SMED30013198

Overview
NameSMED30013198
Smed IDSMED30013198
Length (bp)1259
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30013198 (SMED30013198) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30013198 (SMED30013198) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013198

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013198SMESG000057605.1 dd_Smed_v4_24714_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013198SMESG000057605.1 dd_Smed_v6_24714_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30013198 vs. TrEMBL
Match: S9W8G9 (Ubiquitin carboxyl-terminal hydrolase OS=Schizosaccharomyces cryophilus (strain OY26 / ATCC MYA-4695 / CBS 11777 / NBRC 106824 / NRRL Y48691) OX=653667 GN=SPOG_04058 PE=3 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 4.017e-6
Identity = 66/307 (21.50%), Postives = 123/307 (40.07%), Query Frame = 1
Query:  355 GLVGLKKRNQECCINSIAQALASSTKI-------IEQFHEVKSHIPFCIALQILLELIAGLNQRFPFSNLEENTNLIKKLAKNIKWSQKSQQDGYGLLSAIIQGIHQEMK-EVKIEIEYPLRIDMVNKMSGLDTQNTIQSQ-------IGLSIELAGPYNVYPGVTLDYLIQNHFSPFVIDGDPSSTSQVLFLSRTPTSLLFHIQLDKYHDKK-QQTLRLDYFIAYSEFLSLEFNLVLDIDCGEVIKEKVDYKLVAVIERKEELSGSHYRTYRKFEGNWILADDERIIYVEFT--CHVQPYILIYEK 1221
            GL G++     C ++ I Q+   +  +          F   K       A+  +   +    ++  F       NL+ K++K++  S  SQQDG+  L  ++  +H E   +     + P+       M  + T +  ++Q       + +S++L  P     G    Y+   H      D    + ++ LF  + P +L   +QL ++       + ++D  I Y   L +++N   D          VDY+L +++  K  L   HY  Y  F+ +W L DD  I  V  +   + Q Y+L Y +
Sbjct:  144 GLRGIQNLGATCFMSVILQSTLHNPLLRNLFLSGFHTFETCKRSSCMTCAIDNMFASVYASKEKTSFYGPTVILNLMWKMSKSL--SGYSQQDGHEFLVYLLDQMHSESGGDNSFPCKCPIHKIFSGSMKNVITCSECKTQKVATDPLMEVSLDLHEP--SIQGCLERYISPEHIQYTCSDCSAKTATKQLFFDKLPPTLC--LQLKRFEQNSFAISTKVDKVITYPMLLKMQYNFNQD---------SVDYQLYSIVCHKGTLDTGHYIAYTLFQDHWYLLDDTTITVVSESEVLNTQAYLLFYHE 435          
BLAST of SMED30013198 vs. Planmine SMEST
Match: SMESG000057605.1 (SMESG000057605.1)

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 355/361 (98.34%), Postives = 357/361 (98.89%), Query Frame = 1
Query:  142 MTPQLDXXXXXXXXXXXXXXXXFCLFLYCVCNREDFERPNQHLYREISYKSLYDSESESSMHQKIGNINECGLVGLKKRNQECCINSIAQALASSTKIIEQFHEVKSHIPFCIALQILLELIAGLNQRFPFSNLEENTNLIKKLAKNIKWSQKSQQDGYGLLSAIIQGIHQEMKEVKIEIEYPLRIDMVNKMSGLDTQNTIQSQIGLSIELAGPYNVYPGVTLDYLIQNHFSPFVIDGDPSSTSQVLFLSRTPTSLLFHIQLDKYHDKKQQTLRLDYFIAYSEFLSLEFNLVLDIDCGEVIKEKVDYKLVAVIERKEELSGSHYRTYRKFEGNWILADDERIIYVEFTCHVQPYILIYEKL 1224
            MTPQLDGGIIAVTVILLIVLVGFCLFLYCVCNREDFERPN+HLYREISYKSLYDSESESSMHQKIGNINECGLVGLKKRNQECCINSI QALASSTKIIEQFHEVKSHIPFCIALQILLELIAGLNQRFPFSNLEENTNLIKKLAKNIKWSQKSQQDGYGLLSAIIQGIHQEMKEVKIEIEYPLRIDMVNKMSGLDTQNTIQ+QIGLSIELAGPYNVYPGVTLDYLIQNHFSP VIDGDPSSTSQVLFL RTPTSLLFHIQLDKYHDKKQQTLRLDYFIAYSEFLSLEFNLV DIDCGEVIKEKVDYKLVAVIERKEELSGSHYRTYRKFEGNWILADDERIIYVEFTCHVQPYILIYEKL
Sbjct:    1 MTPQLDGGIIAVTVILLIVLVGFCLFLYCVCNREDFERPNEHLYREISYKSLYDSESESSMHQKIGNINECGLVGLKKRNQECCINSIVQALASSTKIIEQFHEVKSHIPFCIALQILLELIAGLNQRFPFSNLEENTNLIKKLAKNIKWSQKSQQDGYGLLSAIIQGIHQEMKEVKIEIEYPLRIDMVNKMSGLDTQNTIQTQIGLSIELAGPYNVYPGVTLDYLIQNHFSPSVIDGDPSSTSQVLFLGRTPTSLLFHIQLDKYHDKKQQTLRLDYFIAYSEFLSLEFNLVSDIDCGEVIKEKVDYKLVAVIERKEELSGSHYRTYRKFEGNWILADDERIIYVEFTCHVQPYILIYEKL 361          
BLAST of SMED30013198 vs. Planmine SMEST
Match: SMESG000057792.1 (SMESG000057792.1)

HSP 1 Score: 219.935 bits (559), Expect = 6.596e-68
Identity = 111/289 (38.41%), Postives = 177/289 (61.25%), Query Frame = 1
Query:  364 GLKKRNQECCINSIAQALASSTKIIEQFHEVKSHIPFCIALQILLELIAGLNQ-RFPFSNLEENTNLIKKLAKNIKWSQKSQQDGYGLLSAIIQGIHQEMKEVKIE-IEYPLRIDMVNKMSGLDTQNTIQSQIGLSIELAGPYNVYPGVTLDYLIQNHFSPFVIDGDPSSTSQVLFLSRTPTSLLFHIQLDKYHDKKQQTLRLDYFIAYSEFLSLEFNLVLDIDCGEVIKEKVDYKLVAVIERKEELSGSHYRTYRKFEGNWILADDERIIYVEFTCHVQPYILIYEKL 1224
            G K   + C +N+I QA ASS  +I QF  +       ++L+   +++ G+N     +  L +NTN ++ L + + W++ +QQD + L +A+I+GI  E K   I+ IE PL++ MV +  GLD  +  Q  +GLS+ L+GPY   PGVTL++LI  HFSP +IDGDP+ TSQ+ FL   P  LL HIQ +K+   K++ ++  Y I Y + +++ F+++  ++   V +  V Y+L AV++    +SG HY  YRK+  NW L  DE++  +EF+ ++ PYILIYEK+
Sbjct:   66 GFKNLAETCYMNAIIQAAASSQILISQFQHLHETYKESMSLKCFYDVLIGVNTPDDSYVRLCKNTNQLETLIRLVNWTKTNQQDAFELFTALIKGISDEFKAQNIDDIEMPLKLKMVYRFKGLDIPDRTQYHLGLSLGLSGPYETKPGVTLEFLILEHFSPTLIDGDPNKTSQLFFLKGAPDVLLLHIQANKWDSVKEKMIKPKYHIVYDQEMTIWFDIITALNKDNVKRISVTYRLTAVVQHMGTISGGHYVAYRKWRNNWYLVSDEQVELMEFSGNICPYILIYEKI 354          
BLAST of SMED30013198 vs. Planmine SMEST
Match: SMESG000057791.1 (SMESG000057791.1)

HSP 1 Score: 196.823 bits (499), Expect = 1.691e-59
Identity = 108/316 (34.18%), Postives = 178/316 (56.33%), Query Frame = 1
Query:  322 MHQKIGNINE-------CGLVGLKKR-------NQECCINSIAQALASSTKIIEQFHEVKSHIPFCIALQILLELIAGLNQRFPFS-NLEENTNLIKKLAKNIKWSQKSQQDGYGLLSAIIQGIHQEMKEVKIEIEYPLRIDMVNKMSGLDTQNTIQSQIGLSIELAGPYNVYPGVTLDYLIQNHFSPFVIDGDPSSTSQVLFLSRTPTSLLFHIQLDKYHDKKQQTLRLDYFIAYSEFLSLEFNLVLDIDCGEVIKEKVDYKLVAVIERKEELSGSHYRTYRKFEGNWILADDERIIYVEFTCHVQPYILIYEKL 1224
            MH+   NI++       C      KR       + +C + S+ QA+A+S  +I QF ++    P C +L  L++L+ G+ ++  +  N  ENT ++ +L   IKW++ SQQD + +++AI + I   +K +  +   P++I +++   G+D  N IQ+ +GLS+ L G Y+  PGV L+YLI  HF P +IDG+P+ TS +    + P  LL HIQ +K+ D     ++  Y+I Y E ++L  ++  D+   +V ++K+ Y L +V+     +S  HY TYR F G W   DDE +  ++F   + PYILIYEKL
Sbjct:    1 MHKNPKNISKTSCCNLLCSFTCRNKRPGSIYNTSSKCYMISVIQAIAASDILIAQFEDIYDKYPNCSSLGYLIDLLRGVIRKGRYKKNRSENTQILNQLILEIKWNKCSQQDAFEIMTAIWKSISDNLK-IYGKFFLPMKIKLIHSFKGIDVTNKIQNYLGLSLGLCGNYHERPGVILEYLIDQHFQPSLIDGNPNKTSNITIYEKAPEILLLHIQANKWDDFSGVMVKPIYYILYEENMTLWLDIAQDLMRNKVHRQKLVYNLKSVVSHSGNISQGHYVTYRTFRGKWFKVDDETVTEIQFDKKISPYILIYEKL 315          
BLAST of SMED30013198 vs. Planmine SMEST
Match: SMESG000057791.1 (SMESG000057791.1)

HSP 1 Score: 193.741 bits (491), Expect = 7.251e-59
Identity = 100/276 (36.23%), Postives = 164/276 (59.42%), Query Frame = 1
Query:  400 SIAQALASSTKIIEQFHEVKSHIPFCIALQILLELIAGLNQRFPFS-NLEENTNLIKKLAKNIKWSQKSQQDGYGLLSAIIQGIHQEMKEVKIEIEYPLRIDMVNKMSGLDTQNTIQSQIGLSIELAGPYNVYPGVTLDYLIQNHFSPFVIDGDPSSTSQVLFLSRTPTSLLFHIQLDKYHDKKQQTLRLDYFIAYSEFLSLEFNLVLDIDCGEVIKEKVDYKLVAVIERKEELSGSHYRTYRKFEGNWILADDERIIYVEFTCHVQPYILIYEKL 1224
            S+ QA+A+S  +I QF ++    P C +L  L++L+ G+ ++  +  N  ENT ++ +L   IKW++ SQQD + +++AI + I   +K +  +   P++I +++   G+D  N IQ+ +GLS+ L G Y+  PGV L+YLI  HF P +IDG+P+ TS +    + P  LL HIQ +K+ D     ++  Y+I Y E ++L  ++  D+   +V ++K+ Y L +V+     +S  HY TYR F G W   DDE +  ++F   + PYILIYEKL
Sbjct:    3 SVIQAIAASDILIAQFEDIYDKYPNCSSLGYLIDLLRGVIRKGRYKKNRSENTQILNQLILEIKWNKCSQQDAFEIMTAIWKSISDNLK-IYGKFFLPMKIKLIHSFKGIDVTNKIQNYLGLSLGLCGNYHERPGVILEYLIDQHFQPSLIDGNPNKTSNITIYEKAPEILLLHIQANKWDDFSGVMVKPIYYILYEENMTLWLDIAQDLMRNKVHRQKLVYNLKSVVSHSGNISQGHYVTYRTFRGKWFKVDDETVTEIQFDKKISPYILIYEKL 277          
BLAST of SMED30013198 vs. Planmine SMEST
Match: SMESG000057804.1 (SMESG000057804.1)

HSP 1 Score: 188.734 bits (478), Expect = 9.260e-56
Identity = 109/289 (37.72%), Postives = 168/289 (58.13%), Query Frame = 1
Query:  364 GLKKRNQECCINSIAQALASSTKIIEQFHEVKSHIPFC-IALQILLELIAGLNQRFPFSNLEENTNLIKKLAKNIKWSQKSQQDGYGLLSAIIQGIHQEMKEVK-IEIEYPLRIDMVNKMSGLDTQNTIQSQIGLSIELAGPYNVYPGVTLDYLIQNHFSPFVIDGDPSSTSQVLFLSRTPTSLLFHIQLDKYHDKKQQTLRLDYFIAYSEFLSLEFNLVLDIDCGEVIKE-KVDYKLVAVIERKEELSGSHYRTYRKFEGNWILADDERIIYVEFTCHVQPYILIYEK 1221
            GLK  +  C +NS+ QALASS  +I+    ++ +       L I +EL+  +N     SN++ N+ L+ KL   I+W +  QQD +  LS I+  I +E++ +K  EIE PL+  M+    G++ +N +Q   G+ I L G ++ +PGV L+ LI ++F P  ID +PS TSQ+ F    PT LL HIQ +K+ + +Q+ ++ +Y+I Y   L L  NL +  D G+ IKE + +Y+L AV+     +S  HY  YRK    W L  DE++  V+F C V PY+LI+EK
Sbjct:   91 GLKNLDLICYMNSVIQALASSNHLIKMLKTLQQYTQNTENVLDIFIELLTDVNNSR--SNVDHNSKLLLKLIDKIEWQKFDQQDAFDFLSKIMSSIQKEVENIKGDEIEIPLKTKMIYIFKGIEMKNQVQYHFGIPIGLFGDFSNFPGVKLEDLINSYFDPVTIDDEPSKTSQIYFCKEAPTILLLHIQANKWDNDQQKMIKPEYYIQYHHKLGL--NLKISDDLGKEIKEGETNYELCAVVHHMGNISSGHYVVYRKCSTIWYLLSDEQVSQVKFDCDVCPYLLIFEK 375          
The following BLAST results are available for this feature:
BLAST of SMED30013198 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013198 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013198 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013198 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013198 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013198 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013198 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013198 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
S9W8G94.017e-621.50Ubiquitin carboxyl-terminal hydrolase OS=Schizosac... [more]
back to top
BLAST of SMED30013198 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013198 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013198 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013198 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013198 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013198 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057605.10.000e+098.34SMESG000057605.1[more]
SMESG000057792.16.596e-6838.41SMESG000057792.1[more]
SMESG000057791.11.691e-5934.18SMESG000057791.1[more]
SMESG000057791.17.251e-5936.23SMESG000057791.1[more]
SMESG000057804.19.260e-5637.72SMESG000057804.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013198 ID=SMED30013198|Name=SMED30013198|organism=Schmidtea mediterranea sexual|type=transcript|length=1259bp
TATTGACTCAATTTGATTTTTTCAGCACTCGATCAAACTTACTCAACAAG
AAATCGGTTAAAGCATCACGGAATAATAATTATTGATTTCTTTACAGTGG
ACAAAAAGTACCAATAAAATATTAATTGATAAGGACACAAAATGACACCT
CAACTTGACGGAGGTATAATAGCAGTCACGGTCATACTTTTGATAGTATT
AGTTGGATTCTGTCTTTTCCTTTATTGCGTATGTAACAGAGAAGACTTCG
AACGACCAAATCAACACCTATATCGTGAAATCAGTTATAAATCCTTATAT
GACAGTGAATCTGAAAGCTCTATGCACCAGAAAATTGGAAATATCAATGA
ATGTGGATTAGTGGGATTAAAGAAAAGGAACCAGGAATGCTGTATAAATT
CGATTGCCCAAGCTCTTGCATCTAGCACTAAGATCATTGAACAATTCCAC
GAAGTGAAATCGCACATTCCATTCTGTATAGCATTGCAAATCCTTCTCGA
ACTTATAGCAGGCCTAAATCAGAGATTTCCTTTCTCAAATTTGGAAGAAA
ATACAAATTTAATAAAAAAGTTGGCTAAGAATATAAAGTGGAGCCAAAAG
TCTCAACAGGACGGATACGGGCTCCTGTCGGCTATAATCCAAGGTATCCA
TCAGGAAATGAAGGAAGTAAAAATTGAGATAGAATATCCTTTGAGGATAG
ACATGGTAAATAAAATGAGTGGACTAGATACCCAAAATACAATTCAAAGC
CAAATAGGGTTATCAATTGAACTGGCTGGCCCTTATAATGTTTATCCTGG
AGTTACGTTGGATTATCTCATTCAGAATCATTTCTCTCCATTTGTTATTG
ACGGTGATCCATCGTCAACTTCTCAAGTACTTTTCTTGAGCCGGACTCCA
ACTTCTTTACTCTTCCATATTCAATTGGACAAATATCACGATAAAAAGCA
ACAAACGTTGAGATTGGATTATTTTATTGCATATTCCGAATTTTTGTCAT
TGGAATTCAATCTTGTTTTGGATATAGATTGTGGCGAAGTAATTAAAGAG
AAAGTTGATTATAAATTGGTGGCTGTCATCGAACGCAAAGAAGAACTTTC
AGGAAGTCACTATAGAACCTATCGAAAATTCGAAGGAAACTGGATTTTAG
CGGATGATGAACGTATTATATATGTTGAATTCACTTGTCACGTCCAACCT
TACATTTTAATTTATGAAAAGTTGTGATAGAAATACAAAAATAATATTTG
TTTGCACAA
back to top

protein sequence of SMED30013198-orf-1

>SMED30013198-orf-1 ID=SMED30013198-orf-1|Name=SMED30013198-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=362bp
MTPQLDGGIIAVTVILLIVLVGFCLFLYCVCNREDFERPNQHLYREISYK
SLYDSESESSMHQKIGNINECGLVGLKKRNQECCINSIAQALASSTKIIE
QFHEVKSHIPFCIALQILLELIAGLNQRFPFSNLEENTNLIKKLAKNIKW
SQKSQQDGYGLLSAIIQGIHQEMKEVKIEIEYPLRIDMVNKMSGLDTQNT
IQSQIGLSIELAGPYNVYPGVTLDYLIQNHFSPFVIDGDPSSTSQVLFLS
RTPTSLLFHIQLDKYHDKKQQTLRLDYFIAYSEFLSLEFNLVLDIDCGEV
IKEKVDYKLVAVIERKEELSGSHYRTYRKFEGNWILADDERIIYVEFTCH
VQPYILIYEKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR001394Peptidase_C19_UCH
IPR028889USP_dom
Vocabulary: molecular function
TermDefinition
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0016579protein deubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001394Peptidase C19, ubiquitin carboxyl-terminal hydrolasePFAMPF00443UCHcoord: 75..358
e-value: 3.2E-14
score: 53.1
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 74..361
e-value: 1.2E-22
score: 82.7
NoneNo IPR availablePANTHERPTHR21646FAMILY NOT NAMEDcoord: 57..360
NoneNo IPR availableCDDcd02257Peptidase_C19coord: 154..359
e-value: 1.07512E-11
score: 62.1154
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR028889Ubiquitin specific protease domainPROSITEPS50235USP_3coord: 74..361
score: 20.19
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 71..360