 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 5.660e-55
Identity = 133/454 (29.30%), Postives = 243/454 (53.52%), Query Frame = 2
Query: 1391 IQIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETE-------IASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASA-HLNQCRYKRKPCEKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEE--EIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARI-GMSETEKNVENEMK----RLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM--SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPR---IMRQNVMWEYLEGDTLFVKWSV 2686
            + +E + +C  C ++L++P Q +CG R C  C+  LT +GPK C  C++ E       I +  E   D AA REI ++  KC ++ C+W G I+E  A H  +C Y+R PCE CQ  I  SE+++H E  CE R   C+YC ++  +K+I+        ++IC +F  +C + CG ++    +  +H + C++ +  CP ++ GCK+ +   + + H +        + +  ++ ++ ++  +  E+E   + + E F+ +   +  +I  +S   + +E  +     +L E  Q LR       +     ++W+I +F+R+ Q A  G   ++ SP FYS K GYK+ +R+Y NGDG G+ TH+S+FFV+++G+ D L  WPFS K+   ++  + ++  ++  +PD  +  + +P +++  A G P    + +      YL  DT+F+K  V
Sbjct:   23 VSMETKYQCQQCHQVLRKPVQAQCGHRFCVHCLKLLTSSGPKPCEACRQEEIYEEPQSILNSNEAFPDNAAGREIASLPAKCISEGCSWTGCIKEYEAQHEGKCEYERVPCETCQVLILRSEKERHNERECEARTLNCKYCKVSFNFKEIK------AHDEICQKFPMQCKD-CGKKKIPREKFLDHSKSCAKSKTACPFSEVGCKVVVDVADAVTHNEGLVFIVFSVVVLQVRALENIVCVLNREVERSSLTL-EAFSRQHRLDQDKIENLSNKVRQLERTLTMRDLQLAETDQTLRELQFCTFD---GVFVWKIADFSRRRQDAVAGRTPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRGKCDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDVTSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 465          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DF65 (TRAF-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 7.001e-55
Identity = 126/449 (28.06%), Postives = 231/449 (51.45%), Query Frame = 2
Query: 1361 IIEIIRKQTQI------QIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQHEN-VCEERRTRCEYCNITETWKQIQQEHVNVKE--EKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIG------MSETEKNVENEMKRLREHYQKLR--------SYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAK---DAHVERLKPD-GAPCYNKPTADVGTAIGSPRIM 2626
            ++++I+ ++++      Q + R+ C  C ++L EP QT+CGCRLC+ C+ E + +    CP C ET  +    ++ D+A  +EI+ + I C NK C +  K+++   HL  C Y  K C  C +     E K+HE   C+   T CE C +  +   ++++H NV E  + +C ++R  CP KC  +  + +K+H   C R+ +EC + + GC+  + REE  +H    A  H  + MD +  + +    + + +         + N R S E+  +       ++E E +++ ++K+ +  Y+KL         S + T E      Y W++E    K   A+ G    I S  FYS   GY++ +++YPNGDG+    ++SV+FVL+KG++D+   WPF++ ++  +++     +  V  ++P+    CY +P  +   A G P+ +
Sbjct:    8 VLKVIKDRSKLFYFECEQQKQRISCVKCHQVLIEPYQTQCGCRLCSNCLEECSKDEESHCPGCNETMNSPSNYSKHDKAIEKEILELNIICTNKGCEYTCKVKDLDNHLETCEYIEKRCTACNESYPRKELKKHEEFTCKMIITTCEDCGLELSKGDLEKKHKNVNELIDNVCSKWRDICPFKCSEDTLVNIKDHLLTCERRPVECSLNEMGCRKVLPREEMREHFNLEANYHTVLLMDALFLLRKEHQDLSVSV--------SVQNERNSAEIKELKEKLSSLLTEIE-DLKTKLKQFQSMYEKLENERNLAKCSLSETKER--YGEYTWKVENIMEKVNDAKKGVNTQILSESFYSSNPGYRMCLKIYPNGDGSAFGNYLSVYFVLMKGKYDDQIQWPFNSIISIRLVNIARRGEDRVLNMRPNINDQCYGRPKEEHNLAAGQPKFV 445          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A4W4H2M4 (TNF receptor-associated factor OS=Electrophorus electricus OX=8005 GN=LOC113588078 PE=3 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.488e-54
Identity = 129/461 (27.98%), Postives = 234/461 (50.76%), Query Frame = 2
Query: 1370 IIRKQTQIQIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCK-------ETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASA-HLNQCRYKRKPCEKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEE--EIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXX-XXXXEIESHKILMTEIFN----TRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAH--VERLKPD-GAPCYNKPTADVGTAIGSPR---IMRQNVMWEYLEGDTLFVKWSV 2686
            I R+   + +E + +C  C ++L++P Q +CG R C  C  ELT +GP  C  C+       +  + ++ E   D AA REI ++  KCPN+ C+W G +++    H  +C ++R  CE CQ  I  S+  +H E  CE R   C+YC ++  +K I+        ++IC +F  +C + CG ++    + +EH + C++ +  C   + GC+  +   +  +H Q +  EHL++ +       + +   +  E+E   + +  +       +E  E     + + E+ +     +L E  Q LR       +     +IW+I +F+ + Q A  G   ++ SP FYS K GYK+ +R+Y NGDG G++TH+S+FFV+++G++D L  WPF  K+   ++   +    ++  +PD  +  + +P +++  A G P    + +      YL  DT+F+K  V
Sbjct:   27 ISRQVLSVSMEPKYQCQQCKEVLRKPFQAQCGHRFCVFCFKELTSSGPIPCEACRAEGIFEEQLSMLNITEAFPDNAARREIDSLPAKCPNEGCSWTGTLKDYEGQHEGRCEFERVTCEACQVLILLSDRDRHNERECEARTLNCKYCKVSFNFKDIK------AHDEICQKFPMQCKD-CGKKKIPREKFQEHSKSCAKSKSACQFREIGCRAVVDNGKQHEHEQASITEHLRLMLADKMTALENIACVLNREVERTALTLEALTRQHRLDQEKIESLSTKVRQLERTLTMRDLKLAESEQSLRELQFCTYD---GMFIWKISDFSHRRQDALAGRSPALFSPAFYSSKYGYKMCLRLYMNGDGTGRNTHLSLFFVVMRGKYDALLKWPFGQKVTLMLLDQNNREHIIDAFRPDTSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 477          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 145.591 bits (366), Expect = 5.109e-36
Identity = 120/474 (25.32%), Postives = 205/474 (43.25%), Query Frame = 2
Query: 1376 RKQTQIQIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASA-HLNQCRYKRKPCEKCQQPISESE-EKQHENVCEERRTRCEYCNITETWKQIQ-QEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGCKIK--------ILREETIQHVQETA---------------EEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFN-----TRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM--SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPR---IMRQNVMWEYLEGDTLFVKWSV 2686
            RK    ++E +  C  C K+L+ P Q +CG R                          S      D AA RE+  +   C N+ C+W G I+E  A H  QC +   PC  C++ +  +E E+ +E  C ER   C+YC     +K I+  + +  K   IC+   G    K   E+ ++   H + C++ R  C     GC +         IL    + +   T                E  LK+                 E+E     M E +N      ++  E+    + + E+ V      + E   K+R  +    +     ++W+I +F++K Q A  G   ++ SP FY+ K GYK+ +R+Y NGDG G+ TH+S+FFV+++G  D L  WPF+ K+   ++  + ++  ++  +PD  +  + +P +D+  A G P    + + +    Y+  DT+F+K  V
Sbjct:   21 RKILANKLEDKHLCNICQKILRRPFQAQCGHRF-------------------------SPASAFPDNAAKREVEALEAVCINEGCSWTGTIKEYEATHEGQCDFMIIPCPSCKELLRANELERHNERECPERTLNCKYCKEPFHFKNIKAHDEICPKYPMICE---GCAKKKIPREKYVD---HIKLCTKFRTPCRFHVVGCDMSVSKPQWNLILTPRDLLYTSFTVPLSQTKVAELSRRCQELELKVGTFENIVCVLNR-----EMERSATTM-EAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYD---GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 454          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 136.346 bits (342), Expect = 9.052e-33
Identity = 110/501 (21.96%), Postives = 203/501 (40.52%), Query Frame = 2
Query: 1406 RLRCGACTKLLKEPRQ-TECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHLNQCRYKRKPC-EKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKI------------------------------------------------CDRFRGKCPNKCGVEEEI--ELKEHW-ERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTR--ESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHV-------ERLKPDG------APCYNKPTADVGT-AIGSPRIMRQNVMWE--YLEGDTLFVKWSV 2686
            R +C  C+K ++EP Q + CG R C  C+ E    G  +CP+  +       +   D    ++I+ + I+C +  + C W G++++   H + C +   PC  +C   ++  +  +H ++ C +R+ +CE+C    T +  +       +E +                                                C RF  +CPN+CG       +L  H  E C    + CP    GCK +  +    +H++ET +                         SH  +M  +   +  E  EL R            EM+ L   +  +               IW++ +++RK Q A+        SPPFY+ + GYKL++  + NG+G+G+ +H+S++  ++ GE+D L  WPF+ K+ F+I+   D  +       E   PD        P  ++ + D  T   G P+ +  + + +  Y+  + +F+K S+
Sbjct:   15 RFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE--DQLPLDYAKIYPDPELEQQILALPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCAVKLTRRDLPEHLQHDCPKRKVKCEFCGSEFTGEAFENHQGICPQESVYCENKCGARMMRRLLAQHTMAECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCPNQCGTPNIAREDLATHVKESCGSALVLCPFKDAGCKHRCPKLAIGRHLEETTK-------------------------SHLTMMCSLVGRQRQEIIELRR------------EMEELSVSHDGV--------------LIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPSSSRNSLDESTLGFGYPKFISHDEIRKRNYIRDNAIFLKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 124.79 bits (312), Expect = 1.213e-28
Identity = 114/475 (24.00%), Postives = 209/475 (44.00%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQHENV-CEERRTRCEYC--NITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEE-EIELKEHWER-CSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXX-------------------------XXEIESHK--ILMTEIFNTRESFELARIGM-SETEKNVENEMKR----LREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGK-DTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDA--HVERL--KPDGAPCYNKPTADVG-TAIGSPRIMRQNVMWE--YLEGDTLFVKWSV 2686
            +E++  C  C   L+   QT CG R C  CI +   +  ++CP   + E+ +  +   D  A REI+++ ++C N  C  + ++R    H+  C++   PC +CQ+ + +SE ++H N  C  R   C  C  NI    KQ          E++C  F       C +E    +L  H +  C +  + C  + +GC+ K+LR +   H+QE  + H++   D ++N     +                             E++  +  +L  E    R+  +L  + + +ET+     E+++    L E  ++L++    G       Y+WR+E F+   +    G  V + SPPFY+ + GYKL +R++     A +   ++S+F   ++GE+D   SWP    +   ++   +   HVE +  KPD    + +PT        G    M+   + +  ++  D L V+  V
Sbjct:   64 LESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCP--VDNEVLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQFH--------EQLC-LFANTVCEYCNMELIRNQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGV------YVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETKPD-LQAFQRPTVQRNPKGFGYVTFMQLQALHQRGFVRDDVLMVRCEV 520          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 124.79 bits (312), Expect = 1.213e-28
Identity = 114/475 (24.00%), Postives = 209/475 (44.00%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQHENV-CEERRTRCEYC--NITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEE-EIELKEHWER-CSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXX-------------------------XXEIESHK--ILMTEIFNTRESFELARIGM-SETEKNVENEMKR----LREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGK-DTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDA--HVERL--KPDGAPCYNKPTADVG-TAIGSPRIMRQNVMWE--YLEGDTLFVKWSV 2686
            +E++  C  C   L+   QT CG R C  CI +   +  ++CP   + E+ +  +   D  A REI+++ ++C N  C  + ++R    H+  C++   PC +CQ+ + +SE ++H N  C  R   C  C  NI    KQ          E++C  F       C +E    +L  H +  C +  + C  + +GC+ K+LR +   H+QE  + H++   D ++N     +                             E++  +  +L  E    R+  +L  + + +ET+     E+++    L E  ++L++    G       Y+WR+E F+   +    G  V + SPPFY+ + GYKL +R++     A +   ++S+F   ++GE+D   SWP    +   ++   +   HVE +  KPD    + +PT        G    M+   + +  ++  D L V+  V
Sbjct:   64 LESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCP--VDNEVLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQFH--------EQLC-LFANTVCEYCNMELIRNQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGV------YVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETKPD-LQAFQRPTVQRNPKGFGYVTFMQLQALHQRGFVRDDVLMVRCEV 520          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 123.635 bits (309), Expect = 3.161e-28
Identity = 76/251 (30.28%), Postives = 129/251 (51.39%), Query Frame = 2
Query: 1325 MEQQRTAIEVNEIIEIIRKQT-QIQIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCK-------ETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASA-HLNQCRYKRKPCEKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEE--EIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKI 2041
            M +Q     V+  +  I +Q   + +E + +C  C  +L++P Q +CG R C  C  +LT +GP  C  C+       E  + S+ E   D AA REI  +  KCPN  C+W G ++E    H  +C ++R  CE CQ  I  S++ +H E  CE R   C+YC +T ++K I+        ++IC +F  +C + CG ++    +  EH + C++ +  C  ++ GC+  +   +  +H Q +  EHL++
Sbjct:   11 MARQSLPSSVDSTLPGISRQVLSVSMEPKYQCQQCKGVLRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEMEHSMLSITEAFPDNAARREIDGLPAKCPNDGCSWNGTLKEYEVQHEGRCEFERVKCEACQMMILLSDKDRHNERECEARTLNCKYCKVTFSFKDIK------AHDEICQKFPMQCKD-CGKKKIPREKFAEHSKSCAKSKSACQFSEIGCRAVVDNGKQHEHEQSSIIEHLRL 254          

HSP 2 Score: 110.923 bits (276), Expect = 4.106e-24
Identity = 49/143 (34.27%), Postives = 86/143 (60.14%), Query Frame = 2
Query: 2276 YIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAH--VERLKPD-GAPCYNKPTADVGTAIGSPR---IMRQNVMWEYLEGDTLFVKWSV 2686
            ++W+I +F+R+ Q A  G   ++ SP FYS K GYK+ +R+Y NGDG G+ +H+S+FFV+++G++D L  WPFS K+   ++   +    ++  +PD  +  + +P +++  A G P    + +      YL  DT+F+K  V
Sbjct:  384 FVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 526          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 2.178e-26
Identity = 51/142 (35.92%), Postives = 85/142 (59.86%), Query Frame = 2
Query: 2279 IWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM---SAKDAHVERLKPD-GAPCYNKPTADVGTAIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            +W+I ++ R+ Q A  G  +S+ S PFY+   GY++  R Y NGDG G+ TH+S+FFV+++GE+D L  WPF  ++  T++   +A+    +  KPD  +  + +PT+D+  A G P  +    +    YL+ DT+F+K  V
Sbjct:  328 VWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLFVSHVALESASYLQDDTIFIKVVV 469          

HSP 2 Score: 54.299 bits (129), Expect = 4.854e-7
Identity = 47/168 (27.98%), Postives = 72/168 (42.86%), Query Frame = 2
Query: 1571 DRAASREIMNMRIKCPNKPCNWE-----GKIREASAHLNQCRYKRKPC--EKCQQPISESEEKQHENV-CEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEI---ELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKI 2041
            D    REI+ +R+ C N     +     GK++E   H+  C ++   C    C + +   E   H  + C  R   C YCN     +Q+         E  C R+   CPNKC  E+ I   EL  H   C  K+ EC  +++GCK K   +   +H     ++HL +
Sbjct:    5 DNCCRREILALRVHCRNDTAGCKQIVELGKLQE---HMAVCVHEAVNCPHAGCTERLLRGELVNHVALGCHFRTESCRYCN-----QQVPLAEKRKHYETRCPRYPIPCPNKCE-EQSIAREELVSHLGICPYKQAECFFSQFGCKYKGTLQGLKEHESGATQQHLSL 163          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 5.508e-24
Identity = 50/142 (35.21%), Postives = 81/142 (57.04%), Query Frame = 2
Query: 2279 IWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIM---SAKDAHVERLKPDGAP-CYNKPTADVGTAIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            +W+I ++ R+ Q A  G  +S+ S PFY+   GYK+  R Y NGDG G+ TH+S+FFV+++GE+D L  WPF  ++  +++   +A+    +   PD A   + +P  D+  A G P  +    +    YL  DT+FV+  V
Sbjct:  271 VWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLVDDTVFVRVVV 412          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 1.680e-21
Identity = 102/412 (24.76%), Postives = 173/412 (41.99%), Query Frame = 2
Query: 1403 ARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPD-CKETEIASLGETQ--EDRAASREIMNMRIKCPNKPCNWEGKIREAS-AHLNQCRYKRKPCEKCQQPISESEEKQHENV---CEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELK-EHWE--RCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESH------------------------KILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAP---------YIWRIEEFTRKWQRARDGTE--VSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNK 2503
            AR  CG+C  LL++  QT CG R C  CI  L  +  + C D    +       TQ   D A  RE+  + ++C ++ C W G++ E   AH+ +C +   PC      +     + H +V   C  R   C  C     ++Q+Q+  ++      C   R +    CG +   E K +H E  RC + R  CP +  GC  +   E    H + + E HL I  D  K   + +++   +   H                        K +  ++  +  S     I   ET + ++N+M R+ EH  +    +  G    +A          ++W+I+    + + A +G E    I SP F++ + GY+LR+R+  +G+      HVS + +L  G +D   +WP+  K
Sbjct:    1 ARFACGSCQGLLRDAVQTHCGHRFCKPCIARLITSVHRSCNDTLMNSNFLVYSPTQFFPDAALRREMGVLPVRCVSEGCEWRGRLLEYDVAHVERCDWVLVPCLLAGCALLLPRAELHRHVAQECSVRPVPCAACAQLLPYRQLQKHQLH------CRSRRTRECKLCGQKSIPEDKWQHHEERRCMKNRDTCPYSPLGCLYRGHGESLHNHDKNSVEVHLAIVYDAFKKTFEQLIKGHADNIKHPPSARLVAAEAQLATMDRRVEEVAKRVERDVRVSEASTRQGNIDRDETAR-LQNKMARV-EHSDQETERSILGLTRRLAELENTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSGE------HVSAYAMLGPGPYDATLAWPYQLK 398          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 99.3673 bits (246), Expect = 6.015e-21
Identity = 63/224 (28.12%), Postives = 108/224 (48.21%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIE---LTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEI---ELKEHWE-RCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIW 2044
            +E++  C  C   L+EP QT CG R C  CI+    L   GPK CP   +  +   G+   D  A REI+++ ++CPNKPC   G++R    H  +C Y + PC +C+ P+   +  +H E  C  R   C +C     +K  +        E++C      C +    ++E+   +L  H E  C + ++ C  +  GC+ +++R     H+ E  + H+++ 
Sbjct:   59 LESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPK-CP--VDNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKDSK------NHEQMCPLVVVNCKH---CQQELIREQLGPHLEVDCQQAQVPCTFSPLGCEAQMVRSLLAAHMHEHTQVHMRLL 270          
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Match: RPL35A (Ribosomal 60S subunit protein L35A; homologous to mammalian ribosomal protein L35 and bacterial L29; RPL35A has a paralog, RPL35B, that arose from the whole genome duplication [Source:SGD;Acc:S000002350])

HSP 1 Score: 84.7297 bits (208), Expect = 1.953e-19
Identity = 52/122 (42.62%), Postives = 81/122 (66.39%), Query Frame = 2
Query:   80 MVKLRASELTKKNKADLEKQLHQLKTELAELRVAKVTGAGGTKLGKIRVLRKSIARVMTVMHTKQKDSLRQYYQHRKLKPQGIRTKATRAMRRQLTDNQKNKKTVRQIRLDRAWPEIIYAIK 445
            M  ++A EL  K+K  L  QL  LK ELAEL+V K++      L KI+ +RKSIA V+TV++ +Q++++RQ Y+ +K +P+ +R K TRA+RR LT  + ++ T +Q +   A+P+  YAIK
Sbjct:    1 MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPS---LPKIKTVRKSIACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVTEKQRKKQIAFPQRKYAIK 119          
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Match: RPL35B (Ribosomal 60S subunit protein L35B; homologous to mammalian ribosomal protein L35 and bacterial L29; RPL35B has a paralog, RPL35A, that arose from the whole genome duplication [Source:SGD;Acc:S000002295])

HSP 1 Score: 84.7297 bits (208), Expect = 1.953e-19
Identity = 52/122 (42.62%), Postives = 81/122 (66.39%), Query Frame = 2
Query:   80 MVKLRASELTKKNKADLEKQLHQLKTELAELRVAKVTGAGGTKLGKIRVLRKSIARVMTVMHTKQKDSLRQYYQHRKLKPQGIRTKATRAMRRQLTDNQKNKKTVRQIRLDRAWPEIIYAIK 445
            M  ++A EL  K+K  L  QL  LK ELAEL+V K++      L KI+ +RKSIA V+TV++ +Q++++RQ Y+ +K +P+ +R K TRA+RR LT  + ++ T +Q +   A+P+  YAIK
Sbjct:    1 MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPS---LPKIKTVRKSIACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVTEKQRKKQIAFPQRKYAIK 119          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 159.073 bits (401), Expect = 9.628e-41
Identity = 128/478 (26.78%), Postives = 220/478 (46.03%), Query Frame = 2
Query: 1385 TQIQIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKP--CNWEGKIREASAHLNQCRYKRKPC--EKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWERCSRK-RIECPMAKWGCK--IKIL--REETIQHVQE-------TAEEHLKIWXXXXXXXXXXXXXXXXEIES----HKILMTEIFNTRESF--ELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAP----------------YIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAH--VERLKPD-GAPCYNKPTADVGTAIGSPRI--MRQNVMWEYLEGDTLFVKWSV 2686
            T   I A+  C  C  ++K+  QT CG R C+ CI  L   GP QC  C  T   +  ET  D+ A REI+ + + C N+P  C WEG++R    H  +C +    C   +C + +S ++  +H +N C+ R   C YC       ++++ H     EK C  +   CP KC  +E I ++ H    +R+ R+E      GC+  +++L   E  I+ +++          + ++I  +        +++    +E+    H++L+ E  +  +    E+ R+ +   E    +++ R  E   +L        N  IA                  +W+I     K   A  G   S  SP F++  +GYK+  R+Y NGDG G++ HVS+FFV+++GE+D L  WPF  K+   ++   +    ++  +PD  +  + +P A++  A G P      Q     Y+  DT+F+K  V
Sbjct:   14 TDTAIAAKHLCAKCRLIVKDAVQTACGHRYCSPCISPLLSRGPIQCDVCGST--ITKPETFRDKFADREILELHVHCVNQPHGCPWEGELRHRQNHHTKCEFNPISCVHPECGKKLSVAKLPEHLQNECQYREETCSYCEQPVVVARMKEHH-----EKTCPSYPVNCP-KCS-KELIRVEVHSTPFTREPRLE---KGRGCENTLEVLEDHESRIKKLEQRGGGIGVNGLQSMRISENIDNEAIGDVLRRVANVEAKGADHEVLVVEAHSAVDELRREVGRLNVKLQES---DDIIRRLERQLELHDQGTGLRNLAIADLEERLNTLQGTTFDSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDNVEHVIDAFRPDPSSSSFQRPRAEMNIASGCPLFCSHEQLTQHAYIRDDTMFLKIIV 476          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 152.91 bits (385), Expect = 8.900e-39
Identity = 122/497 (24.55%), Postives = 210/497 (42.25%), Query Frame = 2
Query: 1391 IQIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPK-QCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEK--CQQPISESEEKQHENV-CEERRTRCEYCNITETWKQIQQEH----------------------VNVKEEKI----------------------------CDRFRGKCPNKCGVEEEIE-LKEHW-ERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHVER------LKPD-GAPCYNKPTADVGTAIGSPRIMRQNVMW--EYLEGDTLFVKWSV 2686
            I +     C  C   L+ P QT+CG R C EC+ E +    + +CP  +E  +    +   D+AA R I++  +KCP K C WE ++R+  AH   C Y+   C    C   +   +  +H  V C+ R   CEYC   E+   +Q+ H                      ++V E  +                            CD+F   CPN CG +   E L++H  E C    + C    +GC+++I      QH+    + HL +                     +++L++   ++   F   + G+        NE+ ++R                    ++WRI +F    ++A+ G +V + S PF++ KNGYKLR  +YPNG  +GK+TH+S F  + +GE+D + +WPF+  +  T++  K+  ++R      + P+     +++P        GS   +    +W   Y+   TLF++  V
Sbjct:   17 IAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMDREP-LDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTCSNPMCSAQLPRMDVDEHLLVECDWRLIVCEYCG-DESPYCLQKAHARNCDYKLVTCSNPMCSAQLPRMDVDEHLLVECDWRLIVCEYCGDESPYCLQKDHSNQCDKFPVLCPNDCGTQITREKLRDHQSEECQFAVVPCAFRDFGCEVEIQNRLMDQHLDTNIQSHLNM-------------------TCNQLLLSR--DSGAQFHELQQGLGRV-----NELLKMR--------------------FVWRIPDFADSLRQAKLGLKVRLDSEPFFTEKNGYKLRATLYPNGTMSGKNTHISAFVSINRGEYDGILAWPFTRVIKITLLDQKENVLQRRNVEKTIIPNPSLENFHRPKTVSNNGRGSATFVSHEKLWTENYVVDGTLFMQVEV 465          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 147.902 bits (372), Expect = 3.174e-37
Identity = 128/458 (27.95%), Postives = 199/458 (43.45%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTE-CGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNK--PCNWEGKIREASAHLNQCRYKRKPCEK-CQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEI---ELKEHWER-CSRKRIECPMAKWGCKIKIL-------REETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHVER------LKP----DGAPCYNKPTADVGTAIGSPRIMRQN--VMWEYLEGDTLFVKWSV 2686
            ++ +  C  C  LL  P Q + CG R+CT+C  +L L+   +CP C +    ++ +   D+A   EI  + +KC N    C WEG + E S+H+ +C Y    CE  C          +H +  C E+   C YC+     K  +    N      C      CPNKC  +  I   EL  H E  C R ++ C     GC  +I        RE+  +H +     H+K+  D      +++M+   ++  H  L                        +E   KRL +  +   S             IWRIE++TRK + A+ G   ++ SP F + K+GY+L   V  NGDG GK TH+SVF  ++KG +D L  WPF  ++ F ++   D   +R      +KP    D  P   +P  +   + G  +  +    V   Y++ DT+F+K SV
Sbjct:   39 LQKKYICLDCEGLLWYPVQIKPCGHRVCTKCYTKL-LSSSARCPGCMDELNENIPDI--DKAFHEEIQELDVKCRNVEWNCKWEGCVNEFSSHVEKCDYSDILCENDCGAKFQRRFLTKHLDKDCPEKLITCLYCDEKHLRKDKKGHLEN------CPLLPCPCPNKCDKKLTIHRCELDSHVENDCPRTKLMCEYEVLGCGHRITGLEGGGSREKMPKHNKTNIIAHVKMVADLALKNKELIMRFSEKLSEHGTL------------------------IEKHEKRLNDLEKIAHSQ-----------LIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQRKHIRFSIKPNPCADNEPFLGRPRLEKNASFGGAKFAKHEEIVSRNYIKEDTIFLKISV 452          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO45915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA4])

HSP 1 Score: 135.191 bits (339), Expect = 2.847e-33
Identity = 113/449 (25.17%), Postives = 197/449 (43.88%), Query Frame = 2
Query: 1391 IQIEARLRCGACTKLLKEPRQ-TECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHLNQ-CRYKRKPCEK-CQQPISESEEKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIE--LKEHW-ERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDG-TEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMS------AKDAHVERLKPDGAPCYNKPTADVGTAIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            + ++    C  C   L++P Q T CG R+C  CI  +  N   +CP   +    ++G+   D A  R+I++M I CP+    C W+G I +   HL + C      C K C   +   + + H   C  R   C +CN     K++    +NV  +  C  F   CP  CG ++  +  L  H  + C    I C  A+ GC  K  R++   HVQE+                         + SH  ++ ++   +      ++ +S  ++ +  + + ++    + RS    GE      +IW+I+ F+RK   A+ G     + S  FY+  +GYK+   V+ NG G G+  ++SV   +  GE+D +  WP   +  FT++        K   V   +P      ++P+AD     G+ R + Q+ +    Y + +T+F+K+SV
Sbjct:   10 VPLDKSFECPVCLMALRDPVQVTPCGHRVCQTCIKPIIRNRRPRCP--LDNLTLNVGKIFPDNACHRQILSMDILCPHHGDGCEWQGTISDLEKHLERGCNLSEVRCPKDCGASVERGKLEGHYPECSRRLVNCTHCN-----KEVVFADMNVHLQS-CASFPISCPLTCGAKDLTKEALAVHLNQECPLLVIPCRFAEAGCTFKAKRQKMAAHVQES-------------------------LTSHVAMLCDLVCEQ------KLQISAQKERLLLQKEHIQLQIVECRSRCANGE------FIWKIQCFSRKLMDAKTGRASEPMISEAFYTSPHGYKMCAGVWLNGIGTGRGRYISVGLQVQSGEFDSILKWPLYPRYTFTLLDQSEDTKTKRDVVATFEPQS---ISRPSADRQLGKGARRFVLQDEVCGTTYCKDNTIFIKFSV 410          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 135.576 bits (340), Expect = 5.279e-33
Identity = 111/450 (24.67%), Postives = 196/450 (43.56%), Query Frame = 2
Query: 1400 EARLRCGACTKLLKEPRQT-ECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNK--PCNWEGKIREASAHLNQCRYKRKPCEK-CQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEI---ELKEHWER-CSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHVERLK----------PDGAPCYNKPTADVGTAIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            E +  C  C  +   P Q  ECG RLC  C   +  +   +CP C       + +   D+A   ++  +  +C N    C  E    +   H  +C Y    C+  C        +++H +  C ++   C YC+     ++ ++EH+     + C      CPNKC     I   +L EH E+ C R ++ C     GC+ +  RE+  +H++     H+K+    +    + +     + E H+ +M ++         +R+G  + EK   +++                         IWRIE++TRK + A+ G   ++ SP F + K+GY+L   V  NGDG GK TH+SVF  ++KG +D L  WPF  ++ F +++  +   ER            PD  P   +P  +   + G  + ++   +    +++ DT+F+K SV
Sbjct:   50 ERKHLCPVCEDIFVSPVQIKECGHRLCQHCYKTIWRSPEPKCPKCSGDLDDKIPDV--DQAFENDMNELPCRCINHEWGCKVEVPFTQMITHKGECEYSDILCDNDCGAKFQRRFKQKHLDKDCPKKIISCPYCD-DRHLRENKKEHL-----EDCLLIPLPCPNKCDKTLTIPRGQLDEHIEKECPRAKLMCEFESLGCQHRCSREKMAKHMKSEIIGHVKMIFGVVLEQKEKLDNHAQKFEEHETIMKQV--------DSRVG--DLEKIAHSQI-------------------------IWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFVSVLKGAFDALLKWPFHYRVTFFLLNQHENPEERKHVKFSIKPNPIPDNEPFLGRPRLEKNASFGGAKFIKHEEIESGNFIKDDTVFLKVSV 456          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 155.221 bits (391), Expect = 2.323e-39
Identity = 124/448 (27.68%), Postives = 206/448 (45.98%), Query Frame = 2
Query: 1400 EARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKP--CNWEGKIREASAHLNQCRYKRKPCE--KCQQPISESEEKQHEN-VCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLRE--------HYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDA--HV-ERLKPD-GAPCYNKPTADVGTAIGSPRIMRQNVM--WEYLEGDTLFVKWSV 2686
            EA+  C AC  +L +PRQTECG R C  CI ++       CP   + E     +   D    REIM +++ C ++   C  +  +++   H+N C +   PC   KC++ +   E  +H    C+ R + CE+C       ++Q+      +E +C  F   CPN            H    S  R E          K++   T + ++   E                + Q++ E+ES +  +  +     + E       ET+ N  ++M  + E         +Q L + +  G        IW+I ++ R+ Q A  G  +S+ S PFY+   GYK+  RVY NGDG GK TH+S+FFV+++GE+D L  WPF  K+   +M    +  H+ +  KPD  +  + +P A++  A G P  + Q+V+    Y++ DT+F+K +V
Sbjct:   43 EAKYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCP--ADMEPLFKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCPLGKCKERMMRKEIPEHLAWKCKYRESTCEFCKNKMPLTELQKH-----KETVCPAFPVSCPN------------HCTSSSLPRSE----------KLMSSHTEKLLELELELR-------------SLRQLRDEMESLRGTLDTVRTRLSALEQGGRASLETQLNRHDDMLSVHEIRLADMDLRFQVLETASYNGT------LIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMNIASGCPLFVSQSVLESGTYIKDDTIFIKVTV 442          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 140.198 bits (352), Expect = 3.903e-34
Identity = 110/499 (22.04%), Postives = 203/499 (40.68%), Query Frame = 2
Query: 1406 RLRCGACTKLLKEPRQ-TECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHLNQCRYKRKPC-EKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKI------------------------------------------------CDRFRGKCPNKCGVEEEI--ELKEHW-ERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHV-------ERLKPDG------APCYNKPTADVGT-AIGSPRIMRQNVMWE--YLEGDTLFVKWSV 2686
            R +C  C+K ++EP Q + CG R C  C+ E    G  +CP+  +       +   D    ++I+++ I+C +  + C W G++++   H + C +   PC  +C   ++  +   H ++ C +R+ +CE+C    T +  +       +E +                                                C RF  +CPN+CG       +L  H  + C    + CP    GCK +  +    +H+++T + HL +  + +                           +E  EL R            EM+ L   +  +               IW++ +++RK Q A+  +     SPPFY+ + GYKL++  + NG+G+G+ +H+SV+  ++ GE+D L  WPFS K+ F+I+   D  +       E   PD        PC  + + D  T   G P+ +    + +  Y+  + +F+K S+
Sbjct:   15 RFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE--DQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNLVSR-----------------------QRQEILELRR------------EMEELSVSHDGV--------------LIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKRNYIRDNCIFIKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 140.584 bits (353), Expect = 5.409e-34
Identity = 110/499 (22.04%), Postives = 203/499 (40.68%), Query Frame = 2
Query: 1406 RLRCGACTKLLKEPRQ-TECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHLNQCRYKRKPC-EKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKI------------------------------------------------CDRFRGKCPNKCGVEEEI--ELKEHW-ERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHV-------ERLKPDG------APCYNKPTADVGT-AIGSPRIMRQNVMWE--YLEGDTLFVKWSV 2686
            R +C  C+K ++EP Q + CG R C  C+ E    G  +CP+  +       +   D    ++I+++ I+C +  + C W G++++   H + C +   PC  +C   ++  +   H ++ C +R+ +CE+C    T +  +       +E +                                                C RF  +CPN+CG       +L  H  + C    + CP    GCK +  +    +H+++T + HL +  + +                           +E  EL R            EM+ L   +  +               IW++ +++RK Q A+  +     SPPFY+ + GYKL++  + NG+G+G+ +H+SV+  ++ GE+D L  WPFS K+ F+I+   D  +       E   PD        PC  + + D  T   G P+ +    + +  Y+  + +F+K S+
Sbjct:   15 RFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPE--DQLPLDYAKIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNLVSR-----------------------QRQEILELRR------------EMEELSVSHDGV--------------LIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKRNYIRDNCIFIKASI 462          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 135.191 bits (339), Expect = 1.580e-32
Identity = 110/500 (22.00%), Postives = 203/500 (40.60%), Query Frame = 2
Query: 1406 RLRCGACTKLLKEPRQ-TECGCRLCTECIIE-LTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPN--KPCNWEGKIREASAHLNQCRYKRKPC-EKCQQPISESEEKQH-ENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKI------------------------------------------------CDRFRGKCPNKCGVEEEI--ELKEHW-ERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHV-------ERLKPDG------APCYNKPTADVGT-AIGSPRIMRQNVMWE--YLEGDTLFVKWSV 2686
            R +C  C+K ++EP Q + CG R C  C+ E L++  P          +  L +   D    ++I+++ I+C +  + C W G++++   H + C +   PC  +C   ++  +   H ++ C +R+ +CE+C    T +  +       +E +                                                C RF  +CPN+CG       +L  H  + C    + CP    GCK +  +    +H+++T + HL +  + +                           +E  EL R            EM+ L   +  +               IW++ +++RK Q A+  +     SPPFY+ + GYKL++  + NG+G+G+ +H+SV+  ++ GE+D L  WPFS K+ F+I+   D  +       E   PD        PC  + + D  T   G P+ +    + +  Y+  + +F+K S+
Sbjct:   15 RFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSIFFP----------MGLLPQIYPDPELEQQILSLPIRCIHSEEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSEFTGEAFENHQGVCPQESVYCENKCGARMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTMMCNLVSR-----------------------QRQEILELRR------------EMEELSVSHDGV--------------LIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKRNYIRDNCIFIKASI 455          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 123.25 bits (308), Expect = 3.390e-28
Identity = 69/228 (30.26%), Postives = 123/228 (53.95%), Query Frame = 2
Query: 1391 IQIEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETE-------IASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASA-HLNQCRYKRKPCEKCQQPISESEEKQHENV-CEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEE--EIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKI 2041
            + +E + +C  C ++L++P Q +CG R C  C  +LT +GPK C  C++ E       I +  E   D AA REI ++  +C N+ C+W G I+E  A H  +C +++  CE CQ  +   ++ +H +  CEER   C+YC +T  +K I+        ++IC +F  +C + CG ++    +  +H + C++ +  CP ++ GCK  +   +  +H   +  EHL++
Sbjct:   29 VPMEDKYKCQQCLQVLRKPVQAQCGHRFCVHCFRQLTSSGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARCLNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNCKYCKVTFNFKDIK------AHDEICQKFPLQCKD-CGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEHLRL 249          

HSP 2 Score: 106.686 bits (265), Expect = 9.387e-23
Identity = 48/143 (33.57%), Postives = 84/143 (58.74%), Query Frame = 2
Query: 2276 YIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAH--VERLKPD-GAPCYNKPTADVGTAIGSPR---IMRQNVMWEYLEGDTLFVKWSV 2686
            ++W+I +F+ + Q A  G   ++ SP FYS K GYK+ +R+Y NGDG G+ TH+S+FFV+++ ++D L  WPFS K+   ++   +    ++  +PD  +  + +P +++  A G P    + +      YL  DT+F+K  V
Sbjct:  376 FVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAFRPDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 518          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000023758.1 (SMESG000023758.1)

HSP 1 Score: 332.028 bits (850), Expect = 3.518e-90
Identity = 165/429 (38.46%), Postives = 258/429 (60.14%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHVERLKPDGAPCYNKPTADVGTAIGSPRIMRQNVMW--EYLEGDTLFVK 2677
            I+ RL+C  C +LL   RQT+CGCR+CT+C IE+      +CP C ET       T  D+A ++EI N+ I+C  K C W+G ++EA +H N+C Y    CEKCQ  +++   K+H  VC +R  +CE+C + + W +I+ EH N KEE+ICD + G C N C  +++++LKEHW  CS K ++CP+    C++++   E  +H+ E + EH +I M T+  +   +  ++ E ++ K L+ EI  +R++FE ++    +    +E +M+++    ++L + +     PP AP+IW+I EF  K QRA+DGT+  + SPP YSWKNGYKL +R+YPNGDG    TH+SVF  + +G++DEL +WPF   M  T M  ++ +   ++    P   +PT D  TAIG+PR   Q  +    +L  D L+ K
Sbjct: 3600 IKERLKCCKCRELLIGARQTKCGCRICTDCTIEVIETQTIKCPGCDETMERDEDPTTMDKATNKEINNLLIQCQVKECEWKGLMKEAESHTNECEYNEILCEKCQTILTKKTMKEHHKVCIKREEKCEFCGVIDEWIKIEMEHRNPKEEQICDLYEGTCANNCDKKDKVKLKEHWNECSGKPVKCPLELLKCQVRLPITEMQKHMMENSIEHTEIMMKTIGMLAWEVKSLRTENDAQKALIREILESRKNFERSQGNTLKKMAEIEKKMQQMTNSLKELETNSSIARKPPTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWKNGYKLGIRLYPNGDGNATGTHISVFIRVGRGDYDELLTWPFKQNMILT-MKGQEDYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYKK 4027          

HSP 2 Score: 75.0998 bits (183), Expect = 1.419e-12
Identity = 87/265 (32.83%), Postives = 135/265 (50.94%), Query Frame = 3
Query: 3783 SERKTNGVLKEAKIWKQKYQAAMKELKEFPEKRVPLDNLQMWEQLEEQKVETE--NSQA---------------RLRLQEKREEN----LRKFTTVKVNQLTKIQDQMRKLAEGKEQSDLQVEIEKSRLECTEQEIDKYKKMCEQRDLAIHRQKALRGSEKEVFETKARELQAEIERLEAREITSTLEREVEDLTEEVNQLLYMLDGEMNISQELRERINEIVNIPPIVWTSLIPIMSVPTNTMNMGEPTEQPQETIIDEGFVEV 4514
            +E K   + +EAK WK+ +Q A KE++   ++ + +++ ++WEQ+E QK   E  N Q                RLR  EK  E     + K +    NQLT  + Q ++L E  + ++LQ E+   R     +EI + +   E  +    + +A   + K+ +E   + L+ EIE+L+A E T  LE +VE+LTE    L Y+LD E+ IS  LRE IN + N PPI+   L+P+   PT  +     T+ P E   DEGF E 
Sbjct: 4752 TEIKEKAIKREAKKWKEHFQEAKKEIRLLLKRILNMEDWELWEQVEVQKATIEELNEQVQNLEFREKIRQGTIRRLRRHEKEYEQQFNEMYKRSAETRNQLTDEKRQNQQLNE--KITELQQEVNGHRGVAVFKEI-QLRHQHEVNEQLKEQVEAEIKTIKQGYEENEQNLRKEIEKLKALENTHRLEMQVEELTENTEYLAYLLDEEIQISNALREEINALQNRPPIL---LMPLY--PTEIL-----TQVPAEP--DEGFGET 5001          

HSP 3 Score: 71.633 bits (174), Expect = 1.691e-11
Identity = 33/106 (31.13%), Postives = 63/106 (59.43%), Query Frame = 2
Query: 2384 LRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAK---DAHVERLKPDG-APCYNKPTADVGTAIGSPR-IMRQNVMWEYLEGDTLFVKWSV 2686
            +++RVYPNGDG GK  ++SV+F+L +G +D    WPF+ K+  +I   +   + H E+L  D  +    KP +    A G P+ ++++ +  ++++ DT+++   V
Sbjct:    1 MKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPRKWEEQHSEKLGVDPRSMISQKPRSTENVAGGVPQFLLKKYITPQFVKDDTIYITIEV 106          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000010523.1 (SMESG000010523.1)

HSP 1 Score: 327.791 bits (839), Expect = 4.833e-89
Identity = 163/432 (37.73%), Postives = 260/432 (60.19%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHVERLKPDGAPCYNKPTADVGTAIGSPRIMRQNVMW--EYLEGDTLFVKWSV 2686
            I+ RL+C  C +LL   RQT+CGCR+CT+C IE+      +CP C ET       T  D+A ++EI N+ ++C  K C W+G ++EA +H N+C Y    CEKCQ  I++   K+H  +C +R  +CE+C +T+ W +I+ EH N KEE+ICD + G C N C  +++++LKEHW  CS K ++CP+  + C+ ++   E  +H+ E + EH +I M T+  +   +  ++ E ++ K ++ EI  +R++FE ++    +    +E +M+++  + ++L +        P AP+IW+I EF  K QRA+DGT+  + SPP YSW+NGYKL +R+YPNGDG    TH+SVF  + +G++DEL +WPF   M  T M  ++ +   ++    P   +PT D  TAIG+PR   Q  +    +L  D L++K  V
Sbjct: 3791 IKERLKCCKCKELLIGARQTKCGCRICTDCTIEVIETQTIKCPGCDETFEEDEDPTTMDKATNKEINNLLVQCRVKECEWKGLMKEAESHTNECEYNEILCEKCQTIITKKTMKEHHKICIKREEKCEFCGVTDEWIKIEMEHRNPKEEQICDLYEGVCANNCDKKDKVKLKEHWNECSGKPVKCPLELFNCQTQLPMAEMQKHMMENSIEHTEIMMKTIGMLAWEVKSLRTENDAQKAIIREILESRKNFEKSQGDTLKKMVEMEKKMQQMTNNIKELETNNSITRKHPTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWENGYKLGIRLYPNGDGNATGTHISVFIRVGRGDYDELLTWPFKQNMILT-MKGQEDYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEV 4221          

HSP 2 Score: 100.523 bits (249), Expect = 3.111e-20
Identity = 49/145 (33.79%), Postives = 86/145 (59.31%), Query Frame = 2
Query: 2267 IAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSA---KDAHVERLKPD-GAPCYNKPTADVGTAIGSPR-IMRQNVMWEYLEGDTLFVKWSV 2686
            +APY W+I  +  K + A +   + ITS  FY+   GY++++RVYPNGDG GK  ++SV+F+L +G +D    WPF+ K+  +I      ++ H E+L  D G+    KP +    A G P+ ++++ V  ++++ DT+++   V
Sbjct:  320 LAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGMDPGSMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEV 464          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000010523.1 (SMESG000010523.1)

HSP 1 Score: 327.791 bits (839), Expect = 4.926e-89
Identity = 163/432 (37.73%), Postives = 260/432 (60.19%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHVERLKPDGAPCYNKPTADVGTAIGSPRIMRQNVMW--EYLEGDTLFVKWSV 2686
            I+ RL+C  C +LL   RQT+CGCR+CT+C IE+      +CP C ET       T  D+A ++EI N+ ++C  K C W+G ++EA +H N+C Y    CEKCQ  I++   K+H  +C +R  +CE+C +T+ W +I+ EH N KEE+ICD + G C N C  +++++LKEHW  CS K ++CP+  + C+ ++   E  +H+ E + EH +I M T+  +   +  ++ E ++ K ++ EI  +R++FE ++    +    +E +M+++  + ++L +        P AP+IW+I EF  K QRA+DGT+  + SPP YSW+NGYKL +R+YPNGDG    TH+SVF  + +G++DEL +WPF   M  T M  ++ +   ++    P   +PT D  TAIG+PR   Q  +    +L  D L++K  V
Sbjct: 3747 IKERLKCCKCKELLIGARQTKCGCRICTDCTIEVIETQTIKCPGCDETFEEDEDPTTMDKATNKEINNLLVQCRVKECEWKGLMKEAESHTNECEYNEILCEKCQTIITKKTMKEHHKICIKREEKCEFCGVTDEWIKIEMEHRNPKEEQICDLYEGVCANNCDKKDKVKLKEHWNECSGKPVKCPLELFNCQTQLPMAEMQKHMMENSIEHTEIMMKTIGMLAWEVKSLRTENDAQKAIIREILESRKNFEKSQGDTLKKMVEMEKKMQQMTNNIKELETNNSITRKHPTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWENGYKLGIRLYPNGDGNATGTHISVFIRVGRGDYDELLTWPFKQNMILT-MKGQEDYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEV 4177          

HSP 2 Score: 100.523 bits (249), Expect = 3.267e-20
Identity = 49/145 (33.79%), Postives = 86/145 (59.31%), Query Frame = 2
Query: 2267 IAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSA---KDAHVERLKPD-GAPCYNKPTADVGTAIGSPR-IMRQNVMWEYLEGDTLFVKWSV 2686
            +APY W+I  +  K + A +   + ITS  FY+   GY++++RVYPNGDG GK  ++SV+F+L +G +D    WPF+ K+  +I      ++ H E+L  D G+    KP +    A G P+ ++++ V  ++++ DT+++   V
Sbjct:  320 LAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGMDPGSMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEV 464          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000010523.1 (SMESG000010523.1)

HSP 1 Score: 327.791 bits (839), Expect = 4.957e-89
Identity = 163/432 (37.73%), Postives = 260/432 (60.19%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHVERLKPDGAPCYNKPTADVGTAIGSPRIMRQNVMW--EYLEGDTLFVKWSV 2686
            I+ RL+C  C +LL   RQT+CGCR+CT+C IE+      +CP C ET       T  D+A ++EI N+ ++C  K C W+G ++EA +H N+C Y    CEKCQ  I++   K+H  +C +R  +CE+C +T+ W +I+ EH N KEE+ICD + G C N C  +++++LKEHW  CS K ++CP+  + C+ ++   E  +H+ E + EH +I M T+  +   +  ++ E ++ K ++ EI  +R++FE ++    +    +E +M+++  + ++L +        P AP+IW+I EF  K QRA+DGT+  + SPP YSW+NGYKL +R+YPNGDG    TH+SVF  + +G++DEL +WPF   M  T M  ++ +   ++    P   +PT D  TAIG+PR   Q  +    +L  D L++K  V
Sbjct: 3793 IKERLKCCKCKELLIGARQTKCGCRICTDCTIEVIETQTIKCPGCDETFEEDEDPTTMDKATNKEINNLLVQCRVKECEWKGLMKEAESHTNECEYNEILCEKCQTIITKKTMKEHHKICIKREEKCEFCGVTDEWIKIEMEHRNPKEEQICDLYEGVCANNCDKKDKVKLKEHWNECSGKPVKCPLELFNCQTQLPMAEMQKHMMENSIEHTEIMMKTIGMLAWEVKSLRTENDAQKAIIREILESRKNFEKSQGDTLKKMVEMEKKMQQMTNNIKELETNNSITRKHPTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWENGYKLGIRLYPNGDGNATGTHISVFIRVGRGDYDELLTWPFKQNMILT-MKGQEDYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEV 4223          

HSP 2 Score: 100.523 bits (249), Expect = 3.164e-20
Identity = 49/145 (33.79%), Postives = 86/145 (59.31%), Query Frame = 2
Query: 2267 IAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSA---KDAHVERLKPD-GAPCYNKPTADVGTAIGSPR-IMRQNVMWEYLEGDTLFVKWSV 2686
            +APY W+I  +  K + A +   + ITS  FY+   GY++++RVYPNGDG GK  ++SV+F+L +G +D    WPF+ K+  +I      ++ H E+L  D G+    KP +    A G P+ ++++ V  ++++ DT+++   V
Sbjct:  320 LAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGMDPGSMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEV 464          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000010523.1 (SMESG000010523.1)

HSP 1 Score: 327.791 bits (839), Expect = 4.961e-89
Identity = 163/432 (37.73%), Postives = 260/432 (60.19%), Query Frame = 2
Query: 1397 IEARLRCGACTKLLKEPRQTECGCRLCTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNKPCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQHENVCEERRTRCEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWERCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWXXXXXXXXXXXXXXXXEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHYQKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSAKDAHVERLKPDGAPCYNKPTADVGTAIGSPRIMRQNVMW--EYLEGDTLFVKWSV 2686
            I+ RL+C  C +LL   RQT+CGCR+CT+C IE+      +CP C ET       T  D+A ++EI N+ ++C  K C W+G ++EA +H N+C Y    CEKCQ  I++   K+H  +C +R  +CE+C +T+ W +I+ EH N KEE+ICD + G C N C  +++++LKEHW  CS K ++CP+  + C+ ++   E  +H+ E + EH +I M T+  +   +  ++ E ++ K ++ EI  +R++FE ++    +    +E +M+++  + ++L +        P AP+IW+I EF  K QRA+DGT+  + SPP YSW+NGYKL +R+YPNGDG    TH+SVF  + +G++DEL +WPF   M  T M  ++ +   ++    P   +PT D  TAIG+PR   Q  +    +L  D L++K  V
Sbjct: 3798 IKERLKCCKCKELLIGARQTKCGCRICTDCTIEVIETQTIKCPGCDETFEEDEDPTTMDKATNKEINNLLVQCRVKECEWKGLMKEAESHTNECEYNEILCEKCQTIITKKTMKEHHKICIKREEKCEFCGVTDEWIKIEMEHRNPKEEQICDLYEGVCANNCDKKDKVKLKEHWNECSGKPVKCPLELFNCQTQLPMAEMQKHMMENSIEHTEIMMKTIGMLAWEVKSLRTENDAQKAIIREILESRKNFEKSQGDTLKKMVEMEKKMQQMTNNIKELETNNSITRKHPTAPFIWKITEFAEKLQRAKDGTQRILDSPPIYSWENGYKLGIRLYPNGDGNATGTHISVFIRVGRGDYDELLTWPFKQNMILT-MKGQEDYRNPIRTGNEPQMGRPTTDWNTAIGTPRFYPQQRLRGEGFLREDNLYIKLEV 4228          

HSP 2 Score: 100.523 bits (249), Expect = 3.138e-20
Identity = 49/145 (33.79%), Postives = 86/145 (59.31%), Query Frame = 2
Query: 2267 IAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKNGYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMSA---KDAHVERLKPD-GAPCYNKPTADVGTAIGSPR-IMRQNVMWEYLEGDTLFVKWSV 2686
            +APY W+I  +  K + A +   + ITS  FY+   GY++++RVYPNGDG GK  ++SV+F+L +G +D    WPF+ K+  +I      ++ H E+L  D G+    KP +    A G P+ ++++ V  ++++ DT+++   V
Sbjct:  320 LAPYTWKIGGWAEKVKSAEEEKIIGITSHQFYTEIGGYRMKLRVYPNGDGVGKGKYLSVYFLLARGRYDGKLEWPFNRKVTISIAKPGKWEERHSEKLGMDPGSMISQKPKSTENVAGGVPQFLLKKYVTPQFVKDDTIYITIEV 464          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF33.629e-3928.29TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF23.919e-3724.95TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF31.815e-3424.27TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.815e-3424.27TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF53.460e-3122.97TNF receptor associated factor 5 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trf-17.610e-3121.97TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
rpl-351.696e-2147.6660S ribosomal protein L35 [Source:UniProtKB/Swiss... [more]
rpl-351.696e-2147.6660S ribosomal protein L35 [Source:UniProtKB/Swiss... [more]
rpl-351.696e-2147.6660S ribosomal protein L35 [Source:UniProtKB/Swiss... [more]
trf-29.849e-1025.13TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RpL358.221e-3150.82gene:FBgn0029785 transcript:FBtr0070801[more]
RpL358.221e-3150.82gene:FBgn0029785 transcript:FBtr0345788[more]
RpL358.221e-3150.82gene:FBgn0029785 transcript:FBtr0070800[more]
Traf49.369e-2622.22gene:FBgn0026319 transcript:FBtr0334401[more]
Traf42.517e-2224.35gene:FBgn0026319 transcript:FBtr0077429[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a8.231e-3422.16tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a8.231e-3422.16tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf67.617e-3125.57TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf67.617e-3125.57TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf67.617e-3125.57TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh22.592e-3626.01slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh23.397e-3525.96slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
sytl29.049e-3422.27synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
TRAF21.412e-3224.03TNF receptor associated factor 2 [Source:NCBI gene... [more]
slc12a18.204e-3024.12solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf22.328e-4526.60TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf21.644e-4326.42TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf39.781e-3524.27TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf39.781e-3524.27TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf51.475e-3224.42TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39429|TRAF2_MOUSE1.628e-4426.60TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN1.882e-3624.95TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|Q6DJN2|TRF6B_XENLA6.335e-3225.00TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|Q3MV19|TRF6A_XENLA3.101e-3125.62TNF receptor-associated factor 6-A OS=Xenopus laev... [more]
sp|Q61382|TRAF4_MOUSE4.751e-3122.85TNF receptor-associated factor 4 OS=Mus musculus O... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG602.409e-6632.13TNF receptor-associated factor-2-like protein B OS... [more]
T1DBK63.327e-6029.35TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A4W5P1755.660e-5529.30TNF receptor-associated factor OS=Hucho hucho OX=6... [more]
T1DF657.001e-5528.06TRAF-2 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A4W4H2M41.488e-5427.98TNF receptor-associated factor OS=Electrophorus el... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2a5.109e-3625.32TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf4a9.052e-3321.96TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf61.213e-2824.00TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.213e-2824.00TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf2b3.161e-2830.28TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.12.178e-2635.92pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.15.508e-2435.21pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000008091.11.680e-2124.76pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
traf66.015e-2128.13TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPL35A1.953e-1942.62Ribosomal 60S subunit protein L35A; homologous to ... [more]
RPL35B1.953e-1942.62Ribosomal 60S subunit protein L35B; homologous to ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO388739.628e-4126.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412438.900e-3924.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328513.174e-3727.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459152.847e-3325.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328495.279e-3324.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf32.323e-3927.68TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf4a3.903e-3422.04TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a5.409e-3422.04TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a1.580e-3222.00TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf2b3.390e-2830.26TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023758.13.518e-9038.46SMESG000023758.1[more]
SMESG000010523.14.833e-8937.73SMESG000010523.1[more]
SMESG000010523.14.926e-8937.73SMESG000010523.1[more]
SMESG000010523.14.957e-8937.73SMESG000010523.1[more]
SMESG000010523.14.961e-8937.73SMESG000010523.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013205 ID=SMED30013205|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=11006bp
TAAAGTTTATAAAATTTAAATAATATTTGTTTAAATATATAGAATAGTTT
TAGAAGTAAAATTTTAAATATCTACAAAAATGGTCAAACTTCGTGCTTCA
GAATTGACTAAGAAAAATAAAGCTGATTTAGAAAAACAATTACATCAGCT
TAAAACTGAATTGGCTGAATTACGAGTTGCCAAAGTTACTGGTGCTGGAG
GAACCAAATTGGGAAAAATTCGTGTCTTGAGAAAATCAATTGCTCGAGTA
ATGACTGTTATGCATACAAAGCAAAAGGACAGTTTGAGACAATATTACCA
ACATAGGAAATTAAAACCACAAGGTATTAGAACTAAAGCAACAAGAGCTA
TGCGACGTCAATTGACAGACAATCAAAAGAACAAAAAAACTGTTCGTCAA
ATCCGTTTGGACAGAGCATGGCCCGAAATTATTTATGCTATTAAGCAATA
AATTTTAAAATATAGTTTGGAAATTTAAAAAAAAAAAAAAAAAAATCCAC
AACAAAAAGGGAAACAGACGAATCAACAAAAATGGAAACGATCAAACAAG
AAAATGAACTGAGAAAACAAAAGCGGTGTAATGAGGCGGTTTAGAAAGTC
AAAACCTCTCCTAAATTATAACGAATATAGATAAAGGGAATATGAGTGTA
TATAATGTATAAATTGTAAATATATCAGTAATATAAAGCGGTATGTATAT
TATATGAAACCCTGTAAATTAATGTAAAAATGAATTCGAGACACAAATAC
TGAACATAAAAACGACATTGAGATACGAATAATGAATACAAATTAAGGAA
GATGGAACAGAATTATCAAACAAGTACGAACAACGAAACAGTAATCGAAA
TGTGGAAACGGCAATATAACGCCCTAACGAAAGTAGTAAACACGTTACAA
GAACAATGGACGGAGAGCCAAATAGCGTTGAGAGAGGCTCTAAATACAAA
CATGTATCACTTACTAAACATAGAGGAACAACAGAGACGAATGAATGAAA
TGGAACGAGAATTACAAATATTAAGAACAGAAAATCAATGGCAGAGAAAC
GAGTTGCAGAGAGTAGAGGAAGAAACGGAAGAGGAACCACAGGTAGAATG
GAGTGAATGGATATTAAACCAAGTCGAGGAAAGAGTAGAACCAGACTCAT
CGAGTAACGTGGAGTAGAAGGGAAAAGAATGTACATATGTAAAAAGAGTA
AAAGTATAAAGCAAAGAAAAACCCAAAAATCAAAAATTATAAAAATAGGT
GTAAATAAAGAATACGAAGCTAATAAATATATAAAACCTAAACAGCCAAA
CTGACATGTAAATAATTATAGAAAATGGAACAACAAAGAACCGCAATAGA
GGTCAATGAAATTATCGAGATAATCAGAAAACAAACCCAGATACAAATAG
AAGCGAGATTACGATGCGGAGCATGTACTAAATTGTTAAAGGAGCCAAGG
CAAACAGAATGCGGATGTAGACTATGCACCGAATGTATAATAGAATTAAC
ACTAAATGGCCCAAAACAATGTCCAGACTGCAAGGAAACAGAAATCGCAT
CATTAGGAGAAACGCAGGAAGATCGAGCGGCTAGTAGGGAAATAATGAAC
ATGAGAATAAAGTGCCCAAACAAACCCTGCAATTGGGAAGGAAAAATCAG
AGAGGCAAGCGCTCACTTAAATCAATGTAGATATAAAAGGAAACCATGCG
AAAAATGTCAACAACCCATAAGTGAAAGTGAAGAGAAACAACATGAAAAC
GTGTGCGAAGAAAGGCGAACAAGATGCGAATATTGCAATATCACCGAAAC
ATGGAAGCAAATACAACAGGAGCACGTAAACGTTAAAGAGGAAAAGATTT
GTGACAGATTCCGAGGAAAATGCCCAAACAAATGTGGAGTCGAGGAAGAA
ATAGAACTCAAAGAACATTGGGAAAGATGTAGTAGAAAACGAATAGAATG
CCCAATGGCAAAATGGGGATGTAAAATAAAAATACTGAGAGAAGAGACGA
TACAACATGTGCAAGAAACGGCCGAGGAACACCTAAAGATATGGATGGAT
ACTATGAAAAATATGGATCAAATGATGATGCAGATAAAAATCGAAATTGA
ATCACATAAAATACTAATGACAGAAATATTCAACACCAGAGAGTCATTCG
AATTGGCACGAATAGGAATGTCAGAAACAGAAAAGAATGTAGAAAATGAA
ATGAAAAGACTAAGAGAACATTACCAGAAATTAAGAAGTTACACACCCAC
GGGAGAAAATCCACCGATTGCTCCATATATATGGAGAATCGAGGAATTCA
CAAGGAAATGGCAGAGAGCAAGAGATGGAACGGAAGTATCCATAACCAGT
CCACCATTTTATTCATGGAAAAACGGATATAAACTGAGAATGAGGGTATA
TCCAAATGGAGACGGAGCCGGAAAAGATACCCACGTATCTGTATTTTTCG
TACTAGTAAAAGGAGAATGGGACGAACTACAATCATGGCCGTTCAGCAAT
AAAATGGCCTTCACAATAATGTCAGCAAAGGATGCACATGTAGAGAGGCT
CAAACCAGACGGAGCGCCCTGCTACAATAAACCAACAGCAGATGTAGGTA
CAGCAATAGGGTCGCCAAGAATAATGAGACAAAACGTAATGTGGGAATAC
CTAGAAGGAGACACATTATTCGTAAAATGGTCGGTAGAAAGAGAAGGAAC
GGGAAGGACGGAGTAAGGAAGGAGAAATGTGTAAAGTGTAAATAAATATA
AATATATGTCTATGTATAAATAATATAAAAGTAGTGCCATAAAACCAAAA
ACTAGTTATGCGTAAACTGAGAAAATAATAACCACCGCGAATAACAAACC
TTAATTGTAAATATTACTTGTAGAAAATGAATAACAAAGAAATAACGATC
GAGATAATAAACCACCTACCAGTAATAAAGATGATGCAAATCATGGGTAA
CGAACACCAAAGAGCAATACTAATAAAAAATGAAGAGATGGGAACGATGA
ATAAAATAAAAACAGAGACCGAGAAGTGCGAGAGAATGTGGCAACAATTA
CAAAATGGGCATGAAGGCAAGCTGATCATGAGACAAACTAACAACGTAAT
GAATAGAGTCAGAGAAATATACGAGGAAGGGATAGAAGAGTTCGAGAAAT
TGATAAAGAGAAAGATAGAACAAGATATACGAGAGGAAAAGAGAAAGTAT
GCGTCACAACAATTAGAAGAAACCCAAAAAGCCGAGATGGAAAAACTCCA
AAAACAAGTCGAAGAGCAAGAAACGAGAATGAAACATGGGAAAGTTATGT
TGGAGCTGCTAAACAAAAACATAACGGAGTTAAAAGAGAAAGCAAATGAG
GTGAAATTAAAATATTACAGAGAAGTAATCAACACCACGTATCAACAAAG
AGTGATGGACAAATCAATCCAGGAGAAGAAAGAACTCCAAGTAAGAAATG
AAGAATCAAAATTGGAAGTAATGTTTGGAAAGGCAATGCTGGAGTTAGCT
AGCCTAAGAAGCAGTCGGTTGGAAGAAGAAGTGGAAAAACTGAACAAAAG
ATTGATAAAGAAAGTAGAGGAACTAGAAAAAATGCGGGCAAAATATCTAA
GTCAATTAGCAAGAGCAACCTTTAACCAATGTCGAATTGAGGGAGCCGGT
AGGAAAAATAAAGACCTCGAAGCCCAAATCGAACAAATAGGGAACGTACA
AGTTAAAATCCGAGAGGAGTTAGAACGTACCAAAAAAGAACAAACCGCAC
AAGTAGTTGAATGGACAAAAGTGATAAGTGCAAGCGAAAGGAAAACAAAT
GGAGTATTAAAAGAAGCCAAAATTTGGAAACAGAAGTACCAAGCGGCAAT
GAAGGAGCTGAAAGAATTCCCCGAGAAGCGTGTACCTCTCGATAATCTAC
AAATGTGGGAACAGCTCGAAGAGCAAAAAGTGGAAACAGAAAATTCGCAA
GCTCGATTAAGACTACAAGAAAAAAGAGAAGAGAACCTTAGAAAATTCAC
GACGGTGAAAGTGAATCAGTTAACAAAGATACAGGATCAAATGCGAAAAC
TAGCCGAAGGTAAAGAACAGAGCGACTTGCAGGTAGAGATAGAAAAAAGC
AGATTGGAGTGCACAGAGCAGGAAATAGATAAATACAAGAAAATGTGCGA
ACAAAGAGACCTCGCAATTCACCGACAAAAAGCGCTTAGAGGAAGCGAAA
AGGAAGTATTCGAAACCAAAGCGAGAGAACTACAAGCAGAAATAGAGAGA
TTGGAAGCTCGAGAAATCACCTCGACATTGGAAAGAGAAGTAGAGGATCT
CACAGAAGAGGTAAACCAACTGTTATATATGCTGGACGGGGAAATGAATA
TATCGCAAGAATTGCGAGAAAGGATAAACGAGATAGTGAATATCCCACCC
ATTGTGTGGACTTCACTAATACCAATAATGTCAGTGCCGACCAACACTAT
GAATATGGGAGAACCAACGGAGCAACCACAAGAAACCATAATAGACGAAG
GGTTCGTGGAAGTGTGGGGCACATGGGTGTAGAATGAATGACAAGAGATG
AAAATGTAAAAAATGTAAAGATATGTAAATATTGAAGTAAATAAAACGAA
AAATTAGAAAACGAATAAAAATTAAAATTAAAAACAAGATAAAACCCATA
AAAAGAATAAAAAATGCACAAAATCATAAAAATATAAAAAGAAACCAAAA
AAAACAAAACATTGATGTACAAAATTTGTAGAAAATTGATAATCAGAGAA
AACTAACAACAATTGAAGGAGAGTCCGGCGAGACCACTTACAACGTAAGC
ATCAAACCTATAAAGGTTGAAGTGGAGAACGAGTATCCACTACCAATAAT
ATGTAAGACCGAGGAGGTAGTGGAAGGAGAAGGAAGTGAACAGGAAGAAA
TGATAAAAAATATAAAAATGGCGATGGAACAGCAAATTCAAGAAAGACTG
TATAACCAATCAGTGGTTCCAATCGCGAAATTTAATAAAGGCGTTAAAAA
TAGAATTTGAGGTATTAAAAAAACAACGAGAAGAAGTAGAAGACGAAAAC
GATTGGTTGAAACAGAAAATCGAAGTAAACAAGGGTTGGGAAGAAAAAGT
AGAGGAACTGGAAACCGAACTGGCAACAAAATGGTCAAGACATGTGTTGG
AGGACCATTGGAAAACCCAAGCAAAGAAAATGCCATAAAACCAAAAACTT
GAACCGAGCATACAGGAAGCTCGAAGAATATGCAATAAAACAGTACAAGA
AGGTACAGCAAAATACACAACAAATACGAGTATCAAAAGAGGCAAAGGAG
AGCCAAAAGAATGCTATAGAAGAGAAAGACAAAATCATTACCCTAATCCC
CGAAATAAGAAATAGACTGATAAGAGCAGAATTAATGCTAATGAACCACC
CAACCCTTAAACATCAAGACAAAACCAACCCAGAATAAAATAGTGCGAAA
AACGAAAGTTGTACCTCAATGTAAATAAACAAAATGAAAAATCTGTAAAT
AGAAGACATGAACCCATACCCAAAAATCAGCATACTCTTACTCGTCACCC
TCATCAATAAATCAAACCCAAACCCTCAGAGAATCCAAGAAACCCTCGAG
TCAATACAAACAATCAAGTCAGAGCTCACCCGAATGCAAGAATATTTTCT
CCGAAAACCCTCATGTCAAAATCTCAATCTACATCTATTACAGAAAATCA
ATCAACTCGCACAACTCGAAAACACCTTCCTACAAACAATGATATCCTCA
CCTCACCCAATTCCTGAAAATCCAAAACCAAATAAGTTCGAAATTACTAT
TCTCTGTTTGGGAATCGCCCAAATCGTTGTCCTCGTCATCGCAATAATCT
GTCAAATCATCCAAATCATGAAATCTTACCAAAAATCACAAAGTAACCGA
CAATGGAAAAGAAGAGATCAAAAGAATCGAACCACTCGTTTCATAAAGCC
CCCTAACACCCTCAATACCAAAATAGCTCTGCAATAATCAAGCAAATCCA
AATCATCAAACCTCAACCCAAATCAAGCAACCAGTACTACATCCCAGGTC
CAAGTCACAGACGCTTACTCCAATATGACTCGACTGATATCCCTATCGTG
TGTATATAAATAAAACTCAGTAACAATATTGTTTTTATGTATAAAATCCC
GTCACCTTAAGTGATGTCTGCTTACTTCTTGTAAATTGACATTTCATCTT
TCTATTTGAGTGTTAAACGTATAAAAGTAAAAATGTCTGTATGGCGAATG
TGCTAACTAGAAATTGCGCGGCGCAATTTAAATGGCTCCGGGAGTGGTTT
GCTGGGTTTAGAGCCAAAATTAAAACAAAATAAATGAAATTAAAACAAAA
GATAAAAATGAAAAATATGGAAATGGTCACTGCACATACGCATACACCGC
AAGAAGAAACCAAAAATAAGTTAAAACTTATTAATTAAAACAAATTAAAA
ATATAACAAAAATTAAATAAAACAAATAATTAATTAAAATTCGGAAAAAT
GCCTACAGATGCAAAAAGAAACATACGAAAAATAAAATAAACTGCCAAAA
CCTTGCAAAATAAGGTTTAGAAAAAACACAGGCAGAAGAGGCGACCAGAA
AACAAAATATTGGGGTTTAAAAATAATATTTTAAGAAAATAATAATAAAA
ATAAAATCCAACAATAAAATATTAATATATCAAAAAATAAAGAAAAATAT
ATAAAAAATTACAAAAATATTTTGAAATAAATAAAATAATTAAAAAGCCC
TAAAAATGGCGAAAAATCGCCCATTGGTCGCACACAGGCACAAAAATACT
ATATATACGGCAGTCATTTTCATAATTTCTAACCAAATTTGAACCAAATT
TGAACCAAATTTTAGACGGAATTTTAACAGACTTACAGACTTACAGAATT
TTTAGACATTCTTAGATAAACCGTGAATCACTTGTAGTCAAAATTTTTAT
GCCAATTTATGCCAATTTTTCAAATCTGGTTGCATGATTGTGGATTGTAA
GTACTGTTATTTTTTGTATAAATATATATTTCGAAGTCTTGTTACTTTGA
TTTTATTCTGGATGGTCGTGGAATCTTTTGGTGCCACTGACAAATCCCCC
TAAAATCTTATTTATAATAAGTATTTCAATAGATGGTCCATGGGACGGAT
CTCGGGCCGGCTAGTGGGTGAAAACCCTTAGTTGAGCTCGTGGGTCATGC
CTCGTGAACCCCTTGGCAGTTCGCAGTCGGTTCCGGCTTTATGCACGGGA
CCGCTACGCAGGGCGCCATTGTATACTCGAGGCGGCTGCTGAAAATGTGG
CCGGAGCGAGTCGTTTAAAATCACGGGAAGAGCGGAAGACTTTAGTTAGG
GGAAAGCTAAGGCGGATCATGCTTTGATCTAAAACATTTTTGAGTATTCC
GAACGAAAATGTGTAAATAGAACTGGGCAGCAAGGATAGAATATAAGACG
AAAATGACGAAAAATGTTTTGTTTATGCAAATAGCTATTAAATTAATAAT
AGTAGGACAATCTATTGAAAAGTAACAATTATAAAAATTACCTTGTCGAT
AAATGTTCCGCAGGAGAGCAGCACGATTGACCATTCCGATTATTGGAATT
GGAATAAAGAAACCAGCGAGCGAAGTGTCTTTTTAAAAAATCCACCCTCA
TCTTATAGTCAAGACATCCACCATGAACATAGATAGGTGACTCGGTAGAC
GATATATGAAATCCACATATCCAGTAGGGCGAGTAAACGCGAATCATAAT
GCAAAAATCCAGAATAGCTGTACTTTCCATAAAACGCGCAAATCCATAGA
ATTCTATTCACGGTCTGTTAAACCTTCACCACACGAAGAATTTCAATAGA
TGCACTGATCCGTGCAAAGTTTTTGTGGGCCTTGTGATTCGTTTTCAAAA
AATCGATAGATAGCCAACGTTAAAATAAGTTACTTGATCTAAATTTTTTT
TTGAGTCGCTTGGATTTAATCGTTTCCAGTATCGGGACCCATCGCAAAAA
AAATCGTAAGCGTTCATGTTATTAGTACATCATTTTATATAAGCTAACAT
CAAATATAAATCTTAACTTTGACGTCCGTAAATTAATATTCAATAGCAAT
TTTAACCTTGAAAATGATAAATCACCATTAACTTTAAACTGGAAAACTGC
GGATTTCTATTCCACGTCAATATTAATCGTGAAAATTGTAAATTATCAAT
AATATACATCTTGAAGACTATAAACCATTAGTAAGCAATAATAGTAATCT
TGGACCTACACTGTATTACTAATTAATAACATTAATCTGGAAAACTGTAA
ATTGTCATTAAATGTTAAAAATTATTAATAGTTAATAATAGTAATCTTGG
AACTACAATGTATTAGTAATTGATAGCATTAGTCTTGAAAAATATAAATT
GTCATTAAAGGTTAAATATCGTTCCCGAAGGCTATAAGTTATCATTAAAG
ACTAGCATCCATCTTGAAGACCCAAACCCTTACTAAAAATTAGGAACTTG
CTCCACGCGATGTACCCGAGCGAAAGCTACCGTTGGCCATTCGAAAAATT
CGTTTTCGGAGTCAGGCACGGATGTGAGCTTCATTTATTGATTGAAAACC
AACGCAACCTCGTAAAATCTAATCACTATCACTTAGCGTAGAAAACTTTC
AGGTTAATACAACTGCCGATAAGGATGAATTAACTATCGCTCAATAATTA
ACAGTTCAGCTTATAACTAATTAAACCACGGCATTTTAATTCGAAATATT
ATTTATACTATTAAACCCATAATTATGTCGTATTCTAAATTTGGTTATCT
AAATAATTTAATAGTGGCCTTAAGTGGAAAATTCTATTATATAAATAATT
AATAGTGATATCGTGTTTTTCTTAAGTTCAATTATATAAACAACGATAAC
TACGTTACCTGTTAAATCTTACCTTGGGAATAATTTAATAAATATATCGT
GTTTTAAAATTTATTACCCAAATAAATGGTCGGAATTCATTCCAAGCGTT
AGCATGCAAATAATTTAATAGTCCCAGCATACGCTAAAATATAGCATATG
ACTTCGCTTAATCCGCTATAGTAGGACGAGATTTACCGTCCCGGTCATAA
CTACAAGTCGTGAATCAGTTAAGGGGAAAAACGAACCCAAACTGCCGCCG
ATACTCCACTTCTCAGCATCACTCAAATTCTGTTTATAATAATATTTCCT
TTTACTTATTATTTCGGTTAAATTTTCTCTCTTTTTCTACCAGTATGACG
AATAATGATAACTCTACCAACTCAATGAGGATCCCTCGCCTGCCCCCTTC
AATCGTGGCAATCCGCCACAAGTACGAAGACCTCAAGATTCAGCACAGAG
ATCTCCAGGTGAAACACGAAAGGGTAAAAGGGACCTGGGCTCCACCAGAA
GTCGTCAGGGAGCTCAGGCAAAAAATCTCTCGACTTACCCAGGCGCGTGA
CGAACTAATCGTCGAGTCACGCGCCCAGCGTCTACTGATTCGCGAGCAGT
CGGTGGCGCTGCGACAAGCCTTCTCGGACACCGAACTCCGAATCCGGGTC
CCCGGGAATATTCGTGCAGAGCAACTCGATATCGTCCCGGCTCACCACCT
CCCCAATGTTGATGATCGACCTAACCTGATAACAAACGTTCCCACGTCGA
GCGTGAATCTCACGCACTTACCACCTTCCGGGACAGTGGAAACCCGGGCT
AACTCTTCTGCCCCTACGGCCCGTCATCGGCCAAATCGGAATAAGCGACG
TCGAGATCGTCGCAGACAAGAAGAGGCCCGTCTCCGGAGAACTCAGTCGA
GGGAAGGGGTGGACCAATTGGATGATCTACCACCCCCTTACCAAGAGTTC
GAAAACTCGGGGATGGACCCGGATATCCGTTATGCTCCGCGAATCTTATT
CTCCTCTCCCCCAGCTTCCATACATATTAACCTGGTGGATGAGGACAATG
AAGCTCACCCGTTGATGCAGGTATTAAGCGACCTCGAGTTGGACTTCGAT
GAGATCGCTGTCCTCACGGGAACGGTCCCCAACATTGGCCCCCGTGGCGA
AATAGCTGGACCATCTTCGCGGAGAGACGAGGACCCTCGAGGCCATCCTC
CATCGTACCGACCGCCTAAACGGAGATGCCTCCCGACGGATATGGACGCG
GAAGAAGACTAAACCGCCGGAAATCCCAAGTTTACTCGTACTACAAGTTG
CTCCTACACTAACCAATGCTCGCACTGTTCATTTTTCACTTTGTTTCATT
ATTTTTTTGTTGAATATTTGCTTTTGATTAAATGTTGTTTTGGTTGTTAA
TAAATGTTGTTGAATTCATGTTTCTCCTTATCAGTCGAAAGCGGGACCAT
CGGGGATGAGAATTATGGACGCACGGAATCGCGAGAACAATGTTTTTCCG
TGATTTACCCTCCAGAAGTGAACGTAATGCCGAGGAATAGAGGGTTTTTA
CTGGGTTTTGAAGGAGAGCGTAAGTCCTTCTATCGGCAGCTATAATCCGG
GGAAGACGAAGGTCCTTCGGGGAGTAGTGCTAGTAATGGCGCTCACCTGC
TCGAATGGCATTCGGCTATTGTGCACAGTTCCAACATGATTTCGGTCATG
GGTGCGCAATGGTTATTAAAATCGTGCGGCGTATCAGGAAAATATCCCTA
GTAGTTGAACGAGAAGGTTATACCAATAGAATGAGTGATATAGTACACTG
GAAAATTCCTATACGTCCAACAGTAACCTATTGTCGGAGAGGGGCGCAAG
ATCGGTGTTTGCCATAGGCGTCATTTACTCTAGGTATGCCACTAACAACA
AAGTAACTGACATTTTCAGTATAAAAGTATTACCGTACAATATACATTGT
TTATAAATGTTTTAAATCGTCCAATGTCGGTTTGAGAGGCTCAAATGTTG
ATACGACTCAAGAAAGTGACGGAACAGAGTAAAAGACTCGAGATTTAAAA
AGAGGACAAACACCTGGGAACACCTGGCGAGTGCATTTAATGCTGGTCAA
ATACTT
back to top

protein sequence of SMED30013205-orf-1

>SMED30013205-orf-1 ID=SMED30013205-orf-1|Name=SMED30013205-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
MVKLRASELTKKNKADLEKQLHQLKTELAELRVAKVTGAGGTKLGKIRVL
RKSIARVMTVMHTKQKDSLRQYYQHRKLKPQGIRTKATRAMRRQLTDNQK
NKKTVRQIRLDRAWPEIIYAIKQ*
back to top

protein sequence of SMED30013205-orf-2

>SMED30013205-orf-2 ID=SMED30013205-orf-2|Name=SMED30013205-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=160bp
MNPYPKISILLLVTLINKSNPNPQRIQETLESIQTIKSELTRMQEYFLRK
PSCQNLNLHLLQKINQLAQLENTFLQTMISSPHPIPENPKPNKFEITILC
LGIAQIVVLVIAIICQIIQIMKSYQKSQSNRQWKRRDQKNRTTRFIKPPN
TLNTKIALQ*
back to top

protein sequence of SMED30013205-orf-3

>SMED30013205-orf-3 ID=SMED30013205-orf-3|Name=SMED30013205-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=552bp
MNNKEITIEIINHLPVIKMMQIMGNEHQRAILIKNEEMGTMNKIKTETEK
CERMWQQLQNGHEGKLIMRQTNNVMNRVREIYEEGIEEFEKLIKRKIEQD
IREEKRKYASQQLEETQKAEMEKLQKQVEEQETRMKHGKVMLELLNKNIT
ELKEKANEVKLKYYREVINTTYQQRVMDKSIQEKKELQVRNEESKLEVMF
GKAMLELASLRSSRLEEEVEKLNKRLIKKVEELEKMRAKYLSQLARATFN
QCRIEGAGRKNKDLEAQIEQIGNVQVKIREELERTKKEQTAQVVEWTKVI
SASERKTNGVLKEAKIWKQKYQAAMKELKEFPEKRVPLDNLQMWEQLEEQ
KVETENSQARLRLQEKREENLRKFTTVKVNQLTKIQDQMRKLAEGKEQSD
LQVEIEKSRLECTEQEIDKYKKMCEQRDLAIHRQKALRGSEKEVFETKAR
ELQAEIERLEAREITSTLEREVEDLTEEVNQLLYMLDGEMNISQELRERI
NEIVNIPPIVWTSLIPIMSVPTNTMNMGEPTEQPQETIIDEGFVEVWGTW
V*
back to top

protein sequence of SMED30013205-orf-4

>SMED30013205-orf-4 ID=SMED30013205-orf-4|Name=SMED30013205-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=122bp
MEQNYQTSTNNETVIEMWKRQYNALTKVVNTLQEQWTESQIALREALNTN
MYHLLNIEEQQRRMNEMERELQILRTENQWQRNELQRVEEETEEEPQVEW
SEWILNQVEERVEPDSSSNVE*
back to top

protein sequence of SMED30013205-orf-5

>SMED30013205-orf-5 ID=SMED30013205-orf-5|Name=SMED30013205-orf-5|organism=Schmidtea mediterranea sexual|type=polypeptide|length=306bp
MTNNDNSTNSMRIPRLPPSIVAIRHKYEDLKIQHRDLQVKHERVKGTWAP
PEVVRELRQKISRLTQARDELIVESRAQRLLIREQSVALRQAFSDTELRI
RVPGNIRAEQLDIVPAHHLPNVDDRPNLITNVPTSSVNLTHLPPSGTVET
RANSSAPTARHRPNRNKRRRDRRRQEEARLRRTQSREGVDQLDDLPPPYQ
EFENSGMDPDIRYAPRILFSSPPASIHINLVDEDNEAHPLMQVLSDLELD
FDEIAVLTGTVPNIGPRGEIAGPSSRRDEDPRGHPPSYRPPKRRCLPTDM
DAEED*
back to top

protein sequence of SMED30013205-orf-6

>SMED30013205-orf-6 ID=SMED30013205-orf-6|Name=SMED30013205-orf-6|organism=Schmidtea mediterranea sexual|type=polypeptide|length=464bp
MEQQRTAIEVNEIIEIIRKQTQIQIEARLRCGACTKLLKEPRQTECGCRL
CTECIIELTLNGPKQCPDCKETEIASLGETQEDRAASREIMNMRIKCPNK
PCNWEGKIREASAHLNQCRYKRKPCEKCQQPISESEEKQHENVCEERRTR
CEYCNITETWKQIQQEHVNVKEEKICDRFRGKCPNKCGVEEEIELKEHWE
RCSRKRIECPMAKWGCKIKILREETIQHVQETAEEHLKIWMDTMKNMDQM
MMQIKIEIESHKILMTEIFNTRESFELARIGMSETEKNVENEMKRLREHY
QKLRSYTPTGENPPIAPYIWRIEEFTRKWQRARDGTEVSITSPPFYSWKN
GYKLRMRVYPNGDGAGKDTHVSVFFVLVKGEWDELQSWPFSNKMAFTIMS
AKDAHVERLKPDGAPCYNKPTADVGTAIGSPRIMRQNVMWEYLEGDTLFV
KWSVEREGTGRTE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0003735structural constituent of ribosome
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005840ribosome
GO:0005622intracellular
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR001854Ribosomal_L29
IPR018254Ribosomal_L29_CS
IPR002083MATH/TRAF_dom
IPR013083Znf_RING/FYVE/PHD
IPR008974TRAF-like
IPR012227TNF_rcpt-assoc_TRAF_met
IPR001293Znf_TRAF
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0042981regulation of apoptotic process
GO:0007165signal transduction
GO:0016567protein ubiquitination