PH and SEC7 domain-containing protein

Overview
NamePH and SEC7 domain-containing protein
Smed IDSMED30013200
Length (bp)3509
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PH and SEC7 domain-containing protein (SMED30013200) t-SNE clustered cells

Violin plots show distribution of expression levels for PH and SEC7 domain-containing protein (SMED30013200) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PH and SEC7 domain-containing protein (SMED30013200) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PH and SEC7 domain-containing protein (SMED30013200) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013200

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30013200h1SMcG0015551 dd_Smed_v4_9018_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30013200h1SMcG0015551 dd_Smed_v4_9018_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013200h1SMcG0015551 dd_Smed_v4_9018_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Human
Match: PSD (pleckstrin and Sec7 domain containing [Source:HGNC Symbol;Acc:HGNC:9507])

HSP 1 Score: 235.728 bits (600), Expect = 2.417e-65
Identity = 121/259 (46.72%), Postives = 164/259 (63.32%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKL-DYN-DINKQIHTNHLNL---FLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRT 1867
            AD  AA+RLAKRLY LDGF+ +DV++HL K NDFS+LV  E+  FF FT  TLD ALR FL +  L G+TQERERV+ HFS+RY QCNP   + E+  HTL CALMLLNTDLHG+NI ++M+C DF+ ++  LN+G  F RE L  L++SI  + ++W ID E +     +L D N  + K+I     +    FL++  E  +  Y  G L+RK   +   R+T  GKRGWK + G L+ + L+L K+E     +   T
Sbjct:  174 ADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRISGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKRGWKSFHGILKGMILYLQKEEYKPGKALSET 432          

HSP 2 Score: 67.3958 bits (163), Expect = 1.232e-10
Identity = 42/148 (28.38%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            I ++HA A++A+DYSK+ +VF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  A T L+ +EQ+  H+  +  +  +L    +    K  + K   +  ++  ++E E  RY TY+ LL  ++
Sbjct:  438 ISIHHALATRASDYSKRPHVFYLRTADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPA-AVSSQKKFSRPLLPSAATRLSQEEQVRTHEAKLKAMASELREHRAAQLGKKGRGKEAEEQRQKEAYLEFEKSRYSTYAALLRVKL 584          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Human
Match: PSD (pleckstrin and Sec7 domain containing [Source:HGNC Symbol;Acc:HGNC:9507])

HSP 1 Score: 237.654 bits (605), Expect = 7.915e-64
Identity = 119/259 (45.95%), Postives = 159/259 (61.39%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNE-----LIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRT 1867
            AD  AA+RLAKRLY LDGF+ +DV++HL K NDFS+LV  E+  FF FT  TLD ALR FL +  L G+TQERERV+ HFS+RY QCNP   + E+  HTL CALMLLNTDLHG+NI ++M+C DF+ ++  LN+G  F RE L  L++SI  + ++W ID E     L  L  P             +  + FL++  E  +  Y  G L+RK   +   R+T  GKRGWK + G L+ + L+L K+E     +   T
Sbjct:  553 ADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRISGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKRGWKSFHGILKGMILYLQKEEYKPGKALSET 811          

HSP 2 Score: 67.3958 bits (163), Expect = 1.656e-10
Identity = 42/148 (28.38%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            I ++HA A++A+DYSK+ +VF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  A T L+ +EQ+  H+  +  +  +L    +    K  + K   +  ++  ++E E  RY TY+ LL  ++
Sbjct:  817 ISIHHALATRASDYSKRPHVFYLRTADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPA-AVSSQKKFSRPLLPSAATRLSQEEQVRTHEAKLKAMASELREHRAAQLGKKGRGKEAEEQRQKEAYLEFEKSRYSTYAALLRVKL 963          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Human
Match: PSD (pleckstrin and Sec7 domain containing [Source:HGNC Symbol;Acc:HGNC:9507])

HSP 1 Score: 237.654 bits (605), Expect = 7.915e-64
Identity = 119/259 (45.95%), Postives = 159/259 (61.39%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNE-----LIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRT 1867
            AD  AA+RLAKRLY LDGF+ +DV++HL K NDFS+LV  E+  FF FT  TLD ALR FL +  L G+TQERERV+ HFS+RY QCNP   + E+  HTL CALMLLNTDLHG+NI ++M+C DF+ ++  LN+G  F RE L  L++SI  + ++W ID E     L  L  P             +  + FL++  E  +  Y  G L+RK   +   R+T  GKRGWK + G L+ + L+L K+E     +   T
Sbjct:  553 ADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRISGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKRGWKSFHGILKGMILYLQKEEYKPGKALSET 811          

HSP 2 Score: 67.3958 bits (163), Expect = 1.656e-10
Identity = 42/148 (28.38%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            I ++HA A++A+DYSK+ +VF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  A T L+ +EQ+  H+  +  +  +L    +    K  + K   +  ++  ++E E  RY TY+ LL  ++
Sbjct:  817 ISIHHALATRASDYSKRPHVFYLRTADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPA-AVSSQKKFSRPLLPSAATRLSQEEQVRTHEAKLKAMASELREHRAAQLGKKGRGKEAEEQRQKEAYLEFEKSRYSTYAALLRVKL 963          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Human
Match: PSD3 (pleckstrin and Sec7 domain containing 3 [Source:HGNC Symbol;Acc:HGNC:19093])

HSP 1 Score: 226.483 bits (576), Expect = 1.887e-63
Identity = 112/250 (44.80%), Postives = 155/250 (62.00%), Query Frame = 2
Query: 1118 AAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNH----------LNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AAKRLAKRLY LD FK SDV+KHL K N+FS+LV EE+  FFDFT  TLD +LR F   F L G+TQERERV+ HFS RY  CNP+    ++  H L CA+MLLNTDLHG+NI +KM+C++F+ ++  +N G  F ++ L  L+NSI  + + W +D+E     + K       ++ +  H           N FL++P +  +  Y SG+L RK   +   ++T  GKRGWK ++  L+   L+L KDE
Sbjct:   50 AAKRLAKRLYQLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQERERVLIHFSNRYFYCNPDTIASQDGVHCLTCAIMLLNTDLHGHNIGKKMTCQEFIANLQGVNEGVDFSKDLLKALYNSIKNEKLEWAVDDEE----KKKSPSESTEEKANGTHPKTISRIGSTTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDE 295          

HSP 2 Score: 79.7221 bits (195), Expect = 1.339e-14
Identity = 51/146 (34.93%), Postives = 82/146 (56.16%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS-LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLE 2602
            + ++HA ASKATDY KK NVF+L+ ++    LFQ   P E+  W++ +N VAA+ S P F   ++  S       + PA T+ L+ +EQL++H+  +  +  +L    S PP K  K K   +Y  +  ++E E  RY+ Y  +L+
Sbjct:  311 VSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINCVAAVFSAPPF--PAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTRYEMYVSILK 454          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Human
Match: PSD2 (pleckstrin and Sec7 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:19092])

HSP 1 Score: 229.95 bits (585), Expect = 2.024e-62
Identity = 115/245 (46.94%), Postives = 154/245 (62.86%), Query Frame = 2
Query: 1118 AAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNE-----LIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AA RLA+RLYHL+GF+  DV++ L K N+FS+LV  E+ +FFDF+  TLD ALR FL  F L G+TQERERV+ HFSRRY QCNP+    E+  HTL CALMLLNTDLHG+NI +KMSC+ F+ ++ +LN+G  F ++ L  L+NSI  + + W ID +     L  L   K            +  N FL+VP   ++  Y  G L RK   +   +RT  G+RGWK ++  L+   L+L KDE
Sbjct:  313 AAHRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLTLDGALRTFLKAFPLMGETQERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDLHGHNIGKKMSCQQFIANLDQLNDGQDFAKDLLKTLYNSIKNEKLEWAIDEDELRKSLSELVDDKFGTGTKKVTRILDGGNPFLDVPQALSATTYKHGVLTRKTHADMDGKRTPRGRRGWKKFYAVLKGTILYLQKDE 557          

HSP 2 Score: 69.707 bits (169), Expect = 2.759e-11
Identity = 45/148 (30.41%), Postives = 75/148 (50.68%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            I ++HA A++A+DYSKK NV +L+ ++   +LFQ     E+  W+  +N VAA+ S P F   +        R  +    T L  +EQL +H+  +  L  +L      P  +  K+K   +Y  +  ++  E  RY+TY  LL  ++
Sbjct:  573 IRVHHALATRASDYSKKSNVLKLKTADWRVFLFQAPSKEEMLSWILRINLVAAIFSAPAFPA-AVSSMKKFCRPLLPSCTTRLCQEEQLRSHENKLRQLTAELAEHRCHPVERGIKSKEAEEYRLKEHYLTFEKSRYETYIHLLAMKI 719          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Celegans
Match: efa-6 (Exchange factor for Arf-6 [Source:UniProtKB/Swiss-Prot;Acc:G5EET6])

HSP 1 Score: 154.451 bits (389), Expect = 1.161e-38
Identity = 82/242 (33.88%), Postives = 136/242 (56.20%), Query Frame = 2
Query: 1121 AKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTN---HLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            A ++A+ LY L     + V+  L+++N+FS L+  ++   F F+   +D ALR+FL++  L G++  RER++  FS RY++CNP +++  +  HTL CAL+LLN+DLHG N+ +KM+  DF+ ++A  + G  F RE L  LF SI +  I            Q     +  N  + +          EV  ++   EY SG+L+RK ++E+   +T  G+R W++ + RL+ L L+   DE
Sbjct:  202 AAQIARNLYELKNCTSTQVADRLNEQNEFSFLILVKYLELFQFSTTRIDAALREFLSRVELRGESSARERLLRVFSARYLECNPAIFDSLDEVHTLTCALLLLNSDLHGPNMGKKMTARDFITNIA--HTGCTFKREMLKTLFQSIKDNAIS----------LQNSAKNSTANGSVASTSRRQPQQIYEVDPDSVV-EYYSGFLMRKYVRETDGGKTPFGRRSWRMVYARLRGLVLYFDTDE 430          

HSP 2 Score: 60.077 bits (144), Expect = 8.092e-9
Identity = 26/60 (43.33%), Postives = 38/60 (63.33%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVF 2347
            + L+HA A  A DY KK  VFR+++++G E LFQ +  +E+  W + +NFVAA  S P  
Sbjct:  445 VSLHHALAEPAPDYKKKSFVFRVRIAHGGEILFQTSNQKELQEWCEKINFVAAAFSSPTL 504          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Celegans
Match: efa-6 (Exchange factor for Arf-6 [Source:UniProtKB/Swiss-Prot;Acc:G5EET6])

HSP 1 Score: 155.992 bits (393), Expect = 1.268e-38
Identity = 82/242 (33.88%), Postives = 136/242 (56.20%), Query Frame = 2
Query: 1121 AKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTN---HLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            A ++A+ LY L     + V+  L+++N+FS L+  ++   F F+   +D ALR+FL++  L G++  RER++  FS RY++CNP +++  +  HTL CAL+LLN+DLHG N+ +KM+  DF+ ++A  + G  F RE L  LF SI +  I            Q     +  N  + +          EV  ++   EY SG+L+RK ++E+   +T  G+R W++ + RL+ L L+   DE
Sbjct:  333 AAQIARNLYELKNCTSTQVADRLNEQNEFSFLILVKYLELFQFSTTRIDAALREFLSRVELRGESSARERLLRVFSARYLECNPAIFDSLDEVHTLTCALLLLNSDLHGPNMGKKMTARDFITNIA--HTGCTFKREMLKTLFQSIKDNAIS----------LQNSAKNSTANGSVASTSRRQPQQIYEVDPDSVV-EYYSGFLMRKYVRETDGGKTPFGRRSWRMVYARLRGLVLYFDTDE 561          

HSP 2 Score: 60.4622 bits (145), Expect = 7.353e-9
Identity = 26/60 (43.33%), Postives = 38/60 (63.33%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVF 2347
            + L+HA A  A DY KK  VFR+++++G E LFQ +  +E+  W + +NFVAA  S P  
Sbjct:  576 VSLHHALAEPAPDYKKKSFVFRVRIAHGGEILFQTSNQKELQEWCEKINFVAAAFSSPTL 635          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Celegans
Match: efa-6 (Exchange factor for Arf-6 [Source:UniProtKB/Swiss-Prot;Acc:G5EET6])

HSP 1 Score: 155.992 bits (393), Expect = 1.611e-38
Identity = 82/242 (33.88%), Postives = 136/242 (56.20%), Query Frame = 2
Query: 1121 AKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTN---HLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            A ++A+ LY L     + V+  L+++N+FS L+  ++   F F+   +D ALR+FL++  L G++  RER++  FS RY++CNP +++  +  HTL CAL+LLN+DLHG N+ +KM+  DF+ ++A  + G  F RE L  LF SI +  I            Q     +  N  + +          EV  ++   EY SG+L+RK ++E+   +T  G+R W++ + RL+ L L+   DE
Sbjct:  386 AAQIARNLYELKNCTSTQVADRLNEQNEFSFLILVKYLELFQFSTTRIDAALREFLSRVELRGESSARERLLRVFSARYLECNPAIFDSLDEVHTLTCALLLLNSDLHGPNMGKKMTARDFITNIA--HTGCTFKREMLKTLFQSIKDNAIS----------LQNSAKNSTANGSVASTSRRQPQQIYEVDPDSVV-EYYSGFLMRKYVRETDGGKTPFGRRSWRMVYARLRGLVLYFDTDE 614          

HSP 2 Score: 60.4622 bits (145), Expect = 7.574e-9
Identity = 26/60 (43.33%), Postives = 38/60 (63.33%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVF 2347
            + L+HA A  A DY KK  VFR+++++G E LFQ +  +E+  W + +NFVAA  S P  
Sbjct:  629 VSLHHALAEPAPDYKKKSFVFRVRIAHGGEILFQTSNQKELQEWCEKINFVAAAFSSPTL 688          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Celegans
Match: efa-6 (Exchange factor for Arf-6 [Source:UniProtKB/Swiss-Prot;Acc:G5EET6])

HSP 1 Score: 155.606 bits (392), Expect = 1.773e-38
Identity = 82/242 (33.88%), Postives = 136/242 (56.20%), Query Frame = 2
Query: 1121 AKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTN---HLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            A ++A+ LY L     + V+  L+++N+FS L+  ++   F F+   +D ALR+FL++  L G++  RER++  FS RY++CNP +++  +  HTL CAL+LLN+DLHG N+ +KM+  DF+ ++A  + G  F RE L  LF SI +  I            Q     +  N  + +          EV  ++   EY SG+L+RK ++E+   +T  G+R W++ + RL+ L L+   DE
Sbjct:  384 AAQIARNLYELKNCTSTQVADRLNEQNEFSFLILVKYLELFQFSTTRIDAALREFLSRVELRGESSARERLLRVFSARYLECNPAIFDSLDEVHTLTCALLLLNSDLHGPNMGKKMTARDFITNIA--HTGCTFKREMLKTLFQSIKDNAIS----------LQNSAKNSTANGSVASTSRRQPQQIYEVDPDSVV-EYYSGFLMRKYVRETDGGKTPFGRRSWRMVYARLRGLVLYFDTDE 612          

HSP 2 Score: 60.4622 bits (145), Expect = 7.439e-9
Identity = 26/60 (43.33%), Postives = 38/60 (63.33%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVF 2347
            + L+HA A  A DY KK  VFR+++++G E LFQ +  +E+  W + +NFVAA  S P  
Sbjct:  627 VSLHHALAEPAPDYKKKSFVFRVRIAHGGEILFQTSNQKELQEWCEKINFVAAAFSSPTL 686          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Celegans
Match: agef-1 (Arf-1 Guanine nucleotide Exchange Factor homolog [Source:UniProtKB/TrEMBL;Acc:G5EFH7])

HSP 1 Score: 73.559 bits (179), Expect = 9.087e-13
Identity = 40/138 (28.99%), Postives = 74/138 (53.62%), Query Frame = 2
Query: 1169 SDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNP--NVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIR 1576
            + V   L   ++F+  V   + +F DF++  +  ALR FL KF L G+ Q+ +R++  F+ RY+ CNP   ++   +A + L  ++++L TDLH   +  KM+ + ++     +N G +   E L  +F  I +  I+
Sbjct:  561 TQVGDFLGDSDEFNNSVMHAYIDFLDFSSIDILAALRMFLEKFRLPGEAQKIDRLMLKFASRYLDCNPRQGIFASADAAYVLAFSIIMLTTDLHNKTVKNKMTKQGYINMNRGINEGGNIPVELLEAIFEDISKNEIK 698          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Fly
Match: Efa6 (gene:FBgn0051158 transcript:FBtr0113395)

HSP 1 Score: 279.641 bits (714), Expect = 5.091e-77
Identity = 136/280 (48.57%), Postives = 188/280 (67.14%), Query Frame = 2
Query: 1061 SDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLR 1900
            SDV     YH  PKA D  +A RLAKRL+ LDGFK SDVS+HLSK NDFS+ V +E+   F F   +LD ALR+FL +F L G+TQERERV+ HFS+R++ CNP  +N ++A HTL CA+MLLNTDLHG NINRKMSC +FV ++A+LN+G++F ++ L  L+ +I  KP+ W +D E   L Q + +    N  +    LN FL+ P  AT+ EY  GY++RKC  +S +++T  GKR WK+++  L+DL L+L+KDE      F+++    N  N +R
Sbjct:  909 SDVESLHSYHYSPKAVDMPSAIRLAKRLHSLDGFKKSDVSRHLSKNNDFSRAVADEYLKHFTFEKKSLDQALREFLQQFSLSGETQERERVLVHFSKRFLDCNPGTFNSQDAVHTLTCAIMLLNTDLHGQNINRKMSCAEFVDNLADLNDGENFPKDVLKSLYQAIKTKPLEWALDEEAGDLQQQRAN----NSALGNVGLNPFLDPPELATAVEYKKGYVMRKCCYDSSFKKTPFGKRSWKMFYCTLRDLVLYLHKDE----HGFRKSQMSDNLHNAIR 1180          

HSP 2 Score: 93.2041 bits (230), Expect = 1.128e-18
Identity = 52/149 (34.90%), Postives = 87/149 (58.39%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMI 2614
            I ++HA A+KA DY+KK++VFRLQ ++ +EYLFQ ++ +E+  WV+ +N+V A +S P              R  +    + L +KEQL++H+  +  L+Q+LN    K P  S    L+  Y  +  +++ EL RY+TY  +L  +M+
Sbjct: 1179 IRIHHALATKANDYTKKQHVFRLQTADQAEYLFQTSDSKELQSWVETINYVCAAISAPPLE-GGVGSQKRFQRPLLPSKQSKLMLKEQLDSHEVQLAQLDQELNE-HKKGPIPSKGLALQ-NYKEKESYLQYELRRYRTYVSILSAKML 1324          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Fly
Match: Efa6 (gene:FBgn0051158 transcript:FBtr0113396)

HSP 1 Score: 280.026 bits (715), Expect = 5.566e-77
Identity = 136/280 (48.57%), Postives = 188/280 (67.14%), Query Frame = 2
Query: 1061 SDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLR 1900
            SDV     YH  PKA D  +A RLAKRL+ LDGFK SDVS+HLSK NDFS+ V +E+   F F   +LD ALR+FL +F L G+TQERERV+ HFS+R++ CNP  +N ++A HTL CA+MLLNTDLHG NINRKMSC +FV ++A+LN+G++F ++ L  L+ +I  KP+ W +D E   L Q + +    N  +    LN FL+ P  AT+ EY  GY++RKC  +S +++T  GKR WK+++  L+DL L+L+KDE      F+++    N  N +R
Sbjct: 1043 SDVESLHSYHYSPKAVDMPSAIRLAKRLHSLDGFKKSDVSRHLSKNNDFSRAVADEYLKHFTFEKKSLDQALREFLQQFSLSGETQERERVLVHFSKRFLDCNPGTFNSQDAVHTLTCAIMLLNTDLHGQNINRKMSCAEFVDNLADLNDGENFPKDVLKSLYQAIKTKPLEWALDEEAGDLQQQRAN----NSALGNVGLNPFLDPPELATAVEYKKGYVMRKCCYDSSFKKTPFGKRSWKMFYCTLRDLVLYLHKDE----HGFRKSQMSDNLHNAIR 1314          

HSP 2 Score: 93.2041 bits (230), Expect = 1.003e-18
Identity = 54/153 (35.29%), Postives = 87/153 (56.86%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS----LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMI 2614
            I ++HA A+KA DY+KK++VFRLQ ++ +EYLFQ ++ +E+  WV+ +N+V A +S P                   P L S    L +KEQL++H+  +  L+Q+LN    K P  S    L+  Y  +  +++ EL RY+TY  +L  +M+
Sbjct: 1313 IRIHHALATKANDYTKKQHVFRLQTADQAEYLFQTSDSKELQSWVETINYVCAAISAPPLEGGVGSQKRFQ-----RPLLPSKQSKLMLKEQLDSHEVQLAQLDQELNE-HKKGPIPSKGLALQ-NYKEKESYLQYELRRYRTYVSILSAKML 1458          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Fly
Match: Efa6 (gene:FBgn0051158 transcript:FBtr0334559)

HSP 1 Score: 280.026 bits (715), Expect = 7.468e-77
Identity = 136/280 (48.57%), Postives = 188/280 (67.14%), Query Frame = 2
Query: 1061 SDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLR 1900
            SDV     YH  PKA D  +A RLAKRL+ LDGFK SDVS+HLSK NDFS+ V +E+   F F   +LD ALR+FL +F L G+TQERERV+ HFS+R++ CNP  +N ++A HTL CA+MLLNTDLHG NINRKMSC +FV ++A+LN+G++F ++ L  L+ +I  KP+ W +D E   L Q + +    N  +    LN FL+ P  AT+ EY  GY++RKC  +S +++T  GKR WK+++  L+DL L+L+KDE      F+++    N  N +R
Sbjct: 1123 SDVESLHSYHYSPKAVDMPSAIRLAKRLHSLDGFKKSDVSRHLSKNNDFSRAVADEYLKHFTFEKKSLDQALREFLQQFSLSGETQERERVLVHFSKRFLDCNPGTFNSQDAVHTLTCAIMLLNTDLHGQNINRKMSCAEFVDNLADLNDGENFPKDVLKSLYQAIKTKPLEWALDEEAGDLQQQRAN----NSALGNVGLNPFLDPPELATAVEYKKGYVMRKCCYDSSFKKTPFGKRSWKMFYCTLRDLVLYLHKDE----HGFRKSQMSDNLHNAIR 1394          

HSP 2 Score: 93.2041 bits (230), Expect = 1.149e-18
Identity = 54/153 (35.29%), Postives = 87/153 (56.86%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS----LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMI 2614
            I ++HA A+KA DY+KK++VFRLQ ++ +EYLFQ ++ +E+  WV+ +N+V A +S P                   P L S    L +KEQL++H+  +  L+Q+LN    K P  S    L+  Y  +  +++ EL RY+TY  +L  +M+
Sbjct: 1393 IRIHHALATKANDYTKKQHVFRLQTADQAEYLFQTSDSKELQSWVETINYVCAAISAPPLEGGVGSQKRFQ-----RPLLPSKQSKLMLKEQLDSHEVQLAQLDQELNE-HKKGPIPSKGLALQ-NYKEKESYLQYELRRYRTYVSILSAKML 1538          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Fly
Match: Efa6 (gene:FBgn0051158 transcript:FBtr0302187)

HSP 1 Score: 278.87 bits (712), Expect = 9.949e-77
Identity = 136/280 (48.57%), Postives = 188/280 (67.14%), Query Frame = 2
Query: 1061 SDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLR 1900
            SDV     YH  PKA D  +A RLAKRL+ LDGFK SDVS+HLSK NDFS+ V +E+   F F   +LD ALR+FL +F L G+TQERERV+ HFS+R++ CNP  +N ++A HTL CA+MLLNTDLHG NINRKMSC +FV ++A+LN+G++F ++ L  L+ +I  KP+ W +D E   L Q + +    N  +    LN FL+ P  AT+ EY  GY++RKC  +S +++T  GKR WK+++  L+DL L+L+KDE      F+++    N  N +R
Sbjct:  909 SDVESLHSYHYSPKAVDMPSAIRLAKRLHSLDGFKKSDVSRHLSKNNDFSRAVADEYLKHFTFEKKSLDQALREFLQQFSLSGETQERERVLVHFSKRFLDCNPGTFNSQDAVHTLTCAIMLLNTDLHGQNINRKMSCAEFVDNLADLNDGENFPKDVLKSLYQAIKTKPLEWALDEEAGDLQQQRAN----NSALGNVGLNPFLDPPELATAVEYKKGYVMRKCCYDSSFKKTPFGKRSWKMFYCTLRDLVLYLHKDE----HGFRKSQMSDNLHNAIR 1180          

HSP 2 Score: 92.8189 bits (229), Expect = 1.287e-18
Identity = 54/153 (35.29%), Postives = 87/153 (56.86%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS----LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMI 2614
            I ++HA A+KA DY+KK++VFRLQ ++ +EYLFQ ++ +E+  WV+ +N+V A +S P                   P L S    L +KEQL++H+  +  L+Q+LN    K P  S    L+  Y  +  +++ EL RY+TY  +L  +M+
Sbjct: 1179 IRIHHALATKANDYTKKQHVFRLQTADQAEYLFQTSDSKELQSWVETINYVCAAISAPPLEGGVGSQKRFQ-----RPLLPSKQSKLMLKEQLDSHEVQLAQLDQELNE-HKKGPIPSKGLALQ-NYKEKESYLQYELRRYRTYVSILSAKML 1324          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Fly
Match: Efa6 (gene:FBgn0051158 transcript:FBtr0334560)

HSP 1 Score: 279.256 bits (713), Expect = 1.160e-76
Identity = 136/280 (48.57%), Postives = 188/280 (67.14%), Query Frame = 2
Query: 1061 SDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLR 1900
            SDV     YH  PKA D  +A RLAKRL+ LDGFK SDVS+HLSK NDFS+ V +E+   F F   +LD ALR+FL +F L G+TQERERV+ HFS+R++ CNP  +N ++A HTL CA+MLLNTDLHG NINRKMSC +FV ++A+LN+G++F ++ L  L+ +I  KP+ W +D E   L Q + +    N  +    LN FL+ P  AT+ EY  GY++RKC  +S +++T  GKR WK+++  L+DL L+L+KDE      F+++    N  N +R
Sbjct: 1043 SDVESLHSYHYSPKAVDMPSAIRLAKRLHSLDGFKKSDVSRHLSKNNDFSRAVADEYLKHFTFEKKSLDQALREFLQQFSLSGETQERERVLVHFSKRFLDCNPGTFNSQDAVHTLTCAIMLLNTDLHGQNINRKMSCAEFVDNLADLNDGENFPKDVLKSLYQAIKTKPLEWALDEEAGDLQQQRAN----NSALGNVGLNPFLDPPELATAVEYKKGYVMRKCCYDSSFKKTPFGKRSWKMFYCTLRDLVLYLHKDE----HGFRKSQMSDNLHNAIR 1314          

HSP 2 Score: 92.8189 bits (229), Expect = 1.303e-18
Identity = 54/153 (35.29%), Postives = 87/153 (56.86%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS----LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMI 2614
            I ++HA A+KA DY+KK++VFRLQ ++ +EYLFQ ++ +E+  WV+ +N+V A +S P                   P L S    L +KEQL++H+  +  L+Q+LN    K P  S    L+  Y  +  +++ EL RY+TY  +L  +M+
Sbjct: 1313 IRIHHALATKANDYTKKQHVFRLQTADQAEYLFQTSDSKELQSWVETINYVCAAISAPPLEGGVGSQKRFQ-----RPLLPSKQSKLMLKEQLDSHEVQLAQLDQELNE-HKKGPIPSKGLALQ-NYKEKESYLQYELRRYRTYVSILSAKML 1458          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Zebrafish
Match: psda (pleckstrin and Sec7 domain containing a [Source:ZFIN;Acc:ZDB-GENE-090313-44])

HSP 1 Score: 233.802 bits (595), Expect = 2.808e-66
Identity = 115/249 (46.18%), Postives = 167/249 (67.07%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLD-----YNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AAKRLAKRLY LDGFK SDV++HLSK N+FS +V EE+ + F+F+   +D ALR FL +F L G+TQERERV+ HFS+RY+QCNP     E++ HTL CALMLLNTDLHG+N+ ++MSC  F+ ++  LN+G  F ++ L  L+NSI  + ++W ID E +     ++D      +   K+I +   N  + V  +++++ Y +G+L+RK   +   ++T  GKRGWK ++  L+ L L+L KDE
Sbjct:   26 ADLQAAKRLAKRLYTLDGFKKSDVARHLSKNNEFSHMVAEEYLSHFNFSGMMVDQALRVFLKEFALMGETQERERVLSHFSKRYLQCNPKTIPYEDSVHTLTCALMLLNTDLHGHNVGKRMSCMQFIGNLQGLNDGQDFPKDLLKALYNSIKNEKLQWTIDEEELRKSFSEMDGRKDSASHTMKRISSGG-NSLISVAQQSSAQVYKNGFLVRKVHADPDGKKTPRGKRGWKTFYAILKGLILYLQKDE 273          

HSP 2 Score: 73.559 bits (179), Expect = 7.946e-13
Identity = 49/173 (28.32%), Postives = 87/173 (50.29%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPAL----TSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARLNQQAFMDPYL 2674
            + ++H+ A +A DYSK+ NVF L+ ++   +LFQ     ++  W+  +N VAA+ S P F          S      P L    T L+ +EQL++H+     +  +L  L S P  +  K++ + +Y ++ ++++ E  RY TY+ LL  + I +    +A    + F D  L
Sbjct:  289 VSIHHSLAMRAADYSKRPNVFYLRTADWRVFLFQAPNAEQMQSWITRINTVAAMFSAPPFPAAIGSQKKFS-----RPLLPGSNTKLSQEEQLKSHETRFRTVSAELQELRSTPQDRKTKSRDQEEYKQREEYLDFEKTRYGTYTMLLRTK-IRMGETDLAAFEGRLFEDSGL 455          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Zebrafish
Match: psda (pleckstrin and Sec7 domain containing a [Source:ZFIN;Acc:ZDB-GENE-090313-44])

HSP 1 Score: 233.802 bits (595), Expect = 5.156e-66
Identity = 115/249 (46.18%), Postives = 167/249 (67.07%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLD-----YNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AAKRLAKRLY LDGFK SDV++HLSK N+FS +V EE+ + F+F+   +D ALR FL +F L G+TQERERV+ HFS+RY+QCNP     E++ HTL CALMLLNTDLHG+N+ ++MSC  F+ ++  LN+G  F ++ L  L+NSI  + ++W ID E +     ++D      +   K+I +   N  + V  +++++ Y +G+L+RK   +   ++T  GKRGWK ++  L+ L L+L KDE
Sbjct:   49 ADLQAAKRLAKRLYTLDGFKKSDVARHLSKNNEFSHMVAEEYLSHFNFSGMMVDQALRVFLKEFALMGETQERERVLSHFSKRYLQCNPKTIPYEDSVHTLTCALMLLNTDLHGHNVGKRMSCMQFIGNLQGLNDGQDFPKDLLKALYNSIKNEKLQWTIDEEELRKSFSEMDGRKDSASHTMKRISSGG-NSLISVAQQSSAQVYKNGFLVRKVHADPDGKKTPRGKRGWKTFYAILKGLILYLQKDE 296          

HSP 2 Score: 73.559 bits (179), Expect = 7.123e-13
Identity = 49/173 (28.32%), Postives = 87/173 (50.29%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPAL----TSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARLNQQAFMDPYL 2674
            + ++H+ A +A DYSK+ NVF L+ ++   +LFQ     ++  W+  +N VAA+ S P F          S      P L    T L+ +EQL++H+     +  +L  L S P  +  K++ + +Y ++ ++++ E  RY TY+ LL  + I +    +A    + F D  L
Sbjct:  312 VSIHHSLAMRAADYSKRPNVFYLRTADWRVFLFQAPNAEQMQSWITRINTVAAMFSAPPFPAAIGSQKKFS-----RPLLPGSNTKLSQEEQLKSHETRFRTVSAELQELRSTPQDRKTKSRDQEEYKQREEYLDFEKTRYGTYTMLLRTK-IRMGETDLAAFEGRLFEDSGL 478          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Zebrafish
Match: BX890597.1 (pleckstrin and Sec7 domain containing a [Source:NCBI gene;Acc:570918])

HSP 1 Score: 232.261 bits (591), Expect = 9.865e-66
Identity = 115/249 (46.18%), Postives = 167/249 (67.07%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLD-----YNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AAKRLAKRLY LDGFK SDV++HLSK N+FS +V EE+ + F+F+   +D ALR FL +F L G+TQERERV+ HFS+RY+QCNP     E++ HTL CALMLLNTDLHG+N+ ++MSC  F+ ++  LN+G  F ++ L  L+NSI  + ++W ID E +     ++D      +   K+I +   N  + V  +++++ Y +G+L+RK   +   ++T  GKRGWK ++  L+ L L+L KDE
Sbjct:   18 ADLQAAKRLAKRLYTLDGFKKSDVARHLSKNNEFSHMVAEEYLSHFNFSGMMVDQALRVFLKEFALMGETQERERVLSHFSKRYLQCNPKTIPYEDSVHTLTCALMLLNTDLHGHNVGKRMSCMQFIGNLQGLNDGQDFPKDLLKALYNSIKNEKLQWTIDEEELRKSFSEMDGRKDSASHTMKRISSGG-NSLISVAQQSSAQVYKNGFLVRKVHADPDGKKTPRGKRGWKTFYAILKGLILYLQKDE 265          

HSP 2 Score: 72.4034 bits (176), Expect = 1.575e-12
Identity = 49/173 (28.32%), Postives = 87/173 (50.29%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPAL----TSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARLNQQAFMDPYL 2674
            + ++H+ A +A DYSK+ NVF L+ ++   +LFQ     ++  W+  +N VAA+ S P F          S      P L    T L+ +EQL++H+     +  +L  L S P  +  K++ + +Y ++ ++++ E  RY TY+ LL  + I +    +A    + F D  L
Sbjct:  281 VSIHHSLAMRAADYSKRPNVFYLRTADWRVFLFQAPNAEQMQSWITRINTVAAMFSAPPFPAAIGSQKKFS-----RPLLPGSNTKLSQEEQLKSHETRFRTVSAELQELRSTPQDRKTKSRDQEEYKQREEYLDFEKTRYGTYTMLLRTK-IRMGETDLAAFEGRLFEDSGL 447          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Zebrafish
Match: psda (pleckstrin and Sec7 domain containing a [Source:ZFIN;Acc:ZDB-GENE-090313-44])

HSP 1 Score: 233.032 bits (593), Expect = 1.172e-65
Identity = 115/249 (46.18%), Postives = 167/249 (67.07%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLD-----YNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AAKRLAKRLY LDGFK SDV++HLSK N+FS +V EE+ + F+F+   +D ALR FL +F L G+TQERERV+ HFS+RY+QCNP     E++ HTL CALMLLNTDLHG+N+ ++MSC  F+ ++  LN+G  F ++ L  L+NSI  + ++W ID E +     ++D      +   K+I +   N  + V  +++++ Y +G+L+RK   +   ++T  GKRGWK ++  L+ L L+L KDE
Sbjct:   59 ADLQAAKRLAKRLYTLDGFKKSDVARHLSKNNEFSHMVAEEYLSHFNFSGMMVDQALRVFLKEFALMGETQERERVLSHFSKRYLQCNPKTIPYEDSVHTLTCALMLLNTDLHGHNVGKRMSCMQFIGNLQGLNDGQDFPKDLLKALYNSIKNEKLQWTIDEEELRKSFSEMDGRKDSASHTMKRISSGG-NSLISVAQQSSAQVYKNGFLVRKVHADPDGKKTPRGKRGWKTFYAILKGLILYLQKDE 306          

HSP 2 Score: 73.1738 bits (178), Expect = 9.555e-13
Identity = 49/173 (28.32%), Postives = 87/173 (50.29%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPAL----TSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARLNQQAFMDPYL 2674
            + ++H+ A +A DYSK+ NVF L+ ++   +LFQ     ++  W+  +N VAA+ S P F          S      P L    T L+ +EQL++H+     +  +L  L S P  +  K++ + +Y ++ ++++ E  RY TY+ LL  + I +    +A    + F D  L
Sbjct:  322 VSIHHSLAMRAADYSKRPNVFYLRTADWRVFLFQAPNAEQMQSWITRINTVAAMFSAPPFPAAIGSQKKFS-----RPLLPGSNTKLSQEEQLKSHETRFRTVSAELQELRSTPQDRKTKSRDQEEYKQREEYLDFEKTRYGTYTMLLRTK-IRMGETDLAAFEGRLFEDSGL 488          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Zebrafish
Match: psd3l (pleckstrin and Sec7 domain containing 3, like [Source:ZFIN;Acc:ZDB-GENE-030131-8195])

HSP 1 Score: 239.58 bits (610), Expect = 6.425e-65
Identity = 120/276 (43.48%), Postives = 169/276 (61.23%), Query Frame = 2
Query: 1031 DKDEIEINAPSDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHL-------NLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            D D +E    +DV            +D+ AA+RLA+RLYHL+GF+ SDV+KHL K NDFS++V EE+  FF+FT  TLD +LR FL  F L G+TQERERV+ HFS RY QCNP +   ++  H L CALMLLNTDLHG NI +KM+C++F+ ++  LN G  F RE L  L+NSI  + + W +D +   L +   +  D N   H+  +       N FL++  +  +  Y +G+L RK   +   ++T  GKRGWK ++  L+ + L+L KDE
Sbjct:  481 DMDVVECLKDTDVLHNG------SRSDQEAARRLARRLYHLEGFRRSDVAKHLGKNNDFSKMVAEEYLTFFEFTDQTLDQSLRCFLKAFSLMGETQERERVLIHFSNRYYQCNPTIITAQDGVHCLTCALMLLNTDLHGPNIGKKMTCQEFINNLDGLNGGQDFPRELLKSLYNSIKNEKLEWAVDGD--ELKKSLSELADKNHHSHSKSISRISSGSNPFLDIAHDPNAAVYKTGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGMILYLQKDE 748          

HSP 2 Score: 78.1814 bits (191), Expect = 4.457e-14
Identity = 49/146 (33.56%), Postives = 82/146 (56.16%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS-LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLE 2602
            I ++HA A KA DY KK NV +L+ ++   +LFQ   P E++ W+  +N VAA+ S P F   ++  S       + PA T+ ++ +EQL++H+  + ++  +L    S PP K  K K   +Y  +  ++E E  RY+ Y +LL+
Sbjct:  764 ISVHHALAIKAMDYEKKPNVLKLKTADWRVFLFQAQSPEEMESWIRIINSVAAMFSAPSF--PAAIGSQKKFSRPLLPATTTRMSQEEQLKSHEAKLKHVSTELAEHRSYPPDKKVKAKEIDEYRLKEHYLEFEENRYEMYVKLLK 907          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Xenopus
Match: PSD3 (pleckstrin and Sec7 domain containing 3 [Source:NCBI gene;Acc:100127548])

HSP 1 Score: 229.565 bits (584), Expect = 4.592e-65
Identity = 116/250 (46.40%), Postives = 157/250 (62.80%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNL------FLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            ++K AAKRLAKRLYHLDGFK SDV+KHL K NDFS++V EE+  FFDFT  TLD +LR F   F L G+TQERERV+ HFS RY  CNPN  +  +  H L CA+MLLNTDLHG+NI +KMSC++F+ ++  +N G  F R  L  L+NSI  + + W  D+       P  + ++      +  +N       FLE+P +  +  Y +G+L RK   +   ++T  GKRGWK ++  L+   L+L KDE
Sbjct:   52 SNKQAAKRLAKRLYHLDGFKRSDVAKHLGKNNDFSKIVAEEYLKFFDFTGLTLDQSLRIFFKAFSLIGETQERERVLVHFSNRYFLCNPNSISSIDGVHCLTCAIMLLNTDLHGHNIGKKMSCQEFIANLQGVNEGRDFPRVLLKALYNSIKNEKLEWAADDVDAMKKSPSDNADEKPNGTQSKSVNRIGSSNPFLEIPHDPNAAVYKTGFLARKIHADMDGKKTPRGKRGWKTFYAILKGTVLYLQKDE 301          

HSP 2 Score: 72.0182 bits (175), Expect = 2.618e-12
Identity = 51/157 (32.48%), Postives = 78/157 (49.68%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS-LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTI 2635
            + ++HA A KATDY K+ NV +L+ ++   +LFQ     E++LW+  +N VAA+ S P F   ++  S       + PA T+ L   EQL +H+  +  +  +L    S PP               +K   KE+  YK     LEFE +HL+N  I
Sbjct:  317 VSIHHALALKATDYEKRPNVLKLKTADWRVFLFQAQSTEEMELWISKINCVAAVFSAPPF--PAAIGSQKKFSRPLLPATTTKLTKDEQLRSHETKLKQISTELAEHRSYPP--------------DKKVKAKEIDEYKLKDHYLEFE-VHLYNAMI 456          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Xenopus
Match: PSD3 (pleckstrin and Sec7 domain containing 3 [Source:NCBI gene;Acc:100127548])

HSP 1 Score: 229.95 bits (585), Expect = 4.971e-64
Identity = 120/250 (48.00%), Postives = 158/250 (63.20%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRW------NIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            ++K AAKRLAKRLYHLDGFK SDV+KHL K NDFS++V EE+  FFDFT  TLD +LR F   F L G+TQERERV+ HFS RY  CNPN  +  +  H L CA+MLLNTDLHG+NI +KMSC++F+ ++  +N G  F R  L  L+NSI  + + W      N D +  G  Q K     +N+       N FLE+P +  +  Y +G+L RK   +   ++T  GKRGWK ++  L+   L+L KDE
Sbjct:  116 SNKQAAKRLAKRLYHLDGFKRSDVAKHLGKNNDFSKIVAEEYLKFFDFTGLTLDQSLRIFFKAFSLIGETQERERVLVHFSNRYFLCNPNSISSIDGVHCLTCAIMLLNTDLHGHNIGKKMSCQEFIANLQGVNEGRDFPRVLLKALYNSIKNEKLEWAKSPSDNADEKPNGT-QSK----SVNR---IGSSNPFLEIPHDPNAAVYKTGFLARKIHADMDGKKTPRGKRGWKTFYAILKGTVLYLQKDE 357          

HSP 2 Score: 75.8702 bits (185), Expect = 2.050e-13
Identity = 48/146 (32.88%), Postives = 79/146 (54.11%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS-LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLE 2602
            + ++HA A KATDY K+ NV +L+ ++   +LFQ     E++LW+  +N VAA+ S P F   ++  S       + PA T+ L   EQL +H+  +  +  +L    S PP K  K K   +Y  +  ++E E  RY+ Y ++L+
Sbjct:  373 VSIHHALALKATDYEKRPNVLKLKTADWRVFLFQAQSTEEMELWISKINCVAAVFSAPPF--PAAIGSQKKFSRPLLPATTTKLTKDEQLRSHETKLKQISTELAEHRSYPPDKKVKAKEIDEYKLKDHYLEFEKTRYEVYVKILK 516          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Xenopus
Match: PSD3 (pleckstrin and Sec7 domain containing 3 [Source:NCBI gene;Acc:100127548])

HSP 1 Score: 223.787 bits (569), Expect = 7.593e-63
Identity = 118/248 (47.58%), Postives = 158/248 (63.71%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDR--EDLIMLFNSI--LEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            ++K AAKRLAKRLYHLDGFK SDV+KHL K NDFS++V EE+  FFDFT  TLD +LR F   F L G+TQERERV+ HFS RY  CNPN  +  +  H L CA+MLLNTDLHG+NI +KMSC++F+ ++  +N G  F R  +DL+ + + +  ++K    N D +  G  Q K   N I         N FLE+P +  +  Y +G+L RK   +   ++T  GKRGWK ++  L+   L+L KDE
Sbjct:   21 SNKQAAKRLAKRLYHLDGFKRSDVAKHLGKNNDFSKIVAEEYLKFFDFTGLTLDQSLRIFFKAFSLIGETQERERVLVHFSNRYFLCNPNSISSIDGVHCLTCAIMLLNTDLHGHNIGKKMSCQEFIANLQGVNEGRDFPRVLKDLLQIMDDVDAMKKSPSDNADEKPNGT-QSK-SVNRIGSS------NPFLEIPHDPNAAVYKTGFLARKIHADMDGKKTPRGKRGWKTFYAILKGTVLYLQKDE 260          

HSP 2 Score: 77.0258 bits (188), Expect = 8.519e-14
Identity = 48/146 (32.88%), Postives = 79/146 (54.11%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS-LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLE 2602
            + ++HA A KATDY K+ NV +L+ ++   +LFQ     E++LW+  +N VAA+ S P F   ++  S       + PA T+ L   EQL +H+  +  +  +L    S PP K  K K   +Y  +  ++E E  RY+ Y ++L+
Sbjct:  276 VSIHHALALKATDYEKRPNVLKLKTADWRVFLFQAQSTEEMELWISKINCVAAVFSAPPF--PAAIGSQKKFSRPLLPATTTKLTKDEQLRSHETKLKQISTELAEHRSYPPDKKVKAKEIDEYKLKDHYLEFEKTRYEVYVKILK 419          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Xenopus
Match: PSD3 (pleckstrin and Sec7 domain containing 3 [Source:NCBI gene;Acc:100127548])

HSP 1 Score: 221.861 bits (564), Expect = 5.904e-62
Identity = 118/248 (47.58%), Postives = 158/248 (63.71%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDR--EDLIMLFNSI--LEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            ++K AAKRLAKRLYHLDGFK SDV+KHL K NDFS++V EE+  FFDFT  TLD +LR F   F L G+TQERERV+ HFS RY  CNPN  +  +  H L CA+MLLNTDLHG+NI +KMSC++F+ ++  +N G  F R  +DL+ + + +  ++K    N D +  G  Q K   N I         N FLE+P +  +  Y +G+L RK   +   ++T  GKRGWK ++  L+   L+L KDE
Sbjct:   51 SNKQAAKRLAKRLYHLDGFKRSDVAKHLGKNNDFSKIVAEEYLKFFDFTGLTLDQSLRIFFKAFSLIGETQERERVLVHFSNRYFLCNPNSISSIDGVHCLTCAIMLLNTDLHGHNIGKKMSCQEFIANLQGVNEGRDFPRVLKDLLQIMDDVDAMKKSPSDNADEKPNGT-QSK-SVNRIGSS------NPFLEIPHDPNAAVYKTGFLARKIHADMDGKKTPRGKRGWKTFYAILKGTVLYLQKDE 290          

HSP 2 Score: 76.2554 bits (186), Expect = 1.576e-13
Identity = 48/146 (32.88%), Postives = 79/146 (54.11%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS-LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLE 2602
            + ++HA A KATDY K+ NV +L+ ++   +LFQ     E++LW+  +N VAA+ S P F   ++  S       + PA T+ L   EQL +H+  +  +  +L    S PP K  K K   +Y  +  ++E E  RY+ Y ++L+
Sbjct:  306 VSIHHALALKATDYEKRPNVLKLKTADWRVFLFQAQSTEEMELWISKINCVAAVFSAPPF--PAAIGSQKKFSRPLLPATTTKLTKDEQLRSHETKLKQISTELAEHRSYPPDKKVKAKEIDEYKLKDHYLEFEKTRYEVYVKILK 449          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Xenopus
Match: PSD3 (pleckstrin and Sec7 domain containing 3 [Source:NCBI gene;Acc:100127548])

HSP 1 Score: 223.016 bits (567), Expect = 3.067e-61
Identity = 117/248 (47.18%), Postives = 159/248 (64.11%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDR--EDLIMLFNSI--LEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            ++K AAKRLAKRLYHLDGFK SDV+KHL K NDFS++V EE+  FFDFT  TLD +LR F   F L G+TQERERV+ HFS RY  CNPN  +  +  H L CA+MLLNTDLHG+NI +KMSC++F+ ++  +N G  F R  +DL+ + + +  ++K    N D +  G  Q K     +N+       N FLE+P +  +  Y +G+L RK   +   ++T  GKRGWK ++  L+   L+L KDE
Sbjct:  170 SNKQAAKRLAKRLYHLDGFKRSDVAKHLGKNNDFSKIVAEEYLKFFDFTGLTLDQSLRIFFKAFSLIGETQERERVLVHFSNRYFLCNPNSISSIDGVHCLTCAIMLLNTDLHGHNIGKKMSCQEFIANLQGVNEGRDFPRVLKDLLQIMDDVDAMKKSPSDNADEKPNGT-QSK----SVNR---IGSSNPFLEIPHDPNAAVYKTGFLARKIHADMDGKKTPRGKRGWKTFYAILKGTVLYLQKDE 409          

HSP 2 Score: 76.6406 bits (187), Expect = 1.337e-13
Identity = 48/146 (32.88%), Postives = 79/146 (54.11%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS-LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLE 2602
            + ++HA A KATDY K+ NV +L+ ++   +LFQ     E++LW+  +N VAA+ S P F   ++  S       + PA T+ L   EQL +H+  +  +  +L    S PP K  K K   +Y  +  ++E E  RY+ Y ++L+
Sbjct:  425 VSIHHALALKATDYEKRPNVLKLKTADWRVFLFQAQSTEEMELWISKINCVAAVFSAPPF--PAAIGSQKKFSRPLLPATTTKLTKDEQLRSHETKLKQISTELAEHRSYPPDKKVKAKEIDEYKLKDHYLEFEKTRYEVYVKILK 568          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Mouse
Match: Psd3 (pleckstrin and Sec7 domain containing 3 [Source:MGI Symbol;Acc:MGI:1918215])

HSP 1 Score: 232.261 bits (591), Expect = 1.432e-65
Identity = 114/250 (45.60%), Postives = 158/250 (63.20%), Query Frame = 2
Query: 1118 AAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNH----------LNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AAKRLAKRLYHLD FK SDV+KHL K N+FS+LV EE+  FFDFT  TLD +LR FL  F L G+TQERERV+ HFS RY  CNP+    ++  H L CA+MLLNTDLHG+NI +KM+C++F+ ++  +N G  F ++ L  L+NSI  + + W +D+E     + K      +++ +  H           N FL++P +  +  Y SG+L RK   +   ++T  GKRGWK ++  L+   L+L KDE
Sbjct:   55 AAKRLAKRLYHLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFLKAFSLVGETQERERVLIHFSNRYFSCNPDTITSKDGVHCLTCAMMLLNTDLHGHNIGKKMTCQEFITNLQGVNEGGDFSKDLLKALYNSIKNEKLEWAVDDEE----KKKSPSEGTDEKANGTHPKTISRIGSTTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDE 300          

HSP 2 Score: 79.7221 bits (195), Expect = 9.943e-15
Identity = 51/146 (34.93%), Postives = 82/146 (56.16%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS-LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLE 2602
            + ++HA ASKATDY KK NVF+L+ ++    LFQ   P E+  W++ +N VAA+ S P F   ++  S       + PA T+ L+ +EQL++H+  +  +  +L    S PP K  K K   +Y  +  ++E E  RY+ Y  +L+
Sbjct:  316 VSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINCVAAVFSAPPF--PAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTRYEIYVSVLK 459          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Mouse
Match: Psd (pleckstrin and Sec7 domain containing [Source:MGI Symbol;Acc:MGI:1920978])

HSP 1 Score: 238.039 bits (606), Expect = 4.531e-64
Identity = 118/249 (47.39%), Postives = 157/249 (63.05%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNE-----LIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AA+RLAKRLY LDGF+ +DV++HL K NDFS+LV  E+  FF FT  TLD ALR FL +  L G+TQERERV+ HFS+RY QCNP   + E+  HTL CALMLLNTDLHG+NI ++M+C DF+ ++  LN+G  F RE L  L++SI  + ++W ID E     L  L  P             +  + FL++  E  +  Y  G L+RK   +   R+T  GKRGWK + G L+ + L+L K+E
Sbjct:  553 ADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRVSGGSGSSSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKRGWKSFHGILKGMILYLQKEE 801          

HSP 2 Score: 67.781 bits (164), Expect = 7.628e-11
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            I ++HA A++A+DYSK+ +VF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  A T L+ +EQ+  H+  +  +  +L    +    K  + K   +  ++  ++E E  RY TY+ LL  +M
Sbjct:  817 ISIHHALATRASDYSKRPHVFYLRTADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPA-AVSSQKKFSRPLLPSAATRLSQEEQVRTHEAKLKAMASELREHRAAHLGKKARGKEADEQRQKEAYLEFEKSRYGTYAALLRVKM 963          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Mouse
Match: Psd (pleckstrin and Sec7 domain containing [Source:MGI Symbol;Acc:MGI:1920978])

HSP 1 Score: 237.269 bits (604), Expect = 6.811e-64
Identity = 118/249 (47.39%), Postives = 157/249 (63.05%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNE-----LIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AA+RLAKRLY LDGF+ +DV++HL K NDFS+LV  E+  FF FT  TLD ALR FL +  L G+TQERERV+ HFS+RY QCNP   + E+  HTL CALMLLNTDLHG+NI ++M+C DF+ ++  LN+G  F RE L  L++SI  + ++W ID E     L  L  P             +  + FL++  E  +  Y  G L+RK   +   R+T  GKRGWK + G L+ + L+L K+E
Sbjct:  554 ADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRVSGGSGSSSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKRGWKSFHGILKGMILYLQKEE 802          

HSP 2 Score: 67.781 bits (164), Expect = 9.197e-11
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            I ++HA A++A+DYSK+ +VF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  A T L+ +EQ+  H+  +  +  +L    +    K  + K   +  ++  ++E E  RY TY+ LL  +M
Sbjct:  818 ISIHHALATRASDYSKRPHVFYLRTADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPA-AVSSQKKFSRPLLPSAATRLSQEEQVRTHEAKLKAMASELREHRAAHLGKKARGKEADEQRQKEAYLEFEKSRYGTYAALLRVKM 964          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Mouse
Match: Psd (pleckstrin and Sec7 domain containing [Source:MGI Symbol;Acc:MGI:1920978])

HSP 1 Score: 237.269 bits (604), Expect = 6.811e-64
Identity = 118/249 (47.39%), Postives = 157/249 (63.05%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNE-----LIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AA+RLAKRLY LDGF+ +DV++HL K NDFS+LV  E+  FF FT  TLD ALR FL +  L G+TQERERV+ HFS+RY QCNP   + E+  HTL CALMLLNTDLHG+NI ++M+C DF+ ++  LN+G  F RE L  L++SI  + ++W ID E     L  L  P             +  + FL++  E  +  Y  G L+RK   +   R+T  GKRGWK + G L+ + L+L K+E
Sbjct:  554 ADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRVSGGSGSSSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKRGWKSFHGILKGMILYLQKEE 802          

HSP 2 Score: 67.781 bits (164), Expect = 9.197e-11
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            I ++HA A++A+DYSK+ +VF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  A T L+ +EQ+  H+  +  +  +L    +    K  + K   +  ++  ++E E  RY TY+ LL  +M
Sbjct:  818 ISIHHALATRASDYSKRPHVFYLRTADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPA-AVSSQKKFSRPLLPSAATRLSQEEQVRTHEAKLKAMASELREHRAAHLGKKARGKEADEQRQKEAYLEFEKSRYGTYAALLRVKM 964          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Mouse
Match: Psd3 (pleckstrin and Sec7 domain containing 3 [Source:MGI Symbol;Acc:MGI:1918215])

HSP 1 Score: 236.113 bits (601), Expect = 2.104e-63
Identity = 114/250 (45.60%), Postives = 158/250 (63.20%), Query Frame = 2
Query: 1118 AAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNH----------LNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AAKRLAKRLYHLD FK SDV+KHL K N+FS+LV EE+  FFDFT  TLD +LR FL  F L G+TQERERV+ HFS RY  CNP+    ++  H L CA+MLLNTDLHG+NI +KM+C++F+ ++  +N G  F ++ L  L+NSI  + + W +D+E     + K      +++ +  H           N FL++P +  +  Y SG+L RK   +   ++T  GKRGWK ++  L+   L+L KDE
Sbjct:  572 AAKRLAKRLYHLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFLKAFSLVGETQERERVLIHFSNRYFSCNPDTITSKDGVHCLTCAMMLLNTDLHGHNIGKKMTCQEFITNLQGVNEGGDFSKDLLKALYNSIKNEKLEWAVDDEE----KKKSPSEGTDEKANGTHPKTISRIGSTTNPFLDIPHDPNAAVYKSGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGTVLYLQKDE 817          

HSP 2 Score: 81.6481 bits (200), Expect = 4.699e-15
Identity = 51/146 (34.93%), Postives = 82/146 (56.16%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS-LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLE 2602
            + ++HA ASKATDY KK NVF+L+ ++    LFQ   P E+  W++ +N VAA+ S P F   ++  S       + PA T+ L+ +EQL++H+  +  +  +L    S PP K  K K   +Y  +  ++E E  RY+ Y  +L+
Sbjct:  833 VSVHHALASKATDYEKKPNVFKLKTADWRVLLFQTQSPEEMQGWINKINCVAAVFSAPPF--PAAIGSQKKFSRPLLPATTTKLSQEEQLKSHESKLKQITTELAEHRSYPPDKKVKAKDVDEYKLKDHYLEFEKTRYEIYVSVLK 976          
BLAST of PH and SEC7 domain-containing protein vs. UniProt/SwissProt
Match: sp|E1JIT7|PSD_DROME (PH and SEC7 domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Efa6 PE=1 SV=2)

HSP 1 Score: 280.026 bits (715), Expect = 7.486e-76
Identity = 136/280 (48.57%), Postives = 188/280 (67.14%), Query Frame = 2
Query: 1061 SDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLR 1900
            SDV     YH  PKA D  +A RLAKRL+ LDGFK SDVS+HLSK NDFS+ V +E+   F F   +LD ALR+FL +F L G+TQERERV+ HFS+R++ CNP  +N ++A HTL CA+MLLNTDLHG NINRKMSC +FV ++A+LN+G++F ++ L  L+ +I  KP+ W +D E   L Q + +    N  +    LN FL+ P  AT+ EY  GY++RKC  +S +++T  GKR WK+++  L+DL L+L+KDE      F+++    N  N +R
Sbjct: 1123 SDVESLHSYHYSPKAVDMPSAIRLAKRLHSLDGFKKSDVSRHLSKNNDFSRAVADEYLKHFTFEKKSLDQALREFLQQFSLSGETQERERVLVHFSKRFLDCNPGTFNSQDAVHTLTCAIMLLNTDLHGQNINRKMSCAEFVDNLADLNDGENFPKDVLKSLYQAIKTKPLEWALDEEAGDLQQQRAN----NSALGNVGLNPFLDPPELATAVEYKKGYVMRKCCYDSSFKKTPFGKRSWKMFYCTLRDLVLYLHKDE----HGFRKSQMSDNLHNAIR 1394          

HSP 2 Score: 93.2041 bits (230), Expect = 1.152e-17
Identity = 54/153 (35.29%), Postives = 87/153 (56.86%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS----LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMI 2614
            I ++HA A+KA DY+KK++VFRLQ ++ +EYLFQ ++ +E+  WV+ +N+V A +S P                   P L S    L +KEQL++H+  +  L+Q+LN    K P  S    L+  Y  +  +++ EL RY+TY  +L  +M+
Sbjct: 1393 IRIHHALATKANDYTKKQHVFRLQTADQAEYLFQTSDSKELQSWVETINYVCAAISAPPLEGGVGSQKRFQ-----RPLLPSKQSKLMLKEQLDSHEVQLAQLDQELNE-HKKGPIPSKGLALQ-NYKEKESYLQYELRRYRTYVSILSAKML 1538          
BLAST of PH and SEC7 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ESQ7|PSD1_RAT (PH and SEC7 domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Psd PE=1 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 1.057e-64
Identity = 118/249 (47.39%), Postives = 157/249 (63.05%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNE-----LIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AA+RLAKRLY LDGF+ +DV++HL K NDFS+LV  E+  FF FT  TLD ALR FL +  L G+TQERERV+ HFS+RY QCNP   + E+  HTL CALMLLNTDLHG+NI ++M+C DF+ ++  LN+G  F RE L  L++SI  + ++W ID E     L  L  P             +  + FL++  E  +  Y  G L+RK   +   R+T  GKRGWK + G L+ + L+L K+E
Sbjct:  178 ADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRVSGGSGSSSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKRGWKSFHGILKGMILYLQKEE 426          

HSP 2 Score: 67.781 bits (164), Expect = 4.257e-10
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            I ++HA A++A+DYSK+ +VF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  A T L+ +EQ+  H+  +  +  +L    +    K  + K   +  ++  ++E E  RY TY+ LL  +M
Sbjct:  442 ISIHHALATRASDYSKRPHVFYLRTADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPA-AVSSQKKFSRPLLPSAATRLSQEEQVRTHEAKLKAMASELREHRAAHLGKKARGKEAEEQRQKETYLEFEKSRYGTYAALLRVKM 588          
BLAST of PH and SEC7 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5DTT2|PSD1_MOUSE (PH and SEC7 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Psd PE=1 SV=2)

HSP 1 Score: 238.039 bits (606), Expect = 3.169e-63
Identity = 118/249 (47.39%), Postives = 157/249 (63.05%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNE-----LIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AA+RLAKRLY LDGF+ +DV++HL K NDFS+LV  E+  FF FT  TLD ALR FL +  L G+TQERERV+ HFS+RY QCNP   + E+  HTL CALMLLNTDLHG+NI ++M+C DF+ ++  LN+G  F RE L  L++SI  + ++W ID E     L  L  P             +  + FL++  E  +  Y  G L+RK   +   R+T  GKRGWK + G L+ + L+L K+E
Sbjct:  553 ADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRVSGGSGSSSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKRGWKSFHGILKGMILYLQKEE 801          

HSP 2 Score: 67.781 bits (164), Expect = 5.336e-10
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            I ++HA A++A+DYSK+ +VF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  A T L+ +EQ+  H+  +  +  +L    +    K  + K   +  ++  ++E E  RY TY+ LL  +M
Sbjct:  817 ISIHHALATRASDYSKRPHVFYLRTADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPA-AVSSQKKFSRPLLPSAATRLSQEEQVRTHEAKLKAMASELREHRAAHLGKKARGKEADEQRQKEAYLEFEKSRYGTYAALLRVKM 963          
BLAST of PH and SEC7 domain-containing protein vs. UniProt/SwissProt
Match: sp|A5PKW4|PSD1_HUMAN (PH and SEC7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PSD PE=1 SV=2)

HSP 1 Score: 237.654 bits (605), Expect = 3.801e-63
Identity = 119/259 (45.95%), Postives = 159/259 (61.39%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNE-----LIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRT 1867
            AD  AA+RLAKRLY LDGF+ +DV++HL K NDFS+LV  E+  FF FT  TLD ALR FL +  L G+TQERERV+ HFS+RY QCNP   + E+  HTL CALMLLNTDLHG+NI ++M+C DF+ ++  LN+G  F RE L  L++SI  + ++W ID E     L  L  P             +  + FL++  E  +  Y  G L+RK   +   R+T  GKRGWK + G L+ + L+L K+E     +   T
Sbjct:  553 ADLEAAQRLAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMTLDQALRVFLKELALMGETQERERVLAHFSQRYFQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALYSSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRISGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHADPDCRKTPRGKRGWKSFHGILKGMILYLQKEEYKPGKALSET 811          

HSP 2 Score: 67.3958 bits (163), Expect = 7.951e-10
Identity = 42/148 (28.38%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            I ++HA A++A+DYSK+ +VF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  A T L+ +EQ+  H+  +  +  +L    +    K  + K   +  ++  ++E E  RY TY+ LL  ++
Sbjct:  817 ISIHHALATRASDYSKRPHVFYLRTADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPA-AVSSQKKFSRPLLPSAATRLSQEEQVRTHEAKLKAMASELREHRAAQLGKKGRGKEAEEQRQKEAYLEFEKSRYSTYAALLRVKL 963          
BLAST of PH and SEC7 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P1I6|PSD2_MOUSE (PH and SEC7 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Psd2 PE=1 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 6.407e-62
Identity = 118/266 (44.36%), Postives = 162/266 (60.90%), Query Frame = 2
Query: 1118 AAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNE-----LIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVN-----GSFKRTVKKRNA 1885
            AA+RLA+RLYHL+GF+  DV++ L K N+FS+LV  E+ +FFDF+  TLD ALR FL  F L G+TQERERV+ HFSRRY QCNP+    E+  HTL CALMLLNTDLHG+NI +KMSC+ F+ ++ +LN+G  F ++ L  L+NSI  + + W ID +     L  L   K            +  N FL+VP    +  Y  G L RK   +   +RT  G+RGWK ++  L+   L+L KDE  ++     G  K  ++  +A
Sbjct:  310 AARRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLTLDRALRTFLKAFPLMGETQERERVLTHFSRRYCQCNPDDSTSEDGIHTLTCALMLLNTDLHGHNIGKKMSCQQFIANLDQLNDGQDFAKDLLKTLYNSIKNEKLEWAIDEDELRKSLSELVDDKFGTGTKKVTRILDGGNPFLDVPQALNATTYKHGVLTRKTHADMDGKRTPRGRRGWKKFYAVLKGTILYLQKDEYRLDKALSEGDLKNAIRVHHA 575          

HSP 2 Score: 67.781 bits (164), Expect = 5.408e-10
Identity = 44/148 (29.73%), Postives = 75/148 (50.68%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            I ++HA A++A+DYSKK NV +L+ ++   +LFQ     E+  W+  +N VAA+ S P F   +        R  +    T L  +EQL +H+  +  +  +L      P  +  K+K   +Y  +  ++  E  RY+TY  LL  ++
Sbjct:  570 IRVHHALATRASDYSKKSNVLKLKTADWRVFLFQAPSKEEMLSWILRINLVAAIFSAPAFPA-AVSSMKKFCRPLLPSCTTRLCQEEQLRSHENKLRQVTAELAEHRCHPLERGLKSKEAEEYRLKEHYLTFEKSRYETYIHLLAVKI 716          
BLAST of PH and SEC7 domain-containing protein vs. TrEMBL
Match: A0A2T7Q1C3 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_02099 PE=4 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 4.439e-80
Identity = 138/284 (48.59%), Postives = 196/284 (69.01%), Query Frame = 2
Query: 1028 GDKDEIEINAPSD-VFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYND-----INKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISV-NGSF 1858
            GD D ++++  SD    E++YHQP K  D+ +A RLAKRL++L+GF+ SDVS+HL K+NDFS LV EE+  +FDF  ++LD +LRKFL KF L G+TQERERV+ HFSR +++CNP  +N E+ACHTL CA+MLLNTDLHG N+ RKM+C DF+ +++ELN+GD+F +E L  ++ SI   PI W ++ E +   +P++D        ++   H  + N FL++P    + EY  GY++RKC  E   R+T +GKRGWK+ +  L+DL L+ YKDE  V  G F
Sbjct:  413 GDVDIMQLSMRSDDSDAESLYHQPTKGVDQPSAARLAKRLFNLEGFRKSDVSRHLCKKNDFSNLVAEEYLKYFDFRGDSLDISLRKFLNKFCLTGETQERERVLAHFSRHFMECNPGAFNSEDACHTLTCAIMLLNTDLHGQNLGRKMTCADFIENLSELNDGDNFPKEVLKSIYQSIKTDPIEWAVE-ESLPEGEPQVDELGTGPLPVSMPSHALNANPFLDLPDPGKTVEYREGYVMRKCCMEPDRRKTPLGKRGWKMVYAVLRDLILYQYKDEHQVRKGQF 695          

HSP 2 Score: 100.908 bits (250), Expect = 1.051e-17
Identity = 54/149 (36.24%), Postives = 87/149 (58.39%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMI 2614
            + ++HA A+KATDY+KK++VFRLQ ++ +E+LFQ    RE+  W+D +N VAA LS P              R  +  + T L+I EQL+ H++ V  +EQ++    +  P K  K+     Y  +  ++E EL R+KTY  LL+ +++
Sbjct:  703 VRIHHALATKATDYTKKQHVFRLQTADWAEFLFQTGSSRELQEWIDTINLVAATLSAPPLPAG-VGSQARFQRPLMPSSCTKLSIHEQLKCHEQRVAQMEQEMQLHRAAAPEKGSKSSAISNYIEKEHYLEFELKRFKTYIYLLQAKIM 850          
BLAST of PH and SEC7 domain-containing protein vs. TrEMBL
Match: A0A0L8FH99 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22020622mg PE=4 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 6.063e-80
Identity = 143/301 (47.51%), Postives = 197/301 (65.45%), Query Frame = 2
Query: 1016 GSDHGDKDEIEINAPSDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHL------NLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLR 1900
            G++H D D              +YHQP K+ D+ +A RLAKRLY+LDGF+ SDVS+HL K+NDFS LV EE+  FFDFT NTLD ALR FL +F L G+TQERERV+ HFS+RY+  NP+ YN E+ACHTL CA+MLLNTDLHG N+ RKM+C +F+ ++ ELN+GD+F +EDL  ++ +I  +PI W  D++L      +    +  +Q+  +        N FLE+P    + EY  GY++RKC  +   RRTS GKRGWK+++  L+D+ L+L+KDE      FK+     N+ N +R
Sbjct:  534 GNEHSDSD-------------CLYHQPFKSVDRPSAARLAKRLYNLDGFRKSDVSRHLCKKNDFSNLVAEEYLQFFDFTGNTLDVALRTFLKQFSLIGETQERERVLAHFSKRYMTTNPDTYNSEDACHTLTCAIMLLNTDLHGQNVGRKMNCNEFIENLCELNDGDNFPKEDLRQIYAAIKMEPIEWAPDDDLQ---DNETTVTNDRRQVPLSETPSRLGHNPFLEIPDPNQTTEYKKGYVMRKCCLDPDGRRTSFGKRGWKMFYASLRDMILYLHKDE----HGFKKGNLIENSSNAIR 814          

HSP 2 Score: 99.3673 bits (246), Expect = 3.315e-17
Identity = 53/148 (35.81%), Postives = 90/148 (60.81%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            I ++H+ A++A+DY+KK++VFRL  S+ +EYLFQ ++ +E+  W++ +N+VAA LS P              R  +  + T  N+ EQL +HQ  V +LE++L+     PP K  K ++   Y  + +F+E EL R++TY  LL+ ++
Sbjct:  813 IRIHHSIATRASDYTKKQHVFRLHTSDWAEYLFQTSDSKELQEWMETINYVAASLSAPPLP-GGIGSKKKFQRPLMPSSYTKKNLSEQLAHHQEKVTHLEKELHEHRLCPPEKGAKARIIHDYVEKEQFLESELKRFQTYKYLLQSKL 959          
BLAST of PH and SEC7 domain-containing protein vs. TrEMBL
Match: A0A1S3INW2 (PH and SEC7 domain-containing protein 2 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106165942 PE=4 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 1.846e-79
Identity = 130/252 (51.59%), Postives = 183/252 (72.62%), Query Frame = 2
Query: 1082 IYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            +Y QP K AD  +A RLAKRLY L+GFK +DV+KHL K+NDFSQLV EE+  FFDF    LD ALR+FL +F L G+TQERERV+ HF+RRY++CNP+ +N E+ACHTL CA+MLLNTDLHG NI R+M+C +F+ ++AELN+G++F R+ L  L+ SI  +P+ W +D E     +  L   + +++++  H N FL+VP  + + EY  GY++RKC  E   ++T +GKRGWK+Y+  L+D+ L+ +KDE
Sbjct:  475 VYFQPTKNADYPSAYRLAKRLYDLEGFKKADVAKHLGKKNDFSQLVAEEYLKFFDFVGIPLDVALRQFLQQFSLTGETQERERVLAHFTRRYMECNPDSFNSEDACHTLTCAIMLLNTDLHGQNIGRRMTCGEFIDNLAELNDGENFPRDVLKTLYLSIKSRPLEWALDEEGEATSETDLLLEE-SRRVNLGH-NPFLDVPDPSQATEYKRGYVMRKCCTEPDGKKTPLGKRGWKMYYATLRDMVLYFHKDE 724          

HSP 2 Score: 97.4413 bits (241), Expect = 1.282e-16
Identity = 49/148 (33.11%), Postives = 87/148 (58.78%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            + ++H+ A+KA DY+KK++V RL+ +  + YL Q ++P E+  W+D +NFVAA LS P              R  +  + T LN+ +QL++H+  V+ L++ L      PP K  K ++  +Y  + +++  EL R++TY+ LL+ +M
Sbjct:  740 VRIHHSLATKAVDYTKKQHVLRLRTAEWAVYLLQSSDPTELQGWIDTINFVAASLSAPPLP-GGVGSQKKFQRPLLPSSYTRLNLTQQLQHHESKVVELQESLEEHKRYPPSKGAKERIIREYEEKEQYLHFELERFQTYAHLLKSKM 886          
BLAST of PH and SEC7 domain-containing protein vs. TrEMBL
Match: A0A1S3IND9 (PH and SEC7 domain-containing protein 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106165942 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 2.558e-79
Identity = 130/252 (51.59%), Postives = 183/252 (72.62%), Query Frame = 2
Query: 1082 IYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            +Y QP K AD  +A RLAKRLY L+GFK +DV+KHL K+NDFSQLV EE+  FFDF    LD ALR+FL +F L G+TQERERV+ HF+RRY++CNP+ +N E+ACHTL CA+MLLNTDLHG NI R+M+C +F+ ++AELN+G++F R+ L  L+ SI  +P+ W +D E     +  L   + +++++  H N FL+VP  + + EY  GY++RKC  E   ++T +GKRGWK+Y+  L+D+ L+ +KDE
Sbjct:  475 VYFQPTKNADYPSAYRLAKRLYDLEGFKKADVAKHLGKKNDFSQLVAEEYLKFFDFVGIPLDVALRQFLQQFSLTGETQERERVLAHFTRRYMECNPDSFNSEDACHTLTCAIMLLNTDLHGQNIGRRMTCGEFIDNLAELNDGENFPRDVLKTLYLSIKSRPLEWALDEEGEATSETDLLLEE-SRRVNLGH-NPFLDVPDPSQATEYKRGYVMRKCCTEPDGKKTPLGKRGWKMYYATLRDMVLYFHKDE 724          

HSP 2 Score: 97.4413 bits (241), Expect = 1.146e-16
Identity = 49/148 (33.11%), Postives = 87/148 (58.78%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            + ++H+ A+KA DY+KK++V RL+ +  + YL Q ++P E+  W+D +NFVAA LS P              R  +  + T LN+ +QL++H+  V+ L++ L      PP K  K ++  +Y  + +++  EL R++TY+ LL+ +M
Sbjct:  740 VRIHHSLATKAVDYTKKQHVLRLRTAEWAVYLLQSSDPTELQGWIDTINFVAASLSAPPLP-GGVGSQKKFQRPLLPSSYTRLNLTQQLQHHESKVVELQESLEEHKRYPPSKGAKERIIREYEEKEQYLHFELERFQTYAHLLKSKM 886          
BLAST of PH and SEC7 domain-containing protein vs. TrEMBL
Match: A0A1S3IPC6 (PH and SEC7 domain-containing protein 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106165942 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 2.790e-79
Identity = 130/252 (51.59%), Postives = 183/252 (72.62%), Query Frame = 2
Query: 1082 IYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            +Y QP K AD  +A RLAKRLY L+GFK +DV+KHL K+NDFSQLV EE+  FFDF    LD ALR+FL +F L G+TQERERV+ HF+RRY++CNP+ +N E+ACHTL CA+MLLNTDLHG NI R+M+C +F+ ++AELN+G++F R+ L  L+ SI  +P+ W +D E     +  L   + +++++  H N FL+VP  + + EY  GY++RKC  E   ++T +GKRGWK+Y+  L+D+ L+ +KDE
Sbjct:  475 VYFQPTKNADYPSAYRLAKRLYDLEGFKKADVAKHLGKKNDFSQLVAEEYLKFFDFVGIPLDVALRQFLQQFSLTGETQERERVLAHFTRRYMECNPDSFNSEDACHTLTCAIMLLNTDLHGQNIGRRMTCGEFIDNLAELNDGENFPRDVLKTLYLSIKSRPLEWALDEEGEATSETDLLLEE-SRRVNLGH-NPFLDVPDPSQATEYKRGYVMRKCCTEPDGKKTPLGKRGWKMYYATLRDMVLYFHKDE 724          

HSP 2 Score: 97.4413 bits (241), Expect = 1.196e-16
Identity = 49/148 (33.11%), Postives = 87/148 (58.78%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            + ++H+ A+KA DY+KK++V RL+ +  + YL Q ++P E+  W+D +NFVAA LS P              R  +  + T LN+ +QL++H+  V+ L++ L      PP K  K ++  +Y  + +++  EL R++TY+ LL+ +M
Sbjct:  740 VRIHHSLATKAVDYTKKQHVLRLRTAEWAVYLLQSSDPTELQGWIDTINFVAASLSAPPLP-GGVGSQKKFQRPLLPSSYTRLNLTQQLQHHESKVVELQESLEEHKRYPPSKGAKERIIREYEEKEQYLHFELERFQTYAHLLKSKM 886          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Cavefish
Match: psda (pleckstrin and Sec7 domain containing a [Source:ZFIN;Acc:ZDB-GENE-090313-44])

HSP 1 Score: 239.58 bits (610), Expect = 3.358e-68
Identity = 115/249 (46.18%), Postives = 170/249 (68.27%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIG-----LFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AAKRLAKRLY+LDGF+ SDV++HLSK N+FS++V EE+ ++F+F+  T+D ALR FL +F L G+TQERERV+ HFSRRY+QCNPN    E++ HTL CALMLLNTDLHG+N+ ++MSC  F+ ++  LN+G  F ++ L  L+NSI  + ++W ID E +      L   ++D      +  ++  N  + +  +++++ Y +G+L+RK   +   +RT  GKRGWK ++  L+ L L+L K E
Sbjct:   26 ADLQAAKRLAKRLYNLDGFRRSDVARHLSKNNEFSRMVAEEYLSYFNFSGLTVDQALRVFLREFALMGETQERERVLSHFSRRYMQCNPNAVPSEDSVHTLTCALMLLNTDLHGHNVGKRMSCTQFIGNLEGLNDGQDFPKDLLKALYNSIKNEKLQWTIDEEELRKSFSELVDGRMDSASHTMKRISSGGNPLVSLAQQSSAQVYKNGFLVRKVHADPDGKRTPRGKRGWKSFYAILKGLVLYLQKGE 274          

HSP 2 Score: 70.4774 bits (171), Expect = 6.459e-12
Identity = 51/173 (29.48%), Postives = 85/173 (49.13%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPAL----TSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARLNQQAFMDPYL 2674
            I ++H+ A +A+DYSK+ NVF L+ ++   +LFQ     ++  W+  +N VAA+ S P F          S      P L    T L+ +EQL+ H+     +  +L  L S P  +  K K + +  ++ +F++ E  RY TY+ LL  + I +    +A    + F D  L
Sbjct:  290 ISIHHSLAMRASDYSKRPNVFYLRTADWRVFLFQAPNAEQMQSWITRINTVAAMFSAPPFPAAIGSQKRFS-----RPLLPGSNTKLSQEEQLQAHETRFRAMSAELQELRSVPQDRRTKGKDQDEGKQREEFLDFEKTRYGTYAMLLRAK-IRIGESDLAAFESRLFADGGL 456          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Cavefish
Match: psd3l (PH and SEC7 domain-containing protein 3 [Source:NCBI gene;Acc:103038592])

HSP 1 Score: 235.728 bits (600), Expect = 5.155e-67
Identity = 115/251 (45.82%), Postives = 163/251 (64.94%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHL-------NLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            +D+ AA+RLA+RLYHL+GF+ SDV+KHL K NDFS++V EE+ +FF+FT  TLD +LR FL  F L G+TQERERV+ H+S RY QCNP +   ++  H L CALMLLNTDLHG NI +KM+C++F+ ++  LN G  F RE L  L+NSI  + + W ID + +     +L  N  +   HT  +       N FL++  +  +  Y +G+L RK   +   ++T  GKRGWK ++  L+ + L+L KDE
Sbjct:   40 SDQEAAQRLARRLYHLEGFRRSDVAKHLGKNNDFSKMVAEEYLSFFEFTGMTLDQSLRSFLKAFALMGETQERERVLIHYSNRYYQCNPTIIASQDGVHCLTCALMLLNTDLHGQNIGKKMTCQEFINNLDGLNAGQDFPRELLKALYNSIKNEKLEWAIDGDELKKSLSELADNKKD-NAHTKSISRISSGSNPFLDIAHDPNAAVYKTGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGMILYLQKDE 289          

HSP 2 Score: 79.337 bits (194), Expect = 1.037e-14
Identity = 54/162 (33.33%), Postives = 87/162 (53.70%), Query Frame = 2
Query: 2120 ESVSSSLDIGSTGDTHIYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS-LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLE 2602
            E   S  D+ +   TH    HA A +A DY KK NV +L+ ++   +LFQ   P E+D W+  +N VAA+ S P F   ++  S       + PA T+ ++ +EQL++H+  + ++  +L    S PP K  K K   +Y  +  ++E E  RY+TY +LL+
Sbjct:  293 EKALSEEDLKNAISTH----HALAIQAVDYEKKPNVLKLKTADWRVFLFQAQSPEEMDSWIRIINSVAAMFSAPSF--PAAIGSQKKFSRPLLPATTTRMSQEEQLKSHEAKLKHISTELAEHRSYPPDKKVKAKEVDEYRLKEHYLEFEENRYETYVKLLK 448          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000052239.1 (PH and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:103042928])

HSP 1 Score: 236.884 bits (603), Expect = 1.211e-66
Identity = 117/248 (47.18%), Postives = 164/248 (66.13%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPS----EATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AAKRLAKRL++LDGF+  DV++HLSK NDFS++V EE+  +F+FT  TLD ALR FL +F L G+TQERERV+ HFSRRY+QCNP +   E++ HTL CALMLLNTDLHG NI ++MSC  F+ ++  LN+G  F RE L  L+NSI  + ++W ID E +     +  ++++ +Q   ++        S     + +  Y +G+L+RK   +   +RT  GKRGWK ++  L+ L L+L K E
Sbjct:   97 ADLEAAKRLAKRLFNLDGFRKCDVARHLSKNNDFSRMVAEEYLGYFNFTGQTLDQALRSFLLEFALMGETQERERVLAHFSRRYLQCNPMLLLSEDSVHTLTCALMLLNTDLHGQNIGKRMSCTQFIGNLEGLNSGHDFPRELLKALYNSIKNEKLQWTIDEEEL-----RKSFSELGEQREESNSRGMKRTGSGIVPASGALLYKTGFLVRKVHADCDGKRTPRGKRGWKTFYAVLKGLVLYLQKGE 339          

HSP 2 Score: 58.9214 bits (141), Expect = 2.882e-8
Identity = 44/144 (30.56%), Postives = 73/144 (50.69%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLL 2599
            + ++H+ A +ATDY K+ NVF L+ ++   YLFQ     ++  W+  +N VAA+ S P            S       A + L+ +EQ++ H+        +L  L S PP +  K +   +Y  + +++E E  RY+TYS LL
Sbjct:  355 VSIHHSLAIRATDYHKRPNVFYLRTADWRVYLFQAPNAEQMQSWITRINTVAAMFSAPPLPAAIGSQKKFSRPLLPGSA-SKLSQEEQVQAHEARFHATSTELAELRSYPPDRKVKGRELEEYRLREEYLEFEKTRYETYSMLL 497          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Cavefish
Match: psda (pleckstrin and Sec7 domain containing a [Source:ZFIN;Acc:ZDB-GENE-090313-44])

HSP 1 Score: 244.973 bits (624), Expect = 1.160e-65
Identity = 115/249 (46.18%), Postives = 170/249 (68.27%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELI-----GLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AAKRLAKRLY+LDGF+ SDV++HLSK N+FS++V EE+ ++F+F+  T+D ALR FL +F L G+TQERERV+ HFSRRY+QCNPN    E++ HTL CALMLLNTDLHG+N+ ++MSC  F+ ++  LN+G  F ++ L  L+NSI  + ++W ID E +      L   ++D      +  ++  N  + +  +++++ Y +G+L+RK   +   +RT  GKRGWK ++  L+ L L+L K E
Sbjct: 1162 ADLQAAKRLAKRLYNLDGFRRSDVARHLSKNNEFSRMVAEEYLSYFNFSGLTVDQALRVFLREFALMGETQERERVLSHFSRRYMQCNPNAVPSEDSVHTLTCALMLLNTDLHGHNVGKRMSCTQFIGNLEGLNDGQDFPKDLLKALYNSIKNEKLQWTIDEEELRKSFSELVDGRMDSASHTMKRISSGGNPLVSLAQQSSAQVYKNGFLVRKVHADPDGKRTPRGKRGWKSFYAILKGLVLYLQKGE 1410          

HSP 2 Score: 73.559 bits (179), Expect = 1.266e-12
Identity = 50/169 (29.59%), Postives = 87/169 (51.48%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARLNQQAFMDPYL 2674
            I ++H+ A +A+DYSK+ NVF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  + T L+ +EQL+ H+     +  +L  L S P  +  K K + +  ++ +F++ E  RY TY+ LL  + I +    +A    + F D  L
Sbjct: 1426 ISIHHSLAMRASDYSKRPNVFYLRTADWRVFLFQAPNAEQMQSWITRINTVAAMFSAPPFPA-AIGSQKRFSRPLLPGSNTKLSQEEQLQAHETRFRAMSAELQELRSVPQDRRTKGKDQDEGKQREEFLDFEKTRYGTYAMLLRAK-IRIGESDLAAFESRLFADGGL 1592          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Cavefish
Match: psd3l (PH and SEC7 domain-containing protein 3 [Source:NCBI gene;Acc:103038592])

HSP 1 Score: 242.276 bits (617), Expect = 6.441e-65
Identity = 115/251 (45.82%), Postives = 163/251 (64.94%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHL-------NLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            +D+ AA+RLA+RLYHL+GF+ SDV+KHL K NDFS++V EE+ +FF+FT  TLD +LR FL  F L G+TQERERV+ H+S RY QCNP +   ++  H L CALMLLNTDLHG NI +KM+C++F+ ++  LN G  F RE L  L+NSI  + + W ID + +     +L  N  +   HT  +       N FL++  +  +  Y +G+L RK   +   ++T  GKRGWK ++  L+ + L+L KDE
Sbjct:  945 SDQEAAQRLARRLYHLEGFRRSDVAKHLGKNNDFSKMVAEEYLSFFEFTGMTLDQSLRSFLKAFALMGETQERERVLIHYSNRYYQCNPTIIASQDGVHCLTCALMLLNTDLHGQNIGKKMTCQEFINNLDGLNAGQDFPRELLKALYNSIKNEKLEWAIDGDELKKSLSELADNKKD-NAHTKSISRISSGSNPFLDIAHDPNAAVYKTGFLARKIHADMDGKKTPRGKRGWKTFYAVLKGMILYLQKDE 1194          

HSP 2 Score: 81.6481 bits (200), Expect = 4.661e-15
Identity = 50/146 (34.25%), Postives = 81/146 (55.48%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTS-LNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLE 2602
            I  +HA A +A DY KK NV +L+ ++   +LFQ   P E+D W+  +N VAA+ S P F    +  S       + PA T+ ++ +EQL++H+  + ++  +L    S PP K  K K   +Y  +  ++E E  RY+TY +LL+
Sbjct: 1210 ISTHHALAIQAVDYEKKPNVLKLKTADWRVFLFQAQSPEEMDSWIRIINSVAAMFSAPSFPA--AIGSQKKFSRPLLPATTTRMSQEEQLKSHEAKLKHISTELAEHRSYPPDKKVKAKEVDEYRLKEHYLEFEENRYETYVKLLK 1353          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Sea Lamprey
Match: si:dkey-283b15.4 (cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502])

HSP 1 Score: 90.8929 bits (224), Expect = 2.262e-19
Identity = 50/160 (31.25%), Postives = 86/160 (53.75%), Query Frame = 2
Query: 1112 KSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYN-----CEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIR 1576
            K+  + +A+ LY  +G   + + ++L +R+DF+  V   F    +F    L  ALR+FL  F L G+ Q+ +R++  F+ RY QCN  V+        + C+ L  A+++LNT LH  N+  K + E F++    +N+G     E L  L++SI  +P +
Sbjct:   93 KNTPEDIAQFLYKGEGLNKTAIGEYLGERDDFNIQVLHAFVELHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCQCNAGVFQSTGGVATDTCYVLSFAIIMLNTSLHNPNVRDKPTTERFILMNRGINDGGDLPEELLRNLYDSIKNEPFK 252          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Sea Lamprey
Match: iqsec1b (IQ motif and Sec7 domain ArfGEF 1b [Source:ZFIN;Acc:ZDB-GENE-120813-1])

HSP 1 Score: 80.8777 bits (198), Expect = 1.368e-15
Identity = 51/160 (31.87%), Postives = 80/160 (50.00%), Query Frame = 2
Query: 1175 VSKHLSKRNDFS-QLVGEEFANF---------------FDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNV---YNCEEACHTLVCALMLLNTDLHGNNIN--RKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDN 1591
            V+  L +R   S Q++GE   N                 DF+   LD ALR F A   + G+ Q+ ER+I  FS+RY  CNP V   +   +    L  A++LLNTD++  N+   RKM  +DFV ++  +++G    RE L+ ++  I    ++ N D+
Sbjct:  494 VAHFLLQRKGLSRQMIGEFLGNRQRAFNRDVLDCVVDEMDFSGMELDEALRMFQAHIRVQGEAQKVERLIEAFSQRYCMCNPGVVKNFQNPDTIFILAFAIVLLNTDMYSPNVKPERKMKLDDFVKNLRGVDDGADIPREILVGIYERIQRGELKTNDDH 653          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001471.1 (pep scaffold:Pmarinus_7.0:GL477283:166775:173339:-1 gene:ENSPMAG00000001328.1 transcript:ENSPMAT00000001471.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 5.550e-15
Identity = 40/115 (34.78%), Postives = 67/115 (58.26%), Query Frame = 2
Query: 1229 FANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNC---EEACHTLVCALMLLNTDLHGNNI--NRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSI 1558
            F +  DF+   LD ALR F     L G+ Q+ ER++  FSRRY  CNP V +    E+    L  A++LLNTD++  ++  +RKM  +DF+ ++  +++G+   R+ L+ ++  I
Sbjct:   61 FVDEMDFSGLELDEALRLFQTHVRLQGEAQKVERLVEVFSRRYCACNPAVVSALCSEDTVFVLAFAIVLLNTDMYSPSVRHDRKMRLDDFIKNLRGVDDGEDIPRDFLVGIYERI 175          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007609.1 (pep scaffold:Pmarinus_7.0:GL477333:80854:108205:-1 gene:ENSPMAG00000006851.1 transcript:ENSPMAT00000007609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 9.910e-14
Identity = 41/122 (33.61%), Postives = 69/122 (56.56%), Query Frame = 2
Query: 1241 FDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNV---YNCEEACHTLVCALMLLNTDLHGNNIN--RKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDN 1591
             DF    +D ALRKF  +  + G+ Q+ ER+I  FS+RY  CN  +   +   +    L  A++LLNTD +  N+   RKM  EDF+ ++  +++G    RE L+ +++ I +K ++ N D+
Sbjct:  109 MDFAGMDIDEALRKFQGQVRVQGEAQKVERMIEAFSQRYCVCNSVLLRQFRNPDTIFILAFAIILLNTDRYSPNVKAERKMKLEDFIKNLRGVDDGKDIPREMLLSIYDRISKKELKTNEDH 230          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Sea Lamprey
Match: psda (pleckstrin and Sec7 domain containing a [Source:ZFIN;Acc:ZDB-GENE-090313-44])

HSP 1 Score: 68.9366 bits (167), Expect = 8.907e-13
Identity = 48/171 (28.07%), Postives = 86/171 (50.29%), Query Frame = 2
Query: 2102 LQNSGNESVSSSLDIGSTGDTHIYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPP-CKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            LQ + +E  + +          + ++HA A++ATDY+K+ +V +L+ ++   +L Q    +E++ W+  +N VA L S P F   +       SR  +  + T L  +EQL +H+  +  +  DL+   S PP  +  + K    Y  ++ ++E E  RY TY  LL  +M
Sbjct:   46 LQKAKDEHKADTPVSDDDAKQAVSVHHALATRATDYTKRPHVLKLKTADWRVFLLQAPNTQEMESWITRINLVATLFSAPPFPA-AIGSQKRFSRPLLPASATKLPQEEQLRSHEDKLKGVTSDLDQHRSYPPDPRRVRAKEADDYRLKQHYLEFEKTRYGTYVTLLRAKM 215          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Yeast
Match: SEC7 (Guanine nucleotide exchange factor (GEF) for ADP ribosylation factors; involved in proliferation of the Golgi, intra-Golgi transport and ER-to-Golgi transport; found in the cytoplasm and on Golgi-associated coated vesicles [Source:SGD;Acc:S000002577])

HSP 1 Score: 95.1301 bits (235), Expect = 4.204e-20
Identity = 67/231 (29.00%), Postives = 115/231 (49.78%), Query Frame = 2
Query:  914 FTEAEDIGSLSPEEETQTFASANLEDDDDKSTLCGSDHGDKDEIEINAPSDVFQEAIYHQPPKAADKSAAKR----------LAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIR 1576
             T  +D      +EE+++ +S N++ DD           +  ++   A S+    AI++  PK A     K+          +AK L   +G  M+ V  +L + +D +  +   F + FDFT  ++  ALR FL  F L G+ Q+ +R +  F+ R+V  NP V++  +  + L  +L++LNTDLH + I  KMS ++F+ +   ++NG    R+ L  LFN I    I+
Sbjct:  790 MTSNDDFKPTYEDEESRSLSSQNIDADD-------PTQFENLKLRKTALSECI--AIFNNKPKKAIPVLIKKGFLKDDSPISIAKWLLETEGLDMAAVGDYLGEGDDKNIAIMHAFVDEFDFTGMSIVDALRSFLQSFRLPGEGQKIDRFMLKFAERFVDQNPGVFSKADTAYVLSYSLIMLNTDLHSSQIKNKMSLQEFLENNEGIDNGRDLPRDFLEGLFNEIANNEIK 1011          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Yeast
Match: GEA2 (Guanine nucleotide exchange factor for ADP ribosylation factors (ARFs); involved in vesicular transport between the Golgi and ER, Golgi organization, and actin cytoskeleton organization; GEA2 has a paralog, GEA1, that arose from the whole genome duplication [Source:SGD;Acc:S000000748])

HSP 1 Score: 54.299 bits (129), Expect = 1.044e-7
Identity = 35/103 (33.98%), Postives = 50/103 (48.54%), Query Frame = 2
Query: 1226 EFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVY-------NCEEACHT----------LVCALMLLNTDLHGNNINRKMSCEDF 1483
            E+   FDF+   +D A+R  L KF L G++Q+ ER+I  FS  Y  C    Y       N E+   T          L  ++++LNTDLH   +   MS ED+
Sbjct:  626 EYIRLFDFSGLRVDEAIRILLTKFRLPGESQQIERIIEAFSSAY--CENQDYDPSKISDNAEDDISTVQPDADSVFILSYSIIMLNTDLHNPQVKEHMSFEDY 726          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Yeast
Match: GEA1 (Guanine nucleotide exchange factor for ADP ribosylation factors (ARFs); involved in vesicular transport between the Golgi and ER, Golgi organization, and actin cytoskeleton organization; GEA1 has a paralog, GEA2, that arose from the whole genome duplication [Source:SGD;Acc:S000003792])

HSP 1 Score: 51.2174 bits (121), Expect = 1.126e-6
Identity = 37/146 (25.34%), Postives = 63/146 (43.15%), Query Frame = 2
Query: 1223 EEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRY-----------------------------VQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPI 1573
            +EF + FDF    +D A+R  L KF L G++Q+ ER++  FS +Y                             +   P+     ++   L  ++++LNTD H   +   M+ +D+  ++    NG  F R  L  ++ SI  K I
Sbjct:  607 KEFIDLFDFKGLRVDEAIRILLTKFRLPGESQQIERIVEAFSSKYSADQSNDKVELEDKKAGKNGSESMTEDDIIHVQPDA----DSVFVLSYSIIMLNTDSHNPQVKDHMTFDDYSNNLRGCYNGKDFPRWYLHKIYTSIKVKEI 748          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Nematostella
Match: EDO34812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN91])

HSP 1 Score: 147.517 bits (371), Expect = 7.925e-39
Identity = 83/244 (34.02%), Postives = 127/244 (52.05%), Query Frame = 2
Query: 1100 KAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYK 1831
            +  +  + + LA RL+ LDGF    V+  L K   F + V  E+   F+F+  ++  ALR F   F+L G+TQERER++  FS RY QCN   Y   +A HTLVCA++LLNTD HG NI +KM+   F+ +MA L +G  F ++ L  ++  I   P+ W+      G+          +  +  +   L  ++  +   K +  G L RK   ES  ++TS  KR W  +   L+ + L L+K
Sbjct:    2 RWVEHESPRTLAFRLFSLDGFTKDQVAPQLYKNTTFGKTVAVEYLKLFNFSGLSIVEALRVFTKAFLLIGETQERERILIPFSNRYYQCNTPDYGSADAVHTLVCAVLLLNTDHHGENIGKKMTLSQFLENMAGLCDGHDFPKDLLKSIYQEIRTNPLEWS------GI------ETAWSPPVILHFCTLSFQIQVDEKDKLFKEGLLYRKVTMESEGKKTSAWKRKWIPFHATLKGMVLFLHK 233          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Nematostella
Match: EDO34882 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN35])

HSP 1 Score: 100.523 bits (249), Expect = 6.708e-22
Identity = 52/148 (35.14%), Postives = 88/148 (59.46%), Query Frame = 2
Query: 1130 LAKRLYHLDGFKMSDVSKHLSK-RNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNP-NVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEK 1567
            +AK L    G     + ++L   +NDF+  V + FA  FDFT   +D ALR FLA+F + G+ Q+ ER++  F+ +Y+ CNP +  + ++    L  A+++LNTDLH  N+ ++M+ EDF+ ++   NNG +F  E L  ++  + +K
Sbjct:   67 VAKFLLSEHGVSKQRLGEYLGNLQNDFNMAVLKCFAESFDFTGMEIDVALRTFLAQFRIPGEAQKIERLMEVFAEQYISCNPTDDTSAQDKVLILAFAIVMLNTDLHSPNVKKRMTQEDFIRNLEGTNNGGNFPSESLAGIYRRVFKK 214          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Nematostella
Match: EDO38004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA8])

HSP 1 Score: 84.7297 bits (208), Expect = 3.673e-17
Identity = 45/143 (31.47%), Postives = 78/143 (54.55%), Query Frame = 2
Query: 1130 LAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSI 1558
            LA  L   +G   + +  +L +  +F+  V  +F +   F    L  ALR+FL  F L G+ Q+ +R++  F+++Y   NP ++   + C+ L  A++LLNT LH  N+  K + E F+     +N G+  DR+ L+ L++SI
Sbjct:   92 LADFLLKEEGLNKTQIGNYLGENKEFNLDVFAKFVDLHKFKDMILVQALRQFLWSFRLPGEAQKIDRMMEAFAQKYCADNPGLFTSTDTCYVLSFAIILLNTSLHNPNVKDKPTVEKFIQMNRGINCGEDLDRDFLVALYDSI 234          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Nematostella
Match: EDO29369 (pep supercontig:ASM20922v1:NEMVEscaffold_1160:24851:31523:-1 gene:NEMVEDRAFT_v1g144802 transcript:EDO29369 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 2.653e-12
Identity = 32/93 (34.41%), Postives = 56/93 (60.22%), Query Frame = 2
Query: 1280 KFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSI 1558
            +FL  F L G+ Q+ +R++  F+++Y   NP ++   + C+ L  A++LLNT LH  N+  K + E F+     +N G+  DR+ L+ L++SI
Sbjct:    2 QFLWSFRLPGEAQKIDRMMEAFAQKYCADNPGLFTSTDTCYVLSFAIILLNTSLHNPNVKDKPTVEKFIQMNRGINCGEDLDRDFLVALYDSI 94          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Nematostella
Match: EDO31538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXN1])

HSP 1 Score: 70.4774 bits (171), Expect = 4.406e-12
Identity = 41/130 (31.54%), Postives = 71/130 (54.62%), Query Frame = 2
Query: 1175 VSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRK--MSCEDFVVSMAELNNGDHFDREDLIMLFNSI 1558
            + +++ K+++   L  + F   F+F    +D  LR+FL  F L G++   E ++  FS  + +CNP VY  ++A  TL  A+++LN D H  NI ++  M  EDF  ++ ++N G+ F    L  +F  I
Sbjct:  728 IGEYIGKKDNSKVL--DAFVRSFEFHDLRVDEGLRQFLESFRLPGESPVIEHIMEFFSEVFFECNPEVYANKDAVFTLAYAVIMLNVDQHNANIKQQKPMVLEDFKRNLRKINGGNDFPATMLEEIFTCI 855          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000003646.2 (PH and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:101166656])

HSP 1 Score: 243.047 bits (619), Expect = 3.092e-69
Identity = 119/248 (47.98%), Postives = 165/248 (66.53%), Query Frame = 2
Query: 1109 DKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHT-----NHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            D  AAKRLAKRLY+LDGF+ SDV++HL K N+FSQLV EE+ + F+F   T+D ALR FL+ F L G+TQERERV+ HFSRRY  CNP   + E++ HTL CA+MLLNTDLHGNN+ ++MSC  F+ ++  LN+G  F +E L +L+ SI  + ++W ID E +     +L  +  +   HT     +  N  + V  +A  + YMSG+L+RK   +   +RT+ GKRGWK ++  L+ L L+L KDE
Sbjct:   38 DLQAAKRLAKRLYNLDGFRKSDVARHLGKNNEFSQLVAEEYLSCFNFKGLTIDQALRLFLSHFALMGETQERERVLAHFSRRYKHCNPESLSTEDSIHTLTCAIMLLNTDLHGNNVGKRMSCTQFISNLEGLNDGKDFPKELLKILYTSIKTEKLQWTIDEEELRKSISELAESRTDSASHTMKRLGSGGNPMVGVAQQADGELYMSGFLVRKVHADPDGKRTARGKRGWKSFYAMLKGLVLYLQKDE 285          

HSP 2 Score: 62.003 bits (149), Expect = 2.737e-9
Identity = 41/148 (27.70%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            + ++H+ A +A DYSK+ NVF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  + T L+ +EQ + H+     +  +L  L+   P +  K +   +   +++++E E  RY TY+ LL  ++
Sbjct:  301 VSVHHSLAMRAVDYSKRPNVFYLRTADWRVFLFQAPNAEQMQSWITRINVVAAMFSAPPFPA-AIGSQKRFSRPLLPGSGTKLSQEEQAKFHENRFRAVSSELLELTPATPDRKAKGRELEEQKLRKEYLEFEKTRYGTYAMLLRAKL 447          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000032974.1 (PH and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:101166656])

HSP 1 Score: 242.276 bits (617), Expect = 9.483e-69
Identity = 119/248 (47.98%), Postives = 165/248 (66.53%), Query Frame = 2
Query: 1109 DKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHT-----NHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            D  AAKRLAKRLY+LDGF+ SDV++HL K N+FSQLV EE+ + F+F   T+D ALR FL+ F L G+TQERERV+ HFSRRY  CNP   + E++ HTL CA+MLLNTDLHGNN+ ++MSC  F+ ++  LN+G  F +E L +L+ SI  + ++W ID E +     +L  +  +   HT     +  N  + V  +A  + YMSG+L+RK   +   +RT+ GKRGWK ++  L+ L L+L KDE
Sbjct:   65 DLQAAKRLAKRLYNLDGFRKSDVARHLGKNNEFSQLVAEEYLSCFNFKGLTIDQALRLFLSHFALMGETQERERVLAHFSRRYKHCNPESLSTEDSIHTLTCAIMLLNTDLHGNNVGKRMSCTQFISNLEGLNDGKDFPKELLKILYTSIKTEKLQWTIDEEELRKSISELAESRTDSASHTMKRLGSGGNPMVGVAQQADGELYMSGFLVRKVHADPDGKRTARGKRGWKSFYAMLKGLVLYLQKDE 312          

HSP 2 Score: 62.003 bits (149), Expect = 2.688e-9
Identity = 41/148 (27.70%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            + ++H+ A +A DYSK+ NVF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  + T L+ +EQ + H+     +  +L  L+   P +  K +   +   +++++E E  RY TY+ LL  ++
Sbjct:  328 VSVHHSLAMRAVDYSKRPNVFYLRTADWRVFLFQAPNAEQMQSWITRINVVAAMFSAPPFPA-AIGSQKRFSRPLLPGSGTKLSQEEQAKFHENRFRAVSSELLELTPATPDRKAKGRELEEQKLRKEYLEFEKTRYGTYAMLLRAKL 474          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045701.1 (PH and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:101166656])

HSP 1 Score: 246.514 bits (628), Expect = 4.417e-66
Identity = 132/312 (42.31%), Postives = 187/312 (59.94%), Query Frame = 2
Query:  956 ETQTFASANLEDDDDKSTLCGSDHGDKDEIEINAP-------SDVFQEAIYHQPPKA------ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHT-----NHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            E +T+  + L+D   K++     H +  E  +N P        DV Q        +A       D  AAKRLAKRLY+LDGF+ SDV++HL K N+FSQLV EE+ + F+F   T+D ALR FL+ F L G+TQERERV+ HFSRRY  CNP   + E++ HTL CA+MLLNTDLHGNN+ ++MSC  F+ ++  LN+G  F +E L +L+ SI  + ++W ID E +     +L  +  +   HT     +  N  + V  +A  + YMSG+L+RK   +   +RT+ GKRGWK ++  L+ L L+L KDE
Sbjct: 1100 EKETWRRSILKDGFRKASSVPVLHSEPRERAVNRPVELLYPQDDVAQRLALGGSDEALANGLKPDLQAAKRLAKRLYNLDGFRKSDVARHLGKNNEFSQLVAEEYLSCFNFKGLTIDQALRLFLSHFALMGETQERERVLAHFSRRYKHCNPESLSTEDSIHTLTCAIMLLNTDLHGNNVGKRMSCTQFISNLEGLNDGKDFPKELLKILYTSIKTEKLQWTIDEEELRKSISELAESRTDSASHTMKRLGSGGNPMVGVAQQADGELYMSGFLVRKVHADPDGKRTARGKRGWKSFYAMLKGLVLYLQKDE 1411          

HSP 2 Score: 63.929 bits (154), Expect = 9.998e-10
Identity = 41/148 (27.70%), Postives = 77/148 (52.03%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            + ++H+ A +A DYSK+ NVF L+ ++   +LFQ     ++  W+  +N VAA+ S P F   +       SR  +  + T L+ +EQ + H+     +  +L  L+   P +  K +   +   +++++E E  RY TY+ LL  ++
Sbjct: 1427 VSVHHSLAMRAVDYSKRPNVFYLRTADWRVFLFQAPNAEQMQSWITRINVVAAMFSAPPFPA-AIGSQKRFSRPLLPGSGTKLSQEEQAKFHENRFRAVSSELLELTPATPDRKAKGRELEEQKLRKEYLEFEKTRYGTYAMLLRAKL 1573          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000034031.1 (PH and SEC7 domain-containing protein 1 [Source:NCBI gene;Acc:101166258])

HSP 1 Score: 231.106 bits (588), Expect = 1.185e-64
Identity = 118/251 (47.01%), Postives = 164/251 (65.34%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNE-------LIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD +AAKRLAKRLY+L+GF+ +DVS+HLSK NDFSQ + EE+ +FF+F    LD ALR FL +F L G+TQERERV+ HFSRRY+ CNP V   E+A HTL CALMLLNTDLHG N+ ++MS   F+ ++  LNNG  F ++ L  L+NSI  + ++W +D E        +G    + D +   K++ ++  +L   + S  T   Y +G+L+RK   +S  +R   GKRGWK ++  L+ L L+L K E
Sbjct:   92 ADVAAAKRLAKRLYNLEGFRKADVSRHLSKNNDFSQTIAEEYLSFFNFAGLNLDQALRTFLRQFALMGETQERERVLSHFSRRYMVCNPGVMPSEDAVHTLTCALMLLNTDLHGQNVGKRMSSSQFIANLEGLNNGQDFPKDLLKALYNSIKNQKLQWTLDEEELRKSFSELGDSLCEADTSKSMKRVSSSGKSLSDGMHSTGTLL-YKNGFLVRKVHADSDGKRRPRGKRGWKTFYAILKGLILYLQKGE 341          

HSP 2 Score: 74.7146 bits (182), Expect = 3.136e-13
Identity = 54/192 (28.12%), Postives = 93/192 (48.44%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLE------------FEMIHLHNMTIARLNQQAFMDPYLVPVQYSQIPGS 2707
            + ++H+ A KA+DYSK+ NVF L+ ++   YLFQ     ++  W+  +N VAAL S P F   +       SR  +   ++ L+ +EQ+ +H+     +  DL  L S PP +  K +   +Y ++ ++++ E  RY TY  LL             FE + L + ++ R +    +       Q SQ+  S
Sbjct:  357 VSIHHSLAMKASDYSKRPNVFYLRTADWRVYLFQAPNAEQMQSWITRINTVAALFSAPPFPA-AIGSQKKFSRPLLPGTMSKLSEEEQMRSHEARFRAISNDLGDLRSYPPDRKVKGREMEEYRQRDEYLDFEKTRYGTYIMLLRAKIRSGEEDLALFESLLLEDSSLQRAHSSPTLQDSSQASQVSQMSSS 547          
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Medaka
Match: psd2 (pleckstrin and Sec7 domain containing 2 [Source:NCBI gene;Acc:101159758])

HSP 1 Score: 233.032 bits (593), Expect = 3.566e-63
Identity = 115/249 (46.18%), Postives = 157/249 (63.05%), Query Frame = 2
Query: 1106 ADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNE-----LIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDE 1837
            AD  AAKRLAKRLYHL+GFK  DV++HL K N+FSQ+V  E+ +FFDF+  +LD ALR FL  F L G+TQERER++ HFSRR+  CN      E+  HTL CALMLLNTDLHG+NI +KMSC+ F+ ++  LNNG  F ++ L +L+NSI  + + W ++ E     L  L + + +         T+  N F+ +P    +  Y  G L RK   E   +RT  G+RGWK ++  L+ + L+L KDE
Sbjct:  405 ADGEAAKRLAKRLYHLEGFKRCDVARHLGKNNEFSQMVASEYLSFFDFSGLSLDRALRNFLKAFPLMGETQERERILVHFSRRFCHCNLQTLTSEDGAHTLTCALMLLNTDLHGHNIGKKMSCQQFISNLDGLNNGKDFPKDLLKVLYNSIKNEKLEWAVEEEELRKSLSELVEEQCEGGSKRVARVTDSSNPFIAIPILLNAVTYKHGVLTRKSHAEMDGKRTPRGRRGWKKFYAVLKGMILYLQKDE 653          

HSP 2 Score: 68.5514 bits (166), Expect = 3.493e-11
Identity = 45/152 (29.61%), Postives = 78/152 (51.32%), Query Frame = 2
Query: 2168 IYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIK----EQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEM 2611
            + ++HA A++ATDYSK+ NV +L+ S+   +L Q     E+  W+  +N VAAL S P F       ++ S +    P L S + +    EQL +H+R +  +  +L       P    K++   +Y  +  ++  E  RY+TY  LL+ ++
Sbjct:  669 VRIHHALATRATDYSKRANVLKLKTSDWRVFLLQAPSEEEMMSWIFRINLVAALFSAPAF-----PAAIGSMKKFCRPILPSSSTRHTQEEQLVSHERQLKQMGVELEEHRKNQPAVDPKSREWEEYRLKEHYLTYEKTRYETYISLLQAKI 815          
BLAST of PH and SEC7 domain-containing protein vs. Planmine SMEST
Match: SMESG000041617.1 (SMESG000041617.1)

HSP 1 Score: 2018.43 bits (5228), Expect = 0.000e+0
Identity = 1067/1067 (100.00%), Postives = 1067/1067 (100.00%), Query Frame = 2
Query:   77 MQILLFVELCNQSLFSSMDILNNFRKFKDLEENEKFYSYWXXXXXXXXXXXXXXXXXXXVDELKFIXXXXXXXXXXEVYSLETSMIEMNCQDEKSPTETPGNSSQNRRYQHTPSPMVPRSSXXXXXXXXXXXTFLQLSNKGFAQSLGKQTFLQKKASENPSISTGFLSHLKDSKLFDPFLPSSSVENYNFHRKMIATDNWLERSFDLDAMDNEDLLSISSHGSDRSNTPVDMRNNASHNDETQKPFPEASNKNEETNLMQCQKIFNSNYVSLLKPKILQFTEAEDIGSLSPEEETQTFASANLEDDDDKSTLCGSDHGDKDEIEINAPSDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLRKNGNSYSDPILTQIPNNKSESAQNTLVNGKSTKKSKRTMRFPGIEKRNCNPSSQPAXXXXXXXXXXXLQNSGNESVSSSLDIGSTGDTHIYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARLNQQAFMDPYLVPVQYSQIPGSSPLFYNHQTNQFVPAVNCVQTNIPVFQYHPSYSVPPGSINNSIKELSEENISQTHIESQAPISXXXXXXIQPVIIRPTFTCNRSSRSQLGNNKRRRYRNIPTPQQVIMQYPPPVHLSNSQTPIYGPLVPAHSSSATQQHHQMLVSKDEXXXXXXXXXXXXXXKVQSHPNVQQTNGANNLSTNNRTFYEIL 3277
            MQILLFVELCNQSLFSSMDILNNFRKFKDLEENEKFYSYWTLDDDYSQSSLSTTSLSQDVDELKFIDDDSASSSSDEVYSLETSMIEMNCQDEKSPTETPGNSSQNRRYQHTPSPMVPRSSNFYDNDNFNDDTFLQLSNKGFAQSLGKQTFLQKKASENPSISTGFLSHLKDSKLFDPFLPSSSVENYNFHRKMIATDNWLERSFDLDAMDNEDLLSISSHGSDRSNTPVDMRNNASHNDETQKPFPEASNKNEETNLMQCQKIFNSNYVSLLKPKILQFTEAEDIGSLSPEEETQTFASANLEDDDDKSTLCGSDHGDKDEIEINAPSDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLRKNGNSYSDPILTQIPNNKSESAQNTLVNGKSTKKSKRTMRFPGIEKRNCNPSSQPASEKVKSKSKSSLQNSGNESVSSSLDIGSTGDTHIYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINSSKDSLDSSRSKINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARLNQQAFMDPYLVPVQYSQIPGSSPLFYNHQTNQFVPAVNCVQTNIPVFQYHPSYSVPPGSINNSIKELSEENISQTHIESQAPISNNNNNNIQPVIIRPTFTCNRSSRSQLGNNKRRRYRNIPTPQQVIMQYPPPVHLSNSQTPIYGPLVPAHSSSATQQHHQMLVSKDESSTSPTSSGNQTPTKVQSHPNVQQTNGANNLSTNNRTFYEIL
Sbjct:    1 MQILLFVELCNQSLFSSMDILNNFRKFKDLEENEKFYSYWTLDDDYSQSSLSTTSLSQDVDELKFIDDDSASSSSDEVYSLETSMIEMNCQDEKSPTETPGNSSQNRRYQHTPSPMVPRSSNFYDNDNFNDDTFLQLSNKGFAQSLGKQTFLQKKASENPSISTGFLSHLKDSKLFDPFLPSSSVENYNFHRKMIATDNWLERSFDLDAMDNEDLLSISSHGSDRSNTPVDMRNNASHNDETQKPFPEASNKNEETNLMQCQKIFNSNYVSLLKPKILQFTEAEDIGSLSPEEETQTFASANLEDDDDKSTLCGSDHGDKDEIEINAPSDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLRKNGNSYSDPILTQIPNNKSESAQNTLVNGKSTKKSKRTMRFPGIEKRNCNPSSQPASEKVKSKSKSSLQNSGNESVSSSLDIGSTGDTHIYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINSSKDSLDSSRSKINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARLNQQAFMDPYLVPVQYSQIPGSSPLFYNHQTNQFVPAVNCVQTNIPVFQYHPSYSVPPGSINNSIKELSEENISQTHIESQAPISNNNNNNIQPVIIRPTFTCNRSSRSQLGNNKRRRYRNIPTPQQVIMQYPPPVHLSNSQTPIYGPLVPAHSSSATQQHHQMLVSKDESSTSPTSSGNQTPTKVQSHPNVQQTNGANNLSTNNRTFYEIL 1067          
BLAST of PH and SEC7 domain-containing protein vs. Planmine SMEST
Match: SMESG000041617.1 (SMESG000041617.1)

HSP 1 Score: 1982.61 bits (5135), Expect = 0.000e+0
Identity = 1050/1050 (100.00%), Postives = 1050/1050 (100.00%), Query Frame = 2
Query:  128 MDILNNFRKFKDLEENEKFYSYWXXXXXXXXXXXXXXXXXXXVDELKFIXXXXXXXXXXEVYSLETSMIEMNCQDEKSPTETPGNSSQNRRYQHTPSPMVPRSSXXXXXXXXXXXTFLQLSNKGFAQSLGKQTFLQKKASENPSISTGFLSHLKDSKLFDPFLPSSSVENYNFHRKMIATDNWLERSFDLDAMDNEDLLSISSHGSDRSNTPVDMRNNASHNDETQKPFPEASNKNEETNLMQCQKIFNSNYVSLLKPKILQFTEAEDIGSLSPEEETQTFASANLEDDDDKSTLCGSDHGDKDEIEINAPSDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLRKNGNSYSDPILTQIPNNKSESAQNTLVNGKSTKKSKRTMRFPGIEKRNCNPSSQPAXXXXXXXXXXXLQNSGNESVSSSLDIGSTGDTHIYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARLNQQAFMDPYLVPVQYSQIPGSSPLFYNHQTNQFVPAVNCVQTNIPVFQYHPSYSVPPGSINNSIKELSEENISQTHIESQAPISXXXXXXIQPVIIRPTFTCNRSSRSQLGNNKRRRYRNIPTPQQVIMQYPPPVHLSNSQTPIYGPLVPAHSSSATQQHHQMLVSKDEXXXXXXXXXXXXXXKVQSHPNVQQTNGANNLSTNNRTFYEIL 3277
            MDILNNFRKFKDLEENEKFYSYWTLDDDYSQSSLSTTSLSQDVDELKFIDDDSASSSSDEVYSLETSMIEMNCQDEKSPTETPGNSSQNRRYQHTPSPMVPRSSNFYDNDNFNDDTFLQLSNKGFAQSLGKQTFLQKKASENPSISTGFLSHLKDSKLFDPFLPSSSVENYNFHRKMIATDNWLERSFDLDAMDNEDLLSISSHGSDRSNTPVDMRNNASHNDETQKPFPEASNKNEETNLMQCQKIFNSNYVSLLKPKILQFTEAEDIGSLSPEEETQTFASANLEDDDDKSTLCGSDHGDKDEIEINAPSDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLRKNGNSYSDPILTQIPNNKSESAQNTLVNGKSTKKSKRTMRFPGIEKRNCNPSSQPASEKVKSKSKSSLQNSGNESVSSSLDIGSTGDTHIYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINSSKDSLDSSRSKINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARLNQQAFMDPYLVPVQYSQIPGSSPLFYNHQTNQFVPAVNCVQTNIPVFQYHPSYSVPPGSINNSIKELSEENISQTHIESQAPISNNNNNNIQPVIIRPTFTCNRSSRSQLGNNKRRRYRNIPTPQQVIMQYPPPVHLSNSQTPIYGPLVPAHSSSATQQHHQMLVSKDESSTSPTSSGNQTPTKVQSHPNVQQTNGANNLSTNNRTFYEIL
Sbjct:    1 MDILNNFRKFKDLEENEKFYSYWTLDDDYSQSSLSTTSLSQDVDELKFIDDDSASSSSDEVYSLETSMIEMNCQDEKSPTETPGNSSQNRRYQHTPSPMVPRSSNFYDNDNFNDDTFLQLSNKGFAQSLGKQTFLQKKASENPSISTGFLSHLKDSKLFDPFLPSSSVENYNFHRKMIATDNWLERSFDLDAMDNEDLLSISSHGSDRSNTPVDMRNNASHNDETQKPFPEASNKNEETNLMQCQKIFNSNYVSLLKPKILQFTEAEDIGSLSPEEETQTFASANLEDDDDKSTLCGSDHGDKDEIEINAPSDVFQEAIYHQPPKAADKSAAKRLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLRKNGNSYSDPILTQIPNNKSESAQNTLVNGKSTKKSKRTMRFPGIEKRNCNPSSQPASEKVKSKSKSSLQNSGNESVSSSLDIGSTGDTHIYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINSSKDSLDSSRSKINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARLNQQAFMDPYLVPVQYSQIPGSSPLFYNHQTNQFVPAVNCVQTNIPVFQYHPSYSVPPGSINNSIKELSEENISQTHIESQAPISNNNNNNIQPVIIRPTFTCNRSSRSQLGNNKRRRYRNIPTPQQVIMQYPPPVHLSNSQTPIYGPLVPAHSSSATQQHHQMLVSKDESSTSPTSSGNQTPTKVQSHPNVQQTNGANNLSTNNRTFYEIL 1050          
BLAST of PH and SEC7 domain-containing protein vs. Planmine SMEST
Match: SMESG000026134.1 (SMESG000026134.1)

HSP 1 Score: 175.637 bits (444), Expect = 8.097e-45
Identity = 148/539 (27.46%), Postives = 265/539 (49.17%), Query Frame = 2
Query: 1028 GDKDEIEINAPSDVFQEAIYHQPPKAADKSAAKRLAKRLY--HLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTALRKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALMLLNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIRWNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATS-KEYMSGYLLRKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKKRNAENDLRKNGNSYSDPILTQIPNNKSESAQNTLVNGKSTKKSKRTMRFPGIEKRNCNPSSQPAXXXXXXXXXXXLQNSGNESVSSSLDIGSTGDTHIYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLS-PPVFNINXXXXXXXXXXXXINPA-LTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIH-LHN 2626
            G++  + IN   +V+  ++         K++ + +AK L    +     + ++ +LS  +  S+ V  E     DFT   L  AL+ F  K  + G++QER+R++ HF+ R+++CNP+ Y  ++ACHT+VCA+MLLNTDLHG    RKM+C++F+ ++      + +   DLI ++N I +  ++ N  ++     + K   N I K   TN  +  + + S   + ++++SG ++RKCIK+S  +R  IG RGWKL F  L  L + L+K  ++              EN+ R   + +SD    ++    S  + + L N  S+                C   + P              +   E++S S++     D+ I ++H+FAS   +  K +N+F L++++ +EY F+V +  +++ WV+ +N+ AALLS PP+                + P  LT L+   Q++ H+  + + E  L  L      +    K K   +   KF + E+ R++TY  LL+ + +  LHN
Sbjct:  147 GNQIPVSINGNKEVYINSVSASNGSIISKTSTE-IAKDLLSDKVSRSNKATIASYLSNCDPNSKSVALEIMKQIDFTNIQLVEALQIFNKKVSVTGESQERDRILTHFTSRFLECNPSSYKDKDACHTIVCAIMLLNTDLHGQVSKRKMTCKEFIDNLLTNYPDNQYKESDLISIYNYIKKNELKNNNSDDGNNTIRRKFT-NFIIKPPKTNQESPMINMDSNLLNLQQFISGNIMRKCIKKSFGKRPGIGHRGWKLQFASLIGLQMLLFKTNLN--------------ENENRTGNDDFSD----RVSLTDSNLSSDLLHNDNSSV---------------CLSVNHPVKSISSKLP----SSCSRENLSVSVE---DVDSCIKIHHSFAS-VVEKLKHKNIFSLKLADQAEYFFKV-KSDQLNSWVNSINYAAALLSAPPIVGAG-----QCGFYKPLMPGYLTDLDKNAQIKIHETQLKSYEDSLKKL------QLASIKNKAAQDENIKFCQFEISRFETYINLLKSKSLQDLHN 630          
BLAST of PH and SEC7 domain-containing protein vs. Planmine SMEST
Match: SMESG000065299.1 (SMESG000065299.1)

HSP 1 Score: 157.147 bits (396), Expect = 1.231e-38
Identity = 94/233 (40.34%), Postives = 140/233 (60.09%), Query Frame = 2
Query: 2156 GDTHIYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARL----NQQAFMDPY--LVPVQYSQIPGSSPLFYNHQTNQFVPAVNCVQTNIPVFQYHPSYSVPPGSINNSI 2836
             D+ I+++HAFA++A DY KK+NVFR++   GSEYLFQVN  +E++ W+D +N+VAALLS P   I  S     SSRS   P +T+  I+ QLE+HQ+CVL LE+ +++L   PP KSDK + + +++   +F E+EL RYKTYS+LLEFE+  LHNMT  R     +   F  PY  +  +  S +  +  +  N Q    + +     TN  +F    +    P ++NN +
Sbjct:  642 ADSEIHIHHAFATRAVDYVKKKNVFRIKTKYGSEYLFQVNNEKEMENWIDNINYVAALLSDPEPIIGISTMEKLSSRSIPRPKITTFGIRNQLESHQKCVLELEKIISNLKENPPKKSDK-RNRMEFDESIRFREEELQRYKTYSQLLEFEIAKLHNMTNLRCMSGNDVPFFCQPYHSISGINQSLLIPNQGIILNQQLLNGISSSEGYMTNPILFNQPAALRFRPPALNNYV 873          
BLAST of PH and SEC7 domain-containing protein vs. Planmine SMEST
Match: SMESG000065299.1 (SMESG000065299.1)

HSP 1 Score: 157.147 bits (396), Expect = 1.231e-38
Identity = 94/233 (40.34%), Postives = 140/233 (60.09%), Query Frame = 2
Query: 2156 GDTHIYLNHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAALLSPPVFNINXXXXXXXXXXXXINPALTSLNIKEQLENHQRCVLNLEQDLNHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHNMTIARL----NQQAFMDPY--LVPVQYSQIPGSSPLFYNHQTNQFVPAVNCVQTNIPVFQYHPSYSVPPGSINNSI 2836
             D+ I+++HAFA++A DY KK+NVFR++   GSEYLFQVN  +E++ W+D +N+VAALLS P   I  S     SSRS   P +T+  I+ QLE+HQ+CVL LE+ +++L   PP KSDK + + +++   +F E+EL RYKTYS+LLEFE+  LHNMT  R     +   F  PY  +  +  S +  +  +  N Q    + +     TN  +F    +    P ++NN +
Sbjct:  639 ADSEIHIHHAFATRAVDYVKKKNVFRIKTKYGSEYLFQVNNEKEMENWIDNINYVAALLSDPEPIIGISTMEKLSSRSIPRPKITTFGIRNQLESHQKCVLELEKIISNLKENPPKKSDK-RNRMEFDESIRFREEELQRYKTYSQLLEFEIAKLHNMTNLRCMSGNDVPFFCQPYHSISGINQSLLIPNQGIILNQQLLNGISSSEGYMTNPILFNQPAALRFRPPALNNYV 870          
The following BLAST results are available for this feature:
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSD2.417e-6546.72pleckstrin and Sec7 domain containing [Source:HGNC... [more]
PSD7.915e-6445.95pleckstrin and Sec7 domain containing [Source:HGNC... [more]
PSD7.915e-6445.95pleckstrin and Sec7 domain containing [Source:HGNC... [more]
PSD31.887e-6344.80pleckstrin and Sec7 domain containing 3 [Source:HG... [more]
PSD22.024e-6246.94pleckstrin and Sec7 domain containing 2 [Source:HG... [more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efa-61.161e-3833.88Exchange factor for Arf-6 [Source:UniProtKB/Swiss... [more]
efa-61.268e-3833.88Exchange factor for Arf-6 [Source:UniProtKB/Swiss... [more]
efa-61.611e-3833.88Exchange factor for Arf-6 [Source:UniProtKB/Swiss... [more]
efa-61.773e-3833.88Exchange factor for Arf-6 [Source:UniProtKB/Swiss... [more]
agef-19.087e-1328.99Arf-1 Guanine nucleotide Exchange Factor homolog ... [more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Efa65.091e-7748.57gene:FBgn0051158 transcript:FBtr0113395[more]
Efa65.566e-7748.57gene:FBgn0051158 transcript:FBtr0113396[more]
Efa67.468e-7748.57gene:FBgn0051158 transcript:FBtr0334559[more]
Efa69.949e-7748.57gene:FBgn0051158 transcript:FBtr0302187[more]
Efa61.160e-7648.57gene:FBgn0051158 transcript:FBtr0334560[more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psda2.808e-6646.18pleckstrin and Sec7 domain containing a [Source:ZF... [more]
psda5.156e-6646.18pleckstrin and Sec7 domain containing a [Source:ZF... [more]
BX890597.19.865e-6646.18pleckstrin and Sec7 domain containing a [Source:NC... [more]
psda1.172e-6546.18pleckstrin and Sec7 domain containing a [Source:ZF... [more]
psd3l6.425e-6543.48pleckstrin and Sec7 domain containing 3, like [Sou... [more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSD34.592e-6546.40pleckstrin and Sec7 domain containing 3 [Source:NC... [more]
PSD34.971e-6448.00pleckstrin and Sec7 domain containing 3 [Source:NC... [more]
PSD37.593e-6347.58pleckstrin and Sec7 domain containing 3 [Source:NC... [more]
PSD35.904e-6247.58pleckstrin and Sec7 domain containing 3 [Source:NC... [more]
PSD33.067e-6147.18pleckstrin and Sec7 domain containing 3 [Source:NC... [more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Psd31.432e-6545.60pleckstrin and Sec7 domain containing 3 [Source:MG... [more]
Psd4.531e-6447.39pleckstrin and Sec7 domain containing [Source:MGI ... [more]
Psd6.811e-6447.39pleckstrin and Sec7 domain containing [Source:MGI ... [more]
Psd6.811e-6447.39pleckstrin and Sec7 domain containing [Source:MGI ... [more]
Psd32.104e-6345.60pleckstrin and Sec7 domain containing 3 [Source:MG... [more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E1JIT7|PSD_DROME7.486e-7648.57PH and SEC7 domain-containing protein OS=Drosophil... [more]
sp|Q9ESQ7|PSD1_RAT1.057e-6447.39PH and SEC7 domain-containing protein 1 OS=Rattus ... [more]
sp|Q5DTT2|PSD1_MOUSE3.169e-6347.39PH and SEC7 domain-containing protein 1 OS=Mus mus... [more]
sp|A5PKW4|PSD1_HUMAN3.801e-6345.95PH and SEC7 domain-containing protein 1 OS=Homo sa... [more]
sp|Q6P1I6|PSD2_MOUSE6.407e-6244.36PH and SEC7 domain-containing protein 2 OS=Mus mus... [more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7Q1C34.439e-8048.59Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A0L8FH996.063e-8047.51Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A1S3INW21.846e-7951.59PH and SEC7 domain-containing protein 2 isoform X3... [more]
A0A1S3IND92.558e-7951.59PH and SEC7 domain-containing protein 1 isoform X1... [more]
A0A1S3IPC62.790e-7951.59PH and SEC7 domain-containing protein 1 isoform X2... [more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psda3.358e-6846.18pleckstrin and Sec7 domain containing a [Source:ZF... [more]
psd3l5.155e-6745.82PH and SEC7 domain-containing protein 3 [Source:NC... [more]
ENSAMXT00000052239.11.211e-6647.18PH and SEC7 domain-containing protein 1 [Source:NC... [more]
psda1.160e-6546.18pleckstrin and Sec7 domain containing a [Source:ZF... [more]
psd3l6.441e-6545.82PH and SEC7 domain-containing protein 3 [Source:NC... [more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-283b15.42.262e-1931.25cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502][more]
iqsec1b1.368e-1531.88IQ motif and Sec7 domain ArfGEF 1b [Source:ZFIN;Ac... [more]
ENSPMAT00000001471.15.550e-1534.78pep scaffold:Pmarinus_7.0:GL477283:166775:173339:-... [more]
ENSPMAT00000007609.19.910e-1433.61pep scaffold:Pmarinus_7.0:GL477333:80854:108205:-1... [more]
psda8.907e-1328.07pleckstrin and Sec7 domain containing a [Source:ZF... [more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SEC74.204e-2029.00Guanine nucleotide exchange factor (GEF) for ADP r... [more]
GEA21.044e-733.98Guanine nucleotide exchange factor for ADP ribosyl... [more]
GEA11.126e-625.34Guanine nucleotide exchange factor for ADP ribosyl... [more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348127.925e-3934.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348826.708e-2235.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380043.673e-1731.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293692.653e-1234.41pep supercontig:ASM20922v1:NEMVEscaffold_1160:2485... [more]
EDO315384.406e-1231.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000003646.23.092e-6947.98PH and SEC7 domain-containing protein 1 [Source:NC... [more]
ENSORLT00000032974.19.483e-6947.98PH and SEC7 domain-containing protein 1 [Source:NC... [more]
ENSORLT00000045701.14.417e-6642.31PH and SEC7 domain-containing protein 1 [Source:NC... [more]
ENSORLT00000034031.11.185e-6447.01PH and SEC7 domain-containing protein 1 [Source:NC... [more]
psd23.566e-6346.18pleckstrin and Sec7 domain containing 2 [Source:NC... [more]
back to top
BLAST of PH and SEC7 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041617.10.000e+0100.00SMESG000041617.1[more]
SMESG000041617.10.000e+0100.00SMESG000041617.1[more]
SMESG000026134.18.097e-4527.46SMESG000026134.1[more]
SMESG000065299.11.231e-3840.34SMESG000065299.1[more]
SMESG000065299.11.231e-3840.34SMESG000065299.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013200 ID=SMED30013200|Name=PH and SEC7 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3509bp
TCTATATAAATCTTATATGAATAGAATTGACTTTAAATAATAATGGAATT
TTTCATTTATTCATTGATATAAATTAATGCAAATCTTGCTTTTTGTTGAA
CTGTGTAATCAATCGCTGTTTTCAAGTATGGATATTCTTAATAACTTTCG
AAAATTTAAAGATTTGGAAGAAAATGAAAAATTTTATTCTTATTGGACAT
TAGATGACGACTACAGTCAGTCAAGTCTTTCTACAACATCCTTATCTCAA
GACGTTGATGAATTAAAGTTTATTGATGATGACAGCGCAAGTTCATCATC
CGATGAAGTCTATTCACTGGAAACATCCATGATTGAAATGAATTGCCAAG
ACGAAAAATCTCCGACAGAAACTCCTGGAAATTCTTCTCAAAACCGTCGT
TATCAACACACTCCATCCCCAATGGTACCAAGATCTAGCAACTTTTACGA
CAATGATAACTTCAATGATGACACATTTCTCCAACTATCTAACAAAGGTT
TTGCTCAGAGTTTAGGAAAACAAACATTTTTACAGAAAAAGGCTTCAGAA
AATCCCAGTATTTCAACGGGATTTCTATCTCATTTGAAAGATAGTAAATT
GTTCGATCCGTTTTTACCATCTTCATCAGTTGAAAATTACAATTTCCATC
GAAAAATGATTGCAACCGACAATTGGCTTGAACGATCTTTCGATTTGGAT
GCCATGGATAATGAAGACCTATTAAGTATCAGTTCGCATGGATCCGATCG
TTCCAATACTCCAGTTGACATGCGCAATAACGCATCTCACAATGATGAGA
CACAGAAACCGTTTCCTGAAGCCAGCAATAAAAATGAAGAAACAAATTTA
ATGCAGTGCCAGAAAATATTCAATTCCAATTATGTTTCATTGTTAAAACC
GAAAATTCTTCAATTTACTGAAGCAGAGGATATTGGTTCTTTGTCACCGG
AAGAAGAAACTCAAACATTTGCAAGTGCCAATTTGGAAGATGATGATGAT
AAATCCACCCTTTGTGGTAGTGATCACGGAGATAAGGATGAAATAGAAAT
TAATGCTCCCAGTGATGTTTTTCAAGAAGCTATTTATCATCAACCCCCTA
AAGCAGCCGATAAATCTGCAGCAAAAAGATTAGCTAAGAGGCTATATCAT
TTAGATGGTTTCAAAATGAGTGATGTTTCGAAACATTTGAGTAAAAGAAA
TGATTTTAGTCAGTTAGTCGGTGAAGAGTTTGCCAATTTTTTCGATTTTA
CTGCCAACACACTCGATACAGCATTGCGCAAATTTCTGGCGAAATTCATT
TTGTGCGGAGACACGCAAGAACGCGAGAGAGTTATTCATCATTTCTCAAG
GAGATATGTCCAGTGCAATCCCAATGTATATAATTGTGAAGAAGCGTGCC
ATACTCTAGTTTGTGCTTTGATGCTTCTAAATACTGATCTCCATGGAAAT
AATATTAACAGAAAAATGAGCTGCGAAGATTTCGTAGTCAGCATGGCAGA
ATTGAACAATGGCGATCATTTCGACCGCGAAGATTTAATTATGTTGTTTA
ATTCAATTTTGGAGAAGCCAATTAGATGGAATATTGACAATGAGCTCATA
GGTTTGTTTCAACCGAAACTCGATTACAACGATATAAACAAACAAATTCA
TACGAATCATTTAAATTTGTTTCTTGAGGTACCATCAGAAGCTACCAGTA
AGGAGTATATGAGCGGATATTTGTTACGGAAATGTATTAAAGAATCTCAT
TATCGAAGAACGAGTATTGGAAAACGAGGATGGAAGCTATATTTCGGTCG
TTTACAAGATCTTACTCTTCATCTTTACAAAGATGAGATTTCTGTGAATG
GCAGTTTCAAACGAACAGTAAAGAAAAGAAATGCTGAAAATGACCTCCGT
AAAAATGGAAACAGCTATTCCGATCCGATTTTAACTCAAATTCCAAATAA
TAAATCGGAATCAGCACAAAATACTCTGGTAAACGGGAAAAGCACGAAAA
AATCTAAGCGAACCATGAGATTTCCAGGTATAGAAAAGCGTAATTGCAAT
CCCTCTTCTCAGCCTGCTTCGGAAAAAGTGAAGTCCAAATCTAAATCGAG
CTTACAAAACTCAGGAAACGAATCTGTAAGCTCGAGCTTGGATATCGGTT
CAACGGGCGATACACATATCTATTTGAATCACGCTTTTGCGTCAAAAGCT
ACAGATTACAGTAAAAAACGAAATGTTTTTCGACTCCAAGTTAGCAATGG
AAGCGAATATTTGTTTCAAGTGAACGAGCCGAGAGAGGTGGATTTGTGGG
TTGATTGTCTAAATTTCGTTGCTGCACTTCTTTCGCCTCCTGTGTTTAAT
ATTAACAGCAGCAAGGATTCTTTGGACTCTTCCAGGAGTAAAATTAATCC
AGCTCTTACTTCATTGAACATAAAGGAACAATTAGAGAACCATCAGAGAT
GCGTTCTTAATCTTGAGCAAGATTTGAATCATCTTTCTTCAAAGCCACCA
TGCAAATCTGATAAAACAAAGCTTAAATGGCAATATAATCGGCAACGTAA
ATTCATTGAGAAAGAACTTCTTCGATACAAAACTTATTCGAGACTTTTAG
AATTTGAAATGATCCATTTACATAACATGACAATTGCTAGATTAAACCAA
CAAGCATTTATGGATCCATATCTGGTTCCCGTTCAGTATTCTCAAATTCC
AGGATCTTCTCCGCTTTTCTACAATCATCAAACCAATCAATTTGTTCCAG
CGGTTAATTGTGTTCAGACAAACATACCAGTCTTTCAGTACCATCCTTCC
TATAGCGTACCTCCTGGATCTATAAACAACTCTATTAAAGAATTATCTGA
GGAAAATATTTCACAAACTCATATTGAGTCACAAGCTCCAATTAGCAACA
ACAACAATAATAATATTCAACCAGTGATCATCCGACCCACTTTCACATGC
AATCGTAGCTCAAGATCACAGCTTGGAAATAATAAACGTCGTCGTTATCG
AAACATTCCCACACCGCAACAAGTTATAATGCAATATCCGCCACCTGTTC
ACCTGTCGAATTCACAGACACCAATATATGGACCTCTGGTCCCCGCTCAT
TCTAGTTCCGCAACTCAACAGCATCATCAGATGTTGGTTAGCAAAGACGA
ATCATCGACATCTCCGACGAGCTCAGGTAACCAAACACCGACAAAAGTCC
AGTCACATCCTAACGTTCAACAAACGAATGGTGCCAACAATCTATCAACA
AACAATAGAACTTTCTATGAAATACTGTGATGCCGACACAGTTTACTCTT
AGATGATTTAATTAAGTATTTTAAAGGAGGAATAATATTCTTTATATAAA
TATGAAATAAATAATGAAATAAATGCATATTTTCTACCTCGAGCTATTCT
GATAACGACATTCATTTAGTTATGATATAATTTTATGGCAAATACGATCT
CAATGCAGAAAATGCTATTTATTTGTAATAATACTTTTGTTATTGTTATT
ATATTACTA
back to top

protein sequence of SMED30013200-orf-1

>SMED30013200-orf-1 ID=SMED30013200-orf-1|Name=SMED30013200-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1068bp
MQILLFVELCNQSLFSSMDILNNFRKFKDLEENEKFYSYWTLDDDYSQSS
LSTTSLSQDVDELKFIDDDSASSSSDEVYSLETSMIEMNCQDEKSPTETP
GNSSQNRRYQHTPSPMVPRSSNFYDNDNFNDDTFLQLSNKGFAQSLGKQT
FLQKKASENPSISTGFLSHLKDSKLFDPFLPSSSVENYNFHRKMIATDNW
LERSFDLDAMDNEDLLSISSHGSDRSNTPVDMRNNASHNDETQKPFPEAS
NKNEETNLMQCQKIFNSNYVSLLKPKILQFTEAEDIGSLSPEEETQTFAS
ANLEDDDDKSTLCGSDHGDKDEIEINAPSDVFQEAIYHQPPKAADKSAAK
RLAKRLYHLDGFKMSDVSKHLSKRNDFSQLVGEEFANFFDFTANTLDTAL
RKFLAKFILCGDTQERERVIHHFSRRYVQCNPNVYNCEEACHTLVCALML
LNTDLHGNNINRKMSCEDFVVSMAELNNGDHFDREDLIMLFNSILEKPIR
WNIDNELIGLFQPKLDYNDINKQIHTNHLNLFLEVPSEATSKEYMSGYLL
RKCIKESHYRRTSIGKRGWKLYFGRLQDLTLHLYKDEISVNGSFKRTVKK
RNAENDLRKNGNSYSDPILTQIPNNKSESAQNTLVNGKSTKKSKRTMRFP
GIEKRNCNPSSQPASEKVKSKSKSSLQNSGNESVSSSLDIGSTGDTHIYL
NHAFASKATDYSKKRNVFRLQVSNGSEYLFQVNEPREVDLWVDCLNFVAA
LLSPPVFNINSSKDSLDSSRSKINPALTSLNIKEQLENHQRCVLNLEQDL
NHLSSKPPCKSDKTKLKWQYNRQRKFIEKELLRYKTYSRLLEFEMIHLHN
MTIARLNQQAFMDPYLVPVQYSQIPGSSPLFYNHQTNQFVPAVNCVQTNI
PVFQYHPSYSVPPGSINNSIKELSEENISQTHIESQAPISNNNNNNIQPV
IIRPTFTCNRSSRSQLGNNKRRRYRNIPTPQQVIMQYPPPVHLSNSQTPI
YGPLVPAHSSSATQQHHQMLVSKDESSTSPTSSGNQTPTKVQSHPNVQQT
NGANNLSTNNRTFYEIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR041681PH_9
IPR035999Sec7_dom_sf
IPR000904Sec7_dom
IPR001849PH_domain
IPR023394Sec7_C_sf
IPR011993PH-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0032012regulation of ARF protein signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: molecular function
TermDefinition
GO:0005086ARF guanyl-nucleotide exchange factor activity
GO:0005543phospholipid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 786..806
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1008..1067
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 601..688
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 608..640
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 655..688
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 91..120
NoneNo IPR availablePANTHERPTHR10663:SF337PH AND SEC7 DOMAIN-CONTAINING PROTEIN 3coord: 340..590
coord: 699..845
NoneNo IPR availablePANTHERPTHR10663GUANYL-NUCLEOTIDE EXCHANGE FACTORcoord: 699..845
NoneNo IPR availablePANTHERPTHR10663GUANYL-NUCLEOTIDE EXCHANGE FACTORcoord: 340..590
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 545..757
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 543..752
e-value: 5.8E-8
score: 42.4
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 542..750
score: 8.83
IPR000904Sec7 domainSMARTSM00222sec7_5coord: 315..499
e-value: 2.2E-37
score: 140.2
IPR000904Sec7 domainPFAMPF01369Sec7coord: 346..499
e-value: 1.2E-36
score: 126.1
IPR000904Sec7 domainPROSITEPS50190SEC7coord: 320..497
score: 20.164
IPR000904Sec7 domainCDDcd00171Sec7coord: 337..499
e-value: 6.67783E-50
score: 172.407
IPR041681Pleckstrin homology domain 9PFAMPF15410PH_9coord: 695..750
e-value: 9.1E-19
score: 68.0
IPR023394Sec7, C-terminal domain superfamilyGENE3DG3DSA:1.10.1000.11coord: 391..510
e-value: 1.4E-34
score: 120.5
IPR035999Sec7 domain superfamilySUPERFAMILYSSF48425Sec7 domaincoord: 346..504