cGMP-dependent protein kinase

Overview
NamecGMP-dependent protein kinase
Smed IDSMED30013197
Length (bp)2490
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cGMP-dependent protein kinase (SMED30013197) t-SNE clustered cells

Violin plots show distribution of expression levels for cGMP-dependent protein kinase (SMED30013197) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cGMP-dependent protein kinase (SMED30013197) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cGMP-dependent protein kinase (SMED30013197) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013197

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013197SMESG000074822.1 SmedASXL_014045SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013197SMESG000074822.1 dd_Smed_v4_15474_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013197SMESG000074822.1 dd_Smed_v4_15474_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG1 (protein kinase cGMP-dependent 1 [Source:HGNC Symbol;Acc:HGNC:9414])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 311/693 (44.88%), Postives = 442/693 (63.78%), Query Frame = 2
Query:  371 VLSQEIEELHKR---ITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESFS-----LSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNF-VPLDETSGWDDEF 2422
             L ++IEEL +R   I E +  + Q    +  L+   DK +SV+   +Q  +  +    +   R+K+Q +  E  +     LS + +  + KS  +  LI+ AI    +DF+K LE  QI++I  CMY      +  II+EG+ G  +YV+  GK+EV K+G KL  M PG++FGELA+L NC RTA+VK +     W I+R+ +Q I+ ++ + +  EY +FL+SV  F+SL ++ L+K+ D L    Y  GEYI+++G  G TF+II  G V V +      +P  +RTL  GD+FGE+AL  E++RTA+VIA ++ V  L++DR+ F  LIG   ++++K YED + K +  +     +  K +                +I TLGVGGFG+VELV+ K++ S  FA+K L K++IV+ +Q+EHI SE++I+      FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  F+D  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP+ERLG  K+G+  I  HK+F GFNWE L    +TP IIP + +  DT  FD F E N   P D+ SGWD +F
Sbjct:   10 ALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAI--LDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIA-AEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSD-------------FNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 686          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 311/715 (43.50%), Postives = 464/715 (64.90%), Query Frame = 2
Query:  386 IEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKS----QVVEDNT---LHRSESNL------RSKKQVVYGESFSLS---------SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIG---------QNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXX-----LEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            ++EL ++++++   I +LT E+ +     +K++ V++ +     Q   D     +HR  S L      R  K  V  E  + +         S E     K  S   LI  A+   Q  FLK+L+ QQIK + +CMY +  +   YII++GEPG H++VLA G++EV +  K L  +     FGELA+L NC RTASVKA+T    W ++R+V+Q I++++   + E+Y+ FL+SV+L K+L +D+LTKI+D L +E Y  G+YI++EGEEG TF+I+  GKVKV Q+ +G  +PQ I+TL  G+YFGE+AL+ +++R+A++IA+ ++V  L++DRE F + +G         + Y  N    ++ +  K+  S   +       +I   +      +      LE+I+TLGVGGFG+VELV+ KN++ + FA+K + K++IV+ KQ+EH+ SE++IL E+  PFI +LY+TF+DNKYVY+L+EACLGGE+W+ LR++  FD+  +KF +     A  YLH   IIYRDL+PEN++ D  G++KL DFGFAK IG+G+KT+TFCGTPEYVAPE+ILNKGHD SVD W++GIL +ELLTG+PPF G + M+ YN ILKG+EK++F RKI R    LI+ LC+ NPTERLG  K+GI+ I  H++  GFNWE L ++ +   +  +L+  ID  YFD++  +  +P DE SGWD +F
Sbjct:   51 LKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQ--FLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNEN-VAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 311/715 (43.50%), Postives = 464/715 (64.90%), Query Frame = 2
Query:  386 IEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKS----QVVEDNT---LHRSESNL------RSKKQVVYGESFSLS---------SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIG---------QNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXX-----LEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            ++EL ++++++   I +LT E+ +     +K++ V++ +     Q   D     +HR  S L      R  K  V  E  + +         S E     K  S   LI  A+   Q  FLK+L+ QQIK + +CMY +  +   YII++GEPG H++VLA G++EV +  K L  +     FGELA+L NC RTASVKA+T    W ++R+V+Q I++++   + E+Y+ FL+SV+L K+L +D+LTKI+D L +E Y  G+YI++EGEEG TF+I+  GKVKV Q+ +G  +PQ I+TL  G+YFGE+AL+ +++R+A++IA+ ++V  L++DRE F + +G         + Y  N    ++ +  K+  S   +       +I   +      +      LE+I+TLGVGGFG+VELV+ KN++ + FA+K + K++IV+ KQ+EH+ SE++IL E+  PFI +LY+TF+DNKYVY+L+EACLGGE+W+ LR++  FD+  +KF +     A  YLH   IIYRDL+PEN++ D  G++KL DFGFAK IG+G+KT+TFCGTPEYVAPE+ILNKGHD SVD W++GIL +ELLTG+PPF G + M+ YN ILKG+EK++F RKI R    LI+ LC+ NPTERLG  K+GI+ I  H++  GFNWE L ++ +   +  +L+  ID  YFD++  +  +P DE SGWD +F
Sbjct:   51 LKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQ--FLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNEN-VAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG1 (protein kinase cGMP-dependent 1 [Source:HGNC Symbol;Acc:HGNC:9414])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 309/682 (45.31%), Postives = 435/682 (63.78%), Query Frame = 2
Query:  380 QEIEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNF-VPLDETSGWDDEF 2422
            + I+EL KR++EK+        E+ +L++   K +SVL   S  +   T       + ++ Q     SF       +   KSE +  LI+ AI    +DF+K LE  QI++I  CMY      +  II+EG+ G  +YV+  GK+EV K+G KL  M PG++FGELA+L NC RTA+VK +     W I+R+ +Q I+ ++ + +  EY +FL+SV  F+SL ++ L+K+ D L    Y  GEYI+++G  G TF+II  G V V +      +P  +RTL  GD+FGE+AL  E++RTA+VIA ++ V  L++DR+ F  LIG   ++++K YED + K +  +     +  K +                +I TLGVGGFG+VELV+ K++ S  FA+K L K++IV+ +Q+EHI SE++I+      FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  F+D  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP+ERLG  K+G+  I  HK+F GFNWE L    +TP IIP + +  DT  FD F E N   P D+ SGWD +F
Sbjct:   17 ERIKELEKRLSEKE-------EEIQELKRKLHKCQSVLPVPSTHIGPRTTR--AQGISAEPQTY--RSFHDLRQAFRKFTKSERSKDLIKEAI--LDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIA-AEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSD-------------FNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Match: PRKG2 (protein kinase cGMP-dependent 2 [Source:HGNC Symbol;Acc:HGNC:9416])

HSP 1 Score: 533.487 bits (1373), Expect = 9.572e-179
Identity = 302/701 (43.08%), Postives = 453/701 (64.62%), Query Frame = 2
Query:  386 IEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKS----QVVEDNT---LHRSESNL------RSKKQVVYGESFSLS---------SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            ++EL ++++++   I +LT E+ +     +K++ V++ +     Q   D     +HR  S L      R  K  V  E  + +         S E     K  S   LI  A+   Q  FLK+L+ QQIK + +CMY +  +   YII++GEPG H++VLA G++EV +  K L  +     FGELA+L NC RTASVKA+T    W ++R+V+Q I++++   + E+Y+ FL+SV+L K+L +D+LTKI+D L +E Y  G+YI++EGEEG TF+I+  GKVKV Q+ +G  +PQ I+TL  G+YFGE+AL+ +++R+A++IA+ ++V  L++DRE F + +G   EL  K  E Y       + +  +  K+      + +++ +   LE+I           E V+ KN++ + FA+K + K++IV+ KQ+EH+ SE++IL E+  PFI +LY+TF+DNKYVY+L+EACLGGE+W+ LR++  FD+  +KF +     A  YLH   IIYRDL+PEN++ D  G++KL DFGFAK IG+G+KT+TFCGTPEYVAPE+ILNKGHD SVD W++GIL +ELLTG+PPF G + M+ YN ILKG+EK++F RKI R    LI+ LC+ NPTERLG  K+GI+ I  H++  GFNWE L ++ +   +  +L+  ID  YFD++  +  +P DE SGWD +F
Sbjct:   51 LKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQ--FLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQ-KYLEGY------VANLNRDDEKRHAKRSMSNWKLSKALSLEMIQL--------KEKVKVKNEN-VAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 733          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 314/748 (41.98%), Postives = 470/748 (62.83%), Query Frame = 2
Query:  263 YPNLNKITTSRNSPNFVINDEKYDEKKVKELI-QTNNVLSQEIEELHKR--ITEKDF-RIRQLTHEVNDLRQNYDKVKSVLYQKSQVVE----------------DNTLHR-----SESNLRSKKQVVYGE--SFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEF-GRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            +  L K +   N     +    ++  ++++LI Q    +S++  +L ++  I E    RI +L  EV  L++  DK++SVL QK+Q                    N L +     ++   R+KK  V  E  +F      ++ + K+  A  +I  A++  ++DFLK+L ++QI ++  CMY    +A  ++IQEGEPG  ++V+A G+++V ++G  L  M  G + GELA+L NC RTASV+A+T+   W ++R V+Q I Q+  M++  +   FL  V++F++LS+D ++K+ D +  + Y  G YI+++GE+G  F++I +G+VKV Q ++G  EP+EIR L  GD+FGERALL EE+RTA++IA +  VEVL LDRE F +LIG + E   K+Y D +   Q     P  S  K     + ++  +   +++ ++TLGVGGFG+VELV    D +  FALK+L K++IV+ +Q+EHI +ER I++E    +I +LYKTFRD K+VY+L+E CLGGE+WT LR++  FDD   +F +   +  ++YLH KNI+YRDL+PEN +  N G++KL DFGFAK + +GRKT+TFCGTPEYV+PEIILNKGHD + D WA+GI   EL+ G PPF   +PM  Y  ILKGV+ +E   R+I +TA  L+K LC+DNP ERLG G  G++ I  H++F GF+WE L S+ + P I+PK+ N  D   FD +   N VP DE SGWD+ F
Sbjct:   38 FSKLRKPSDQPNGNQVQVGTRTFEAHELQKLIPQLEEAISRKDAQLRQQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQ--KNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIG-DLESLKKDYGDKERLAQVVREPP--SPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 780          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 314/748 (41.98%), Postives = 470/748 (62.83%), Query Frame = 2
Query:  263 YPNLNKITTSRNSPNFVINDEKYDEKKVKELI-QTNNVLSQEIEELHKR--ITEKDF-RIRQLTHEVNDLRQNYDKVKSVLYQKSQVVE----------------DNTLHR-----SESNLRSKKQVVYGE--SFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEF-GRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            +  L K +   N     +    ++  ++++LI Q    +S++  +L ++  I E    RI +L  EV  L++  DK++SVL QK+Q                    N L +     ++   R+KK  V  E  +F      ++ + K+  A  +I  A++  ++DFLK+L ++QI ++  CMY    +A  ++IQEGEPG  ++V+A G+++V ++G  L  M  G + GELA+L NC RTASV+A+T+   W ++R V+Q I Q+  M++  +   FL  V++F++LS+D ++K+ D +  + Y  G YI+++GE+G  F++I +G+VKV Q ++G  EP+EIR L  GD+FGERALL EE+RTA++IA +  VEVL LDRE F +LIG + E   K+Y D +   Q     P  S  K     + ++  +   +++ ++TLGVGGFG+VELV    D +  FALK+L K++IV+ +Q+EHI +ER I++E    +I +LYKTFRD K+VY+L+E CLGGE+WT LR++  FDD   +F +   +  ++YLH KNI+YRDL+PEN +  N G++KL DFGFAK + +GRKT+TFCGTPEYV+PEIILNKGHD + D WA+GI   EL+ G PPF   +PM  Y  ILKGV+ +E   R+I +TA  L+K LC+DNP ERLG G  G++ I  H++F GF+WE L S+ + P I+PK+ N  D   FD +   N VP DE SGWD+ F
Sbjct:   38 FSKLRKPSDQPNGNQVQVGTRTFEAHELQKLIPQLEEAISRKDAQLRQQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQ--KNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIG-DLESLKKDYGDKERLAQVVREPP--SPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 780          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 308/721 (42.72%), Postives = 456/721 (63.25%), Query Frame = 2
Query:  374 LSQEIEELHKRITEKDFRIRQ--------------LTHEVNDLRQNYDKVKSVLYQKSQV---------------------VEDNTLHRSESNLRSKKQVVYGE--SFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEF-GRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            L + I +L + I+ KD ++RQ              L  EV  L++  DK++SVL QK+Q                      ++   +  ++   R+KK  V  E  +F      ++ + K+  A  +I  A++  ++DFLK+L ++QI ++  CMY    +A  ++IQEGEPG  ++V+A G+++V ++G  L  M  G + GELA+L NC RTASV+A+T+   W ++R V+Q I Q+  M++  +   FL  V++F++LS+D ++K+ D +  + Y  G YI+++GE+G  F++I +G+VKV Q ++G  EP+EIR L  GD+FGERALL EE+RTA++IA +  VEVL LDRE F +LIG + E   K+Y D +   Q     P  S  K     + ++  +   +++ ++TLGVGGFG+VELV    D +  FALK+L K++IV+ +Q+EHI +ER I++E    +I +LYKTFRD K+VY+L+E CLGGE+WT LR++  FDD   +F +   +  ++YLH KNI+YRDL+PEN +  N G++KL DFGFAK + +GRKT+TFCGTPEYV+PEIILNKGHD + D WA+GI   EL+ G PPF   +PM  Y  ILKGV+ +E   R+I +TA  L+K LC+DNP ERLG G  G++ I  H++F GF+WE L S+ + P I+PK+ N  D   FD +   N VP DE SGWD+ F
Sbjct:   28 LQKLIPQLEEAISRKDAQLRQQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQ--KNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIG-DLESLKKDYGDKERLAQVVREPP--SPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 743          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 308/721 (42.72%), Postives = 456/721 (63.25%), Query Frame = 2
Query:  374 LSQEIEELHKRITEKDFRIRQ--------------LTHEVNDLRQNYDKVKSVLYQKSQV---------------------VEDNTLHRSESNLRSKKQVVYGE--SFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEF-GRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            L + I +L + I+ KD ++RQ              L  EV  L++  DK++SVL QK+Q                      ++   +  ++   R+KK  V  E  +F      ++ + K+  A  +I  A++  ++DFLK+L ++QI ++  CMY    +A  ++IQEGEPG  ++V+A G+++V ++G  L  M  G + GELA+L NC RTASV+A+T+   W ++R V+Q I Q+  M++  +   FL  V++F++LS+D ++K+ D +  + Y  G YI+++GE+G  F++I +G+VKV Q ++G  EP+EIR L  GD+FGERALL EE+RTA++IA +  VEVL LDRE F +LIG + E   K+Y D +   Q     P  S  K     + ++  +   +++ ++TLGVGGFG+VELV    D +  FALK+L K++IV+ +Q+EHI +ER I++E    +I +LYKTFRD K+VY+L+E CLGGE+WT LR++  FDD   +F +   +  ++YLH KNI+YRDL+PEN +  N G++KL DFGFAK + +GRKT+TFCGTPEYV+PEIILNKGHD + D WA+GI   EL+ G PPF   +PM  Y  ILKGV+ +E   R+I +TA  L+K LC+DNP ERLG G  G++ I  H++F GF+WE L S+ + P I+PK+ N  D   FD +   N VP DE SGWD+ F
Sbjct:   28 LQKLIPQLEEAISRKDAQLRQQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQ--KNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIG-DLESLKKDYGDKERLAQVVREPP--SPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 743          
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 568.155 bits (1463), Expect = 0.000e+0
Identity = 310/721 (43.00%), Postives = 456/721 (63.25%), Query Frame = 2
Query:  374 LSQEIEELHKRITEKDFRIRQ--------------LTHEVNDLRQNYDKVKSVLYQKSQVVE----------------DNTLHR-----SESNLRSKKQVVYGE--SFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEF-GRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            L + I +L + I+ KD ++RQ              L  EV  L++  DK++SVL QK+Q                    N L +     ++   R+KK  V  E  +F      ++ + K+  A  +I  A++  ++DFLK+L ++QI ++  CMY    +A  ++IQEGEPG  ++V+A G+++V ++G  L  M  G + GELA+L NC RTASV+A+T+   W ++R V+Q I Q+  M++  +   FL  V++F++LS+D ++K+ D +  + Y  G YI+++GE+G  F++I +G+VKV Q ++G  EP+EIR L  GD+FGERALL EE+RTA++IA +  VEVL LDRE F +LIG + E   K+Y D +   Q     P  S  K     + ++  +   +++ ++TLGVGGFG+VELV    D +  FALK+L K++IV+ +Q+EHI +ER I++E    +I +LYKTFRD K+VY+L+E CLGGE+WT LR++  FDD   +F +   +  ++YLH KNI+YRDL+PEN +  N G++KL DFGFAK + +GRKT+TFCGTPEYV+PEIILNKGHD + D WA+GI   EL+ G PPF   +PM  Y  ILKGV+ +E   R+I +TA  L+K LC+DNP ERLG G  G++ I  H++F GF+WE L S+ + P I+PK+ N  D   FD +   N VP DE SGWD+ F
Sbjct:   34 LQKLIPQLEEAISRKDAQLRQQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQ--KNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIG-DLESLKKDYGDKERLAQVVREPP--SPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 749          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: Pkg21D (gene:FBgn0000442 transcript:FBtr0078042)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 303/634 (47.79%), Postives = 420/634 (66.25%), Query Frame = 2
Query:  557 KKQVVYGESFSLS-----SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEAS-FWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYII-KXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYED----YKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVR-HKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            KKQ V  ES   S     SI +  +EK  S    I+ AI    +DFLK ++  Q++++   MYSK++ A  ++I+EGE G H+YV A+G+  V++ GK L  M  G+ FGELA+L NC RTAS++ ++EA+  W ++R+V+Q I+  + +Q+ E    FL+SV L  +LS++ L KI D L +E Y+ G YI+++G  G +F++I +       +      E  E+RTL+ GDYFGE+AL+ E+ RTA++IA S  VE L LDR+ F RLIG   EL  K+Y D      +K+ Q S        +    ++ ++  ++  DLEV+STLG+GGFG+VELV+ H  D   +FALK L K++IV+ KQEEHI SER I+L  + PFIC LY+TFRD KYVY+L+EAC+GGEIWT LR++  F+D   +FI+G  + A +YLH++ IIYRDL+PEN++ D RG+VK+ DFGFAK IG   KT+TFCGTPEYVAPEIILNKGHD +VD WA+GIL  ELL G+PPF   +PM  YN ILKG++ + F + I+R AVQLIK LC+D P+ERLGY   GI  I  HK+F GF+W+ L S+ + P  +  + +  D  YFD+F      P DE SGWD +F
Sbjct:  142 KKQGVSAESCVQSMQQSYSIPIPKYEKDFSDKQQIKDAIMD--NDFLKNIDASQVRELVDSMYSKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVLDKMGAGKAFGELAILYNCTRTASIRVLSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLRSVPLLMNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPTSPEETELRTLSRGDYFGEQALINEDKRTANIIALSPGVECLTLDRDSFKRLIGDLCELKEKDYGDESRKLAMKQAQESC-----RDEPKEQLQQEFPDLKLTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIVDTKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTPPFSAPDPMQTYNLILKGIDMIAFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYFDRFPCDLNEPPDELSGWDADF 768          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0446099)

HSP 1 Score: 525.013 bits (1351), Expect = 1.080e-175
Identity = 303/739 (41.00%), Postives = 445/739 (60.22%), Query Frame = 2
Query:  302 PNFVINDEKYDEKKVKELIQTNNVLSQEIEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVL------------------------YQKSQVVEDNTLHRSESNLRSKKQV-VYGESFSLSS-----IEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADS-DNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYF-DQFTEKNFVPLDETSGWDDEF 2422
            PNF++++      + +  IQ       +I+E+ + +  KD       +E+ +L+ + DK +SV                                      +S  N + ++ + +  E  S SS     +    ++K E +  LI+ AI    +DF+K L+  QI++I  CMY     A   II+EG+ G  +YV+  G++EV ++GK L  +   ++ GELA+L NC RTA++ A+TE + W IER+ +Q I+ ++ + +  EY  FL+SV +FK L++D L KI D L    Y  G+YIV++G  G TF+II  GKV+V    Q   E + IR L  GD+FGE+AL  +++RTA++I +S D V  L++DRE F +LI    E+  +  ++  +++++ +                +++ I   DL VI+TLGVGGFG+VELV+   D S  FALK + K  IVE +Q++HI+SE++I+ E    FI +L+KTF+D KY+Y+LME+CLGGE+WT LR+K  FDD  T+F     + A  YLHS+NIIYRDL+PEN++ + RG+VKL DFGFAK +  GRKT+TFCGTPEYVAPE+ILN+GHD S D W++G+L FELLTG+PPF G +PM  YN ILKG++ +EF R I R A  LIK LC+DNP ERLGY + GIS I  HK+F GF W  L +  + P I P +++ +DT  F D   +    P D+ +GWD +F
Sbjct:   28 PNFIVSNYVAASPQEERFIQIIQAKELKIQEMQRALQFKD-------NEIAELKSHLDKFQSVFPFSRGSAAGCAGTGGASGSGAGGSGGSGPGTATGATRKSGQNFQRQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAI--LDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKIN---------------EEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 742          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0473363)

HSP 1 Score: 518.079 bits (1333), Expect = 1.802e-175
Identity = 268/568 (47.18%), Postives = 377/568 (66.37%), Query Frame = 2
Query:  725 MYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADS-DNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYF-DQFTEKNFVPLDETSGWDDEF 2422
            MY     A   II+EG+ G  +YV+  G++EV ++GK L  +   ++ GELA+L NC RTA++ A+TE + W IER+ +Q I+ ++ + +  EY  FL+SV +FK L++D L KI D L    Y  G+YIV++G  G TF+II  GKV+V    Q   E + IR L  GD+FGE+AL  +++RTA++I +S D V  L++DRE F +LI    E+  +  ++  +++++ +                +++ I   DL VI+TLGVGGFG+VELV+   D S  FALK + K  IVE +Q++HI+SE++I+ E    FI +L+KTF+D KY+Y+LME+CLGGE+WT LR+K  FDD  T+F     + A  YLHS+NIIYRDL+PEN++ + RG+VKL DFGFAK +  GRKT+TFCGTPEYVAPE+ILN+GHD S D W++G+L FELLTG+PPF G +PM  YN ILKG++ +EF R I R A  LIK LC+DNP ERLGY + GIS I  HK+F GF W  L +  + P I P +++ +DT  F D   +    P D+ +GWD +F
Sbjct:   16 MYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKIN---------------EEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 568          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0473364)

HSP 1 Score: 518.079 bits (1333), Expect = 1.802e-175
Identity = 268/568 (47.18%), Postives = 377/568 (66.37%), Query Frame = 2
Query:  725 MYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADS-DNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYF-DQFTEKNFVPLDETSGWDDEF 2422
            MY     A   II+EG+ G  +YV+  G++EV ++GK L  +   ++ GELA+L NC RTA++ A+TE + W IER+ +Q I+ ++ + +  EY  FL+SV +FK L++D L KI D L    Y  G+YIV++G  G TF+II  GKV+V    Q   E + IR L  GD+FGE+AL  +++RTA++I +S D V  L++DRE F +LI    E+  +  ++  +++++ +                +++ I   DL VI+TLGVGGFG+VELV+   D S  FALK + K  IVE +Q++HI+SE++I+ E    FI +L+KTF+D KY+Y+LME+CLGGE+WT LR+K  FDD  T+F     + A  YLHS+NIIYRDL+PEN++ + RG+VKL DFGFAK +  GRKT+TFCGTPEYVAPE+ILN+GHD S D W++G+L FELLTG+PPF G +PM  YN ILKG++ +EF R I R A  LIK LC+DNP ERLGY + GIS I  HK+F GF W  L +  + P I P +++ +DT  F D   +    P D+ +GWD +F
Sbjct:   16 MYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRKIN---------------EEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 568          
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Match: for (gene:FBgn0000721 transcript:FBtr0089310)

HSP 1 Score: 527.324 bits (1357), Expect = 2.381e-172
Identity = 304/739 (41.14%), Postives = 445/739 (60.22%), Query Frame = 2
Query:  302 PNFVINDEKYDEKKVKELIQTNNVLSQEIEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVL------------------------YQKSQVVEDNTLHRSESNLRSKKQV-VYGESFSLSS-----IEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADS-DNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYF-DQFTEKNFVPLDETSGWDDEF 2422
            PNF++++      + +  IQ       +I+E+ + +  KD       +E+ +L+ + DK +SV                                      +S  N + ++ + +  E  S SS     +    ++K E +  LI+ AI    +DF+K L+  QI++I  CMY     A   II+EG+ G  +YV+  G++EV ++GK L  +   ++ GELA+L NC RTA++ A+TE + W IER+ +Q I+ ++ + +  EY  FL+SV +FK L++D L KI D L    Y  G+YIV++G  G TF+II  GKV+V    Q   E + IR L  GD+FGE+AL  +++RTA++I +S D V  L++DRE F +LI    E+  +  ++  +++++               I  +++ I   DL VI+TLGVGGFG+VELV+   D S  FALK + K  IVE +Q++HI+SE++I+ E    FI +L+KTF+D KY+Y+LME+CLGGE+WT LR+K  FDD  T+F     + A  YLHS+NIIYRDL+PEN++ + RG+VKL DFGFAK +  GRKT+TFCGTPEYVAPE+ILN+GHD S D W++G+L FELLTG+PPF G +PM  YN ILKG++ +EF R I R A  LIK LC+DNP ERLGY + GIS I  HK+F GF W  L +  + P I P +++ +DT  F D   +    P D+ +GWD +F
Sbjct:  374 PNFIVSNYVAASPQEERFIQIIQAKELKIQEMQRALQFKD-------NEIAELKSHLDKFQSVFPFSRGSAAGCAGTGGASGSGAGGSGGSGPGTATGATRKSGQNFQRQRALGISAEPQSESSLLLEHVSFPKYDKDERSRELIKAAI--LDNDFMKNLDLTQIREIVDCMYPVKYPAKNLIIKEGDVGSIVYVMEDGRVEVSREGKYLSTLSGAKVLGELAILYNCQRTATITAITECNLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPIFKDLAEDTLIKISDVLEETHYQRGDYIVRQGARGDTFFIISKGKVRVTIKQQDTQEEKFIRMLGKGDFFGEKALQGDDLRTANIICESADGVSCLVIDRETFNQLISNLDEIKHRYDDEGAMERRK---------------INEEFRDINLTDLRVIATLGVGGFGRVELVQTNGDSSRSFALKQMKKSQIVETRQQQHIMSEKEIMGEANCQFIVKLFKTFKDKKYLYMLMESCLGGELWTILRDKGNFDDSTTRFYTACVVEAFDYLHSRNIIYRDLKPENLLLNERGYVKLVDFGFAKKLQTGRKTWTFCGTPEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGSDPMRTYNIILKGIDAIEFPRNITRNASNLIKKLCRDNPAERLGYQRGGISEIQKHKWFDGFYWWGLQNCTLEPPIKPAVKSVVDTTNFDDYPPDPEGPPPDDVTGWDKDF 1088          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 313/693 (45.17%), Postives = 439/693 (63.35%), Query Frame = 2
Query:  371 VLSQEIEELHKR---ITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESFS-----LSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKN-FVPLDETSGWDDEF 2422
             L ++IEEL +R   I E +  + Q    +  L+   DK +SV+   +Q V   +  +     R+K+Q +  E  +     LS + +  + KS  +  LI+ AI    +DF+K LE  QI++I  CMY         II+EG+ G  +YV+  GK+EV K+G KL  M PG++FGELA+L NC RTA+V+ +T    W I+R+ +Q I+ ++ + +  EY +FL+SV  F+ L ++ L+K+ D L    YS GEYI+++G  G TF+II  GKV V +       P  +R L  GD+FGE+AL  E+IRTA+VIA ++ V  L++DRE F  LIG   ++++K Y+D   K +  +     S  K                  +I TLGVGGFG+VELV+ K++ +  FA+K L K++IV+ +Q+EHI SE++I+ E    FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  F+D  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP+ERLG  K+G+  I  HK+F GFNWE L    + P IIP + +  DT  FD F E N   P D+ SGWD +F
Sbjct:   10 ALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQVHKQSALQEHQ--RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKELIKEAI--LDNDFMKNLELSQIQEIVDCMYPVEYDKESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLQEEILSKLADVLEETHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGTPVYLRALGKGDWFGEKALQGEDIRTANVIA-AEAVTCLVIDRESFKHLIGGLDDVSNKGYDDAGAKAKYEAENAFFSNLKLVD-------------FNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWDTDF 684          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 308/685 (44.96%), Postives = 434/685 (63.36%), Query Frame = 2
Query:  374 LSQEIEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESF-SLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKN-FVPLDETSGWDDEF 2422
            +S+  EE  K +  K+ RI+++   ++   Q  +++K  L++   V+      R+        +     SF  L S  ++ H KS  +  LI+ AI    +DF+K LE  QI++I  CMY         II+EG+ G  +YV+  GK+EV K+G KL  M PG++FGELA+L NC RTA+V+ +T    W I+R+ +Q I+ ++ + +  EY +FL+SV  F+ L ++ L+K+ D L    YS GEYI+++G  G TF+II  GKV V +       P  +R L  GD+FGE+AL  E+IRTA+VIA ++ V  L++DRE F  LIG   ++++K Y+D   K +  +     S  K                  +I TLGVGGFG+VELV+ K++ +  FA+K L K++IV+ +Q+EHI SE++I+ E    FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  F+D  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP+ERLG  K+G+  I  HK+F GFNWE L    + P IIP + +  DT  FD F E N   P D+ SGWD +F
Sbjct:    1 MSELDEEFAKMLLIKEERIKEMERLLSAKEQEVNELKRKLHKYQSVLPSTIGPRTRRAQGISAEPQTARSFQDLKSEALRKHHKSVRSKELIKEAI--LDNDFMKNLELSQIQEIVDCMYPVEYDKESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLQEEILSKLADVLEETHYSDGEYIIRQGARGDTFFIISKGKVNVTREDAPNGTPVYLRALGKGDWFGEKALQGEDIRTANVIA-AEAVTCLVIDRESFKHLIGGLDDVSNKGYDDAGAKAKYEAENAFFSNLKLVD-------------FNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKQIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLIPPIIPDVASPTDTSNFDSFPEDNEDPPPDDNSGWDTDF 669          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 282/580 (48.62%), Postives = 397/580 (68.45%), Query Frame = 2
Query:  725 MYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYEL--------NSKEYEDYKIKKQQSSTIPIESTXXX------XXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            MY +T +   Y+I++GEPG H++VLA GK++V +  K L  +     FGELA+L NC RTASVKA +    W ++R+V+  I++ +   + E+Y+ FL+SV+L  SL  D+LTKIVD L +E Y+ G+YI++EGEEG TFYII NGK+KV Q+ Q   EPQ I TL  GDYFGE+AL+ +++R+A++IA+ D VE L++DRE F + +G   EL        +S   +D K   ++S +    +T              +    I    LE I+TLGVGGFG+VELV+ KN++ + FALK + K++IV+ +QEEHI SER+ILLE   PFI ++Y+T++DNKYVY+L+EACLGGEIW+ LR++  F++   KF +G    A  YLH+  IIYRDL+PEN++ D  G+VKL DFGFAK +  G++T+TFCGTPEYVAPEIILNKGH  SVD W++GIL FELLTGSPPF G + MI+Y  ILKG+EK++F +KI +    LI+ LC+ NP+ERLG  K+GI+ I  H++FTGF+W  L ++ +   +  +++   D  YFD +  +  +P DE SGWD +F
Sbjct:  191 MYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQIINTLGKGDYFGEKALISDDVRSANIIAEEDGVECLVIDRETFSQTVGTFDELKKYLQSYVDSLARDDKKRNAKRSGSCTPPNTPVSHDMIELKERESSFASTIPFTCLEAIATLGVGGFGRVELVKLKNEN-VTFALKCIKKRHIVDNRQEEHIYSERRILLETNCPFIVKMYRTYKDNKYVYMLLEACLGGEIWSLLRDRGSFEEYTAKFCVGCVTEAFDYLHNNGIIYRDLKPENLMLDTDGYVKLVDFGFAKKLKCGQRTWTFCGTPEYVAPEIILNKGHGLSVDFWSLGILIFELLTGSPPFTGSDQMIIYTFILKGIEKMDFPKKITKRPGDLIRKLCRQNPSERLGNLKNGITDIKKHRWFTGFSWSGLKARNLISPLKREVKGPTDHSYFDSYPPEEEIPPDEMSGWDTDF 769          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 282/580 (48.62%), Postives = 397/580 (68.45%), Query Frame = 2
Query:  725 MYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYEL--------NSKEYEDYKIKKQQSSTIPIESTXXX------XXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            MY +T +   Y+I++GEPG H++VLA GK++V +  K L  +     FGELA+L NC RTASVKA +    W ++R+V+  I++ +   + E+Y+ FL+SV+L  SL  D+LTKIVD L +E Y+ G+YI++EGEEG TFYII NGK+KV Q+ Q   EPQ I TL  GDYFGE+AL+ +++R+A++IA+ D VE L++DRE F + +G   EL        +S   +D K   ++S +    +T              +    I    LE I+TLGVGGFG+VELV+ KN++ + FALK + K++IV+ +QEEHI SER+ILLE   PFI ++Y+T++DNKYVY+L+EACLGGEIW+ LR++  F++   KF +G    A  YLH+  IIYRDL+PEN++ D  G+VKL DFGFAK +  G++T+TFCGTPEYVAPEIILNKGH  SVD W++GIL FELLTGSPPF G + MI+Y  ILKG+EK++F +KI +    LI+ LC+ NP+ERLG  K+GI+ I  H++FTGF+W  L ++ +   +  +++   D  YFD +  +  +P DE SGWD +F
Sbjct:  186 MYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCLEVEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQIINTLGKGDYFGEKALISDDVRSANIIAEEDGVECLVIDRETFSQTVGTFDELKKYLQSYVDSLARDDKKRNAKRSGSCTPPNTPVSHDMIELKERESSFASTIPFTCLEAIATLGVGGFGRVELVKLKNEN-VTFALKCIKKRHIVDNRQEEHIYSERRILLETNCPFIVKMYRTYKDNKYVYMLLEACLGGEIWSLLRDRGSFEEYTAKFCVGCVTEAFDYLHNNGIIYRDLKPENLMLDTDGYVKLVDFGFAKKLKCGQRTWTFCGTPEYVAPEIILNKGHGLSVDFWSLGILIFELLTGSPPFTGSDQMIIYTFILKGIEKMDFPKKITKRPGDLIRKLCRQNPSERLGNLKNGITDIKKHRWFTGFSWSGLKARNLISPLKREVKGPTDHSYFDSYPPEEEIPPDEMSGWDTDF 764          
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:ZDB-GENE-060531-80])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 282/580 (48.62%), Postives = 396/580 (68.28%), Query Frame = 2
Query:  725 MYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYEL--------NSKEYEDYKIKKQQSSTIPIESTXXX------XXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            MY +T +   Y+I++GEPG H++VLA GK++V +  K L  +     FGELA+L NC RTASVKA +    W ++R+V+  I++ +   + E+Y+ FL+SV+L  SL  D+LTKIVD L  E Y+ G+YI++EGEEG TFYII NGK+KV Q+ Q   EPQ I TL  GDYFGE+AL+ +++R+A++IA+ D VE L++DRE F + +G   EL        +S   +D K   ++S +    +T              +    I    LE I+TLGVGGFG+VELV+ KN++ + FALK + K++IV+ +QEEHI SER+ILLE   PFI ++Y+T++DNKYVY+L+EACLGGEIW+ LR++  F++   KF +G    A  YLH+  IIYRDL+PEN++ D  G+VKL DFGFAK +  G++T+TFCGTPEYVAPEIILNKGH  SVD W++GIL FELLTGSPPF G + MI+Y  ILKG+EK++F +KI +    LI+ LC+ NP+ERLG  K+GI+ I  H++FTGF+W  L ++ +   +  +++   D  YFD +  +  +P DE SGWD +F
Sbjct:  191 MYERTYQQGEYVIKQGEPGNHLFVLADGKLDVYQHNKLLTSIAVWTTFGELAILYNCTRTASVKAASNVKTWALDREVFHNIMRMTAEARHEQYRNFLRSVSLLASLPGDKLTKIVDCL-EEYYNKGDYIIREGEEGNTFYIIANGKIKVTQSTQDHEEPQIINTLGKGDYFGEKALISDDVRSANIIAEEDGVECLVIDRETFSQTVGTFDELKKYLQSYVDSLARDDKKRNAKRSGSCTPPNTPVSHDMIELKERESSFASTIPFTCLEAIATLGVGGFGRVELVKLKNEN-VTFALKCIKKRHIVDNRQEEHIYSERRILLETNCPFIVKMYRTYKDNKYVYMLLEACLGGEIWSLLRDRGSFEEYTAKFCVGCVTEAFDYLHNNGIIYRDLKPENLMLDTDGYVKLVDFGFAKKLKCGQRTWTFCGTPEYVAPEIILNKGHGLSVDFWSLGILIFELLTGSPPFTGSDQMIIYTFILKGIEKMDFPKKITKRPGDLIRKLCRQNPSERLGNLKNGITDIKKHRWFTGFSWSGLKARNLISPLKREVKGPTDHSYFDSYPPEEEIPPDEMSGWDTDF 768          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 314/694 (45.24%), Postives = 441/694 (63.54%), Query Frame = 2
Query:  371 VLSQEIEELHKR---ITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVV-EDNTLHRSESNLRSKKQVVYGESFS-----LSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKN-FVPLDETSGWDDEF 2422
             L ++IEEL +R   I E +  + Q    +  L+   DK +SV+   +Q V + N     E   R+K+Q +  E  +     LS + +  + KS  +  LI+ AI    +DF+K LE  QI++I  CMY      +  II+EG+ G  +YV+  GK+EV K+  KL  M PG++FGELA+L NC RTA+VK +T    W I+R+ +Q I+ ++ + +  EY +FL+SV  F+SL ++ ++K+ D L    Y  G+YI+++G  G TF+II  GKV V +      +P  +RTL  GD+FGE+AL  E++RTA+VIA ++ V  L++DR+ F  LIG   ++++K YED + K +  +        K                  +I TLGVGGFG+VELV+ K+D    FA+K L K++IV+ +Q+EHI SE++I+      FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  FDD  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP+ERLG  K+G+  I  HK+F GFNWE L    +TP IIP + +  DT  FD F E N   P D+ SGWD +F
Sbjct:   10 ALQEKIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQNPTTLGEQ--RTKRQAISAEPTAIDIQELSHVTLPFYPKSPQSKELIKEAI--LDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGKGDWFGEKALQGEDVRTANVIA-AEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFGNLKLAD-------------FNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 685          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 314/694 (45.24%), Postives = 441/694 (63.54%), Query Frame = 2
Query:  371 VLSQEIEELHKR---ITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVV-EDNTLHRSESNLRSKKQVVYGESFS-----LSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKN-FVPLDETSGWDDEF 2422
             L ++IEEL +R   I E +  + Q    +  L+   DK +SV+   +Q V + N     E   R+K+Q +  E  +     LS + +  + KS  +  LI+ AI    +DF+K LE  QI++I  CMY      +  II+EG+ G  +YV+  GK+EV K+  KL  M PG++FGELA+L NC RTA+VK +T    W I+R+ +Q I+ ++ + +  EY +FL+SV  F+SL ++ ++K+ D L    Y  G+YI+++G  G TF+II  GKV V +      +P  +RTL  GD+FGE+AL  E++RTA+VIA ++ V  L++DR+ F  LIG   ++++K YED + K +  +        K                  +I TLGVGGFG+VELV+ K+D    FA+K L K++IV+ +Q+EHI SE++I+      FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  FDD  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP+ERLG  K+G+  I  HK+F GFNWE L    +TP IIP + +  DT  FD F E N   P D+ SGWD +F
Sbjct:   10 ALQEKIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQNPTTLGEQ--RTKRQAISAEPTAIDIQELSHVTLPFYPKSPQSKELIKEAI--LDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGKGDWFGEKALQGEDVRTANVIA-AEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFGNLKLAD-------------FNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 685          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: camk4 (calcium/calmodulin-dependent protein kinase IV [Source:Xenbase;Acc:XB-GENE-5911781])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 310/686 (45.19%), Postives = 433/686 (63.12%), Query Frame = 2
Query:  380 QEIEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESF----SLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKN-FVPLDETSGWDDEF 2422
            + I +L  R++EK+        E+ +L++   K +SVL   S      T H      R++      +SF     L+    K   KSE +  LI+ AI    +DF+K LE  QI++I  CMY      +  II+EG+ G  +YV+  GK+EV K+  KL  M PG++FGELA+L NC RTA+VK +T    W I+R+ +Q I+ ++ + +  EY +FL+SV  F+SL ++ ++K+ D L    Y  G+YI+++G  G TF+II  GKV V +      +P  +RTL  GD+FGE+AL  E++RTA+VIA ++ V  L++DR+ F  LIG   ++++K YED + K +  +        K                  +I TLGVGGFG+VELV+ K+D    FA+K L K++IV+ +Q+EHI SE++I+      FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  FDD  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP+ERLG  K+G+  I  HK+F GFNWE L    +TP IIP + +  DT  FD F E N   P D+ SGWD +F
Sbjct:   17 ERIRDLENRLSEKE-------KEIQELKRKLHKYQSVLAMPS------TSHIGPRTTRAQGISAEPQSFRSYHDLTRQAFKKFTKSERSKELIKEAI--LDNDFMKNLEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGKGDWFGEKALQGEDVRTANVIA-AEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFGNLKLAD-------------FNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHIRSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNEDPPPDDNSGWDIDF 673          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: ptafr (platelet activating factor receptor [Source:Xenbase;Acc:XB-GENE-968925])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 276/580 (47.59%), Postives = 390/580 (67.24%), Query Frame = 2
Query:  725 MYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYEL--------------NSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            MY +      +II++GEPG  ++VLA GK EV ++ K L  +     FGELA+L NC RTASVKA+T    W ++R+V+Q I++K+   + EEY  FL+SV L K L + +L KI D L +E Y + +YI++EGEEG TF+II  GKVKV Q+ +G  EPQ I+ L  GDYFGE+AL+ +++R+A+++A  D VE L++DRE F + +G   EL              + + +    + ++    + +E   K    +          +LE+++TLGVGGFG+VELV+ KN++ +VFALK + K++IV+ +Q+EHI SE+ IL E   PFI +LY TF+DNKYVY+L+EACLGGE+W+ LR++  FD+   KF  G    A +YLH K ++YRDL+PEN++ D+ G+VKL DFGFAK I  G+KT+TFCGTPEYVAPE+ILNKGH  SVD W++GIL +ELLTGSPPF G + MI+YN IL+G+EK+EF + I +    LI+ LC++NP ERLG  K+GI+ I  H++F GFNWE L ++ +   + P+LE   D  YFD +     +P DE SGWD +F
Sbjct:  210 MYERIYLQGEFIIRQGEPGSQIFVLADGKAEVFQENKLLTSIPVWTTFGELAILYNCTRTASVKAITGVRTWALDREVFQNIMRKTAQSKHEEYLSFLKSVPLLKELPEHKLMKIADCLELEFYEMDDYIIREGEEGSTFFIISKGKVKVTQSTEGYKEPQYIKFLEKGDYFGEKALISDDVRSANILAYGDRVECLVMDRETFNKTVGTYEELMKCLEGYVANLTLDDERRHAKSPVNERHLRAVSME-LNKMKQTLARFPSASPFENLEIVTTLGVGGFGRVELVKVKNEN-LVFALKCIKKRHIVDNRQQEHIHSEKNILEEACSPFIVKLYCTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTAKFCTGCVTEAFEYLHQKGVLYRDLKPENLLLDSEGYVKLVDFGFAKKIFPGQKTWTFCGTPEYVAPEVILNKGHSFSVDFWSLGILLYELLTGSPPFTGPDQMIIYNLILQGIEKIEFYKNITKRPEDLIRRLCRENPAERLGNMKNGIADIKKHRWFNGFNWEGLNTRSLPSPLKPELEGPTDHSYFDSYPPDEEIPPDEVSGWDQDF 787          
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Match: tnpo2 (transportin 2 [Source:Xenbase;Acc:XB-GENE-968452])

HSP 1 Score: 531.946 bits (1369), Expect = 4.643e-178
Identity = 293/699 (41.92%), Postives = 434/699 (62.09%), Query Frame = 2
Query:  401 KRITEKDFRIRQLTHEVNDLRQNYDKVKSVL-----------YQKSQVVEDNTLHRSESNLRSKKQVVYGESFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQS-VNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIG-----QNY--------ELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            K + EKD +I QL  E+       DK++  L            QK +++  +   +++  + ++    +  + S  + ++    K  SA  LI  AI S  +DFL++LE   ++ +  CMY +    +  +IQEG  G H+YVLA G ++VI++ + L  M+PG  FGELA+L NC RTA+VKAVT++  W ++R+V+Q I+  S   Q +EY  FL+  V LF  +    L  I +    + Y  G+YI++EGEEG TF+II  GKV V Q V+G  EPQEI+TL  GDYFGE+AL+ E++R+A++IA+ D+ + L++DR+ F +++G     Q Y         LN  +  + +     S +       +   ++           L+VI+TLG GGFG+VELV+ K D  M FALK + K++IV+  Q+EH+  E+ IL +I   FI  LY+TFRD KYVY+L+E CLGGE+W+ LR+   F++   +F  G  + A  YLH++ I+YRDL+PEN++ D+ G++K+ DFGFAK IG G+KT+TFCGTPEYVAPEII+N+GHD   D W++GIL +ELLTGSPPF G +P+ +YN +LKG+EKV+F  +I R +  +I+ LC+ NP ERLG  K+GIS I  HK+F GFNWE L ++++   +  +++   D  YFD F  ++  P DE SGWD  F
Sbjct:   53 KELQEKDEKILQLEKELEVKVIQIDKLQDALGYNVTQTSPKGSQKKKLLSAHRRQKAKEGVSAEPTSRHYYNPSSQNPDVTCVRKDSSAKKLITGAIMS--NDFLRQLEASHVRCMVDCMYERVYSKSQLVIQEGAAGNHLYVLADGLLDVIQNSRLLGQMHPGTAFGELAILYNCKRTATVKAVTDSKIWVLDRQVFQNIMMSSAQAQHQEYFSFLRRYVGLFSVMIYRLLYTIKNT---DFYDKGDYIIREGEEGNTFFIIAKGKVCVTQAVEGSQEPQEIKTLGVGDYFGEKALISEDVRSANIIAEEDDTQCLVIDRDTFNQMVGTYQELQTYLREYVFQLALNDHDRRNARKSLHHSMSRDNSEVNQLRELVSKFSSTSPFRYLDVITTLGTGGFGRVELVKLK-DEDMTFALKCIKKKHIVDTHQQEHVYWEKNILQQINCSFIIRLYRTFRDAKYVYMLLEVCLGGELWSILRDTGPFEEGTARFCTGCVLEAFDYLHNRGIVYRDLKPENLLLDSEGYIKMVDFGFAKKIGPGKKTWTFCGTPEYVAPEIIMNRGHDFGADYWSLGILIYELLTGSPPFSGTDPIKIYNMVLKGIEKVDFPHRIGRRSEDVIRRLCRINPAERLGNRKNGISDIRKHKWFQGFNWEGLRNRKLLSPLKREIKGITDHSYFDNFLPESEEPPDELSGWDKNF 745          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 310/693 (44.73%), Postives = 442/693 (63.78%), Query Frame = 2
Query:  371 VLSQEIEELHKR---ITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESFS-----LSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTE-KNFVPLDETSGWDDEF 2422
             L ++IEEL +R   I E +  + Q    +  L+   DK +SV+   +Q  +  +    +   R+K+Q +  E  +     LS + +  + KS  +  LI+ AI    +DF+K LE  QI++I  CMY      +  II+EG+ G  +YV+  GK+EV K+G KL  M PG++FGELA+L NC RTA+VK +     W I+R+ +Q I+ ++ + +  EY +FL+SV  F+SL  + L+K+ D L    Y  GEYI+++G  G TF+II  G+V V +      +P  +RTL  GD+FGE+AL  E++RTA+VIA ++ V  L++DR+ F  LIG   ++++K YED + K +  +     +  K +                +I TLGVGGFG+VELV+ K++ S  FA+K L K++IV+ +Q+EHI SE++I+      FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  F+D  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP+ERLG  K+G+  I  HK+F GFNWE L    +TP IIP + +  DT  FD F E  +  P D+ SGWD +F
Sbjct:   10 ALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAI--LDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIA-AEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSD-------------FNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 686          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg2 (protein kinase, cGMP-dependent, type II [Source:MGI Symbol;Acc:MGI:108173])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 314/716 (43.85%), Postives = 463/716 (64.66%), Query Frame = 2
Query:  386 IEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKS----QVVEDNT---LHRSESNL------RSKKQVVYGESFSLS---------SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELN----------SKEYEDYKIKKQQSS-----TIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            ++EL +++ ++   I +LT E+       +K++ V++ +     Q   D     +HR  S L      R  K  V  E  + +         S E     K  S   LI  A+   Q  FLK+L+ QQIK + +CMY +  +   Y+I++GEPG H++VLA G++EV +  K L  +     FGELA+L NC RTASVKA+T    W ++R+V+Q I++++   + EEY+ FL+SV+L K+L +D+LTKI+D L +E Y  G+YI++EGEEG TF+I+  GKVKV Q+ +G  +PQ I+TL  G+YFGE+AL+ +++R+A++IA+ ++V  L++DRE F + +G   EL           +++ E    K+  SS      + +E   +    +          +LE+I+TLGVGGFG+VELV+ KN++ + FA+K + K++IV+ KQ+EH+ SE++IL E+  PFI +LY+TF+DNKYVY+L+EACLGGE+W+ LR++  FD+  +KF +     A  YLH   IIYRDL+PEN++ D  G++KL DFGFAK IG+G+KT+TFCGTPEYVAPE+ILNKGHD SVD W++GIL +ELLTG+PPF G + M+ YN ILKG+EK++F RKI R    LI+ LC+ NPTERLG  K+GI+ I  H++  GFNWE L ++ +   +  +L   ID  YFD++  +  VP DE SGWD +F
Sbjct:   51 LKELREQLAKQTVAIAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQ--FLKRLDPQQIKDMVECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRSMSSWKLSKALSLE-MIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKNEN-VAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 554.288 bits (1427), Expect = 0.000e+0
Identity = 308/682 (45.16%), Postives = 435/682 (63.78%), Query Frame = 2
Query:  380 QEIEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTE-KNFVPLDETSGWDDEF 2422
            + I+EL KR++EK+        E+ +L++   K +SVL   S  +   T       + ++ Q     SF       +   KSE +  LI+ AI    +DF+K LE  QI++I  CMY      +  II+EG+ G  +YV+  GK+EV K+G KL  M PG++FGELA+L NC RTA+VK +     W I+R+ +Q I+ ++ + +  EY +FL+SV  F+SL  + L+K+ D L    Y  GEYI+++G  G TF+II  G+V V +      +P  +RTL  GD+FGE+AL  E++RTA+VIA ++ V  L++DR+ F  LIG   ++++K YED + K +  +     +  K +                +I TLGVGGFG+VELV+ K++ S  FA+K L K++IV+ +Q+EHI SE++I+      FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  F+D  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP+ERLG  K+G+  I  HK+F GFNWE L    +TP IIP + +  DT  FD F E  +  P D+ SGWD +F
Sbjct:   17 ERIKELEKRLSEKE-------EEIQELKRKLHKCQSVLPVPSTHIGPRTTR--AQGISAEPQTY--RSFHDLRQAFRKFTKSERSKDLIKEAI--LDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIA-AEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSD-------------FNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 671          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg2 (protein kinase, cGMP-dependent, type II [Source:MGI Symbol;Acc:MGI:108173])

HSP 1 Score: 535.413 bits (1378), Expect = 1.224e-179
Identity = 304/701 (43.37%), Postives = 451/701 (64.34%), Query Frame = 2
Query:  386 IEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKS----QVVEDNT---LHRSESNL------RSKKQVVYGESFSLS---------SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            ++EL +++ ++   I +LT E+       +K++ V++ +     Q   D     +HR  S L      R  K  V  E  + +         S E     K  S   LI  A+   Q  FLK+L+ QQIK + +CMY +  +   Y+I++GEPG H++VLA G++EV +  K L  +     FGELA+L NC RTASVKA+T    W ++R+V+Q I++++   + EEY+ FL+SV+L K+L +D+LTKI+D L +E Y  G+YI++EGEEG TF+I+  GKVKV Q+ +G  +PQ I+TL  G+YFGE+AL+ +++R+A++IA+ ++V  L++DRE F + +G   EL  K  E Y       +T+  +  K+      + +++ +   LE+I           E V+ KN++ + FA+K + K++IV+ KQ+EH+ SE++IL E+  PFI +LY+TF+DNKYVY+L+EACLGGE+W+ LR++  FD+  +KF +     A  YLH   IIYRDL+PEN++ D  G++KL DFGFAK IG+G+KT+TFCGTPEYVAPE+ILNKGHD SVD W++GIL +ELLTG+PPF G + M+ YN ILKG+EK++F RKI R    LI+ LC+ NPTERLG  K+GI+ I  H++  GFNWE L ++ +   +  +L   ID  YFD++  +  VP DE SGWD +F
Sbjct:   51 LKELREQLAKQTVAIAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQ--FLKRLDPQQIKDMVECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQ-KYLEGY------VATLNRDDEKRHAKRSMSSWKLSKALSLEMIQL--------KEKVKVKNEN-VAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF 733          
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Match: Prkg1 (protein kinase, cGMP-dependent, type I [Source:MGI Symbol;Acc:MGI:108174])

HSP 1 Score: 361.303 bits (926), Expect = 3.660e-117
Identity = 186/389 (47.81%), Postives = 254/389 (65.30%), Query Frame = 2
Query: 1259 KEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTE-KNFVPLDETSGWDDEF 2422
            +E++RTA+VIA ++ V  L++DR+ F  LIG   ++++K YED + K +  +     +  K +                +I TLGVGGFG+VELV+ K++ S  FA+K L K++IV+ +Q+EHI SE++I+      FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  F+D  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC                     ++F GFNWE L    +TP IIP + +  DT  FD F E  +  P D+ SGWD +F
Sbjct:   29 EEDVRTANVIA-AEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSD-------------FNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLC---------------------RWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF 382          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q03042|KGP1_DROME (cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster OX=7227 GN=Pkg21D PE=1 SV=2)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 303/634 (47.79%), Postives = 420/634 (66.25%), Query Frame = 2
Query:  557 KKQVVYGESFSLS-----SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEAS-FWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYII-KXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYED----YKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVR-HKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            KKQ V  ES   S     SI +  +EK  S    I+ AI    +DFLK ++  Q++++   MYSK++ A  ++I+EGE G H+YV A+G+  V++ GK L  M  G+ FGELA+L NC RTAS++ ++EA+  W ++R+V+Q I+  + +Q+ E    FL+SV L  +LS++ L KI D L +E Y+ G YI+++G  G +F++I +       +      E  E+RTL+ GDYFGE+AL+ E+ RTA++IA S  VE L LDR+ F RLIG   EL  K+Y D      +K+ Q S        +    ++ ++  ++  DLEV+STLG+GGFG+VELV+ H  D   +FALK L K++IV+ KQEEHI SER I+L  + PFIC LY+TFRD KYVY+L+EAC+GGEIWT LR++  F+D   +FI+G  + A +YLH++ IIYRDL+PEN++ D RG+VK+ DFGFAK IG   KT+TFCGTPEYVAPEIILNKGHD +VD WA+GIL  ELL G+PPF   +PM  YN ILKG++ + F + I+R AVQLIK LC+D P+ERLGY   GI  I  HK+F GF+W+ L S+ + P  +  + +  D  YFD+F      P DE SGWD +F
Sbjct:  142 KKQGVSAESCVQSMQQSYSIPIPKYEKDFSDKQQIKDAIMD--NDFLKNIDASQVRELVDSMYSKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVLDKMGAGKAFGELAILYNCTRTASIRVLSEAARVWVLDRRVFQQIMMCTGLQRIENSVNFLRSVPLLMNLSEELLAKIADVLELEFYAAGTYIIRQGTAGDSFFLISQGNVRVTQKLTPTSPEETELRTLSRGDYFGEQALINEDKRTANIIALSPGVECLTLDRDSFKRLIGDLCELKEKDYGDESRKLAMKQAQESC-----RDEPKEQLQQEFPDLKLTDLEVVSTLGIGGFGRVELVKAHHQDRVDIFALKCLKKRHIVDTKQEEHIFSERHIMLSSRSPFICRLYRTFRDEKYVYMLLEACMGGEIWTMLRDRGSFEDNAAQFIIGCVLQAFEYLHARGIIYRDLKPENLMLDERGYVKIVDFGFAKQIGTSSKTWTFCGTPEYVAPEIILNKGHDRAVDYWALGILIHELLNGTPPFSAPDPMQTYNLILKGIDMIAFPKHISRWAVQLIKRLCRDVPSERLGYQTGGIQDIKKHKWFLGFDWDGLASQLLIPPFVRPIAHPTDVRYFDRFPCDLNEPPDELSGWDADF 768          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|O76360|EGL4_CAEEL (cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans OX=6239 GN=egl-4 PE=1 SV=2)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 314/748 (41.98%), Postives = 470/748 (62.83%), Query Frame = 2
Query:  263 YPNLNKITTSRNSPNFVINDEKYDEKKVKELI-QTNNVLSQEIEELHKR--ITEKDF-RIRQLTHEVNDLRQNYDKVKSVLYQKSQVVE----------------DNTLHR-----SESNLRSKKQVVYGE--SFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEF-GRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            +  L K +   N     +    ++  ++++LI Q    +S++  +L ++  I E    RI +L  EV  L++  DK++SVL QK+Q                    N L +     ++   R+KK  V  E  +F      ++ + K+  A  +I  A++  ++DFLK+L ++QI ++  CMY    +A  ++IQEGEPG  ++V+A G+++V ++G  L  M  G + GELA+L NC RTASV+A+T+   W ++R V+Q I Q+  M++  +   FL  V++F++LS+D ++K+ D +  + Y  G YI+++GE+G  F++I +G+VKV Q ++G  EP+EIR L  GD+FGERALL EE+RTA++IA +  VEVL LDRE F +LIG + E   K+Y D +   Q     P  S  K     + ++  +   +++ ++TLGVGGFG+VELV    D +  FALK+L K++IV+ +Q+EHI +ER I++E    +I +LYKTFRD K+VY+L+E CLGGE+WT LR++  FDD   +F +   +  ++YLH KNI+YRDL+PEN +  N G++KL DFGFAK + +GRKT+TFCGTPEYV+PEIILNKGHD + D WA+GI   EL+ G PPF   +PM  Y  ILKGV+ +E   R+I +TA  L+K LC+DNP ERLG G  G++ I  H++F GF+WE L S+ + P I+PK+ N  D   FD +   N VP DE SGWD+ F
Sbjct:   38 FSKLRKPSDQPNGNQVQVGTRTFEAHELQKLIPQLEEAISRKDAQLRQQQTIVEGHIKRISELEGEVTTLQRECDKLRSVLEQKAQSAASPGGQPPSPSPRTDQLGNDLQQKAVLPADGVQRAKKIAVSAEPTNFENKPATLQHYNKTVGAKQMIRDAVQ--KNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQAPGVEVLTLDRESFGKLIG-DLESLKKDYGDKERLAQVVREPP--SPVKIVDDFREEFAQVTLKNVKRLATLGVGGFGRVELVCVNGDKAKTFALKALKKKHIVDTRQQEHIFAERNIMMETSTDWIVKLYKTFRDQKFVYMLLEVCLGGELWTTLRDRGHFDDYTARFYVACVLEGLEYLHRKNIVYRDLKPENCLLANTGYLKLVDFGFAKKLASGRKTWTFCGTPEYVSPEIILNKGHDQAADYWALGIYICELMLGRPPFQASDPMKTYTLILKGVDALEIPNRRIGKTATALVKKLCRDNPGERLGSGSGGVNDIRKHRWFMGFDWEGLRSRTLKPPILPKVSNPADVTNFDNYPPDNDVPPDEFSGWDEGF 780          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q64595|KGP2_RAT (cGMP-dependent protein kinase 2 OS=Rattus norvegicus OX=10116 GN=Prkg2 PE=1 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 315/716 (43.99%), Postives = 463/716 (64.66%), Query Frame = 2
Query:  386 IEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKS----QVVEDNT---LHRSESNL------RSKKQVVYGESFSLS---------SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELN----------SKEYEDYKIKKQQSS-----TIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            ++EL +++ ++   I +LT E+       +K++ V++ +     Q   D     +HR  S L      R  K  V  E  S +         S E     K  S   LI  A+   Q  FLK+L+ QQIK + +CMY +  +   YI+++GEPG H++VLA G++EV +  K L  +     FGELA+L NC RTASVKA+T    W ++R+V+Q I++++   + EEY+ FL+SV+L K+L +D+LTKI+D L +E Y  G+YI++EGEEG TF+I+  GKVKV Q+ +G  +PQ I+TL  G+YFGE+AL+ +++R+A++IA+ ++V  L++DRE F + +G   EL           +++ E    K+  SS      + +E   +    +          +LE+I+TLGVGGFG+VELV+ KN++ + FA+K + K++IV+ KQ+EH+ SE++IL E+  PFI +LY+TF+DNKYVY+L+EACLGGE+W+ LR++  FD+  +KF +     A  YLH   IIYRDL+PEN++ D  G++KL DFGFAK IG+G+KT+TFCGTPEYVAPE+ILNKGHD SVD W++GIL +ELLTG+PPF G + M+ YN ILKG+EK++F RKI R    LI+ LC+ NPTERLG  K+GI+ I  H++  GFNWE L ++ +   +  +L   ID  YFD++  +  VP DE SGWD +F
Sbjct:   51 LKELREQLAKQTVAIAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRGAKAGVSAEPTSRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQ--FLKRLDPQQIKDMVECMYGRNYQQGSYIVKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRSMSSWKLSKALSLE-MIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKNEN-IAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q13237|KGP2_HUMAN (cGMP-dependent protein kinase 2 OS=Homo sapiens OX=9606 GN=PRKG2 PE=1 SV=1)

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 311/715 (43.50%), Postives = 464/715 (64.90%), Query Frame = 2
Query:  386 IEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKS----QVVEDNT---LHRSESNL------RSKKQVVYGESFSLS---------SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIG---------QNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXX-----LEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            ++EL ++++++   I +LT E+ +     +K++ V++ +     Q   D     +HR  S L      R  K  V  E  + +         S E     K  S   LI  A+   Q  FLK+L+ QQIK + +CMY +  +   YII++GEPG H++VLA G++EV +  K L  +     FGELA+L NC RTASVKA+T    W ++R+V+Q I++++   + E+Y+ FL+SV+L K+L +D+LTKI+D L +E Y  G+YI++EGEEG TF+I+  GKVKV Q+ +G  +PQ I+TL  G+YFGE+AL+ +++R+A++IA+ ++V  L++DRE F + +G         + Y  N    ++ +  K+  S   +       +I   +      +      LE+I+TLGVGGFG+VELV+ KN++ + FA+K + K++IV+ KQ+EH+ SE++IL E+  PFI +LY+TF+DNKYVY+L+EACLGGE+W+ LR++  FD+  +KF +     A  YLH   IIYRDL+PEN++ D  G++KL DFGFAK IG+G+KT+TFCGTPEYVAPE+ILNKGHD SVD W++GIL +ELLTG+PPF G + M+ YN ILKG+EK++F RKI R    LI+ LC+ NPTERLG  K+GI+ I  H++  GFNWE L ++ +   +  +L+  ID  YFD++  +  +P DE SGWD +F
Sbjct:   51 LKELREQLSKQTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQ--FLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRSMSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNEN-VAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Match: sp|Q61410|KGP2_MOUSE (cGMP-dependent protein kinase 2 OS=Mus musculus OX=10090 GN=Prkg2 PE=1 SV=1)

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 314/716 (43.85%), Postives = 463/716 (64.66%), Query Frame = 2
Query:  386 IEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKS----QVVEDNT---LHRSESNL------RSKKQVVYGESFSLS---------SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELN----------SKEYEDYKIKKQQSS-----TIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            ++EL +++ ++   I +LT E+       +K++ V++ +     Q   D     +HR  S L      R  K  V  E  + +         S E     K  S   LI  A+   Q  FLK+L+ QQIK + +CMY + +    Y+I++GEPG H++VLA G++EV +  K L  +     FGELA+L NC RTASVKA+T    W ++R+V+Q I++++   + EEY+ FL+SV+L K+L +D+LTKI+D L +E Y  G+YI++EGEEG TF+I+  GKVKV Q+ +G  +PQ I+TL  G+YFGE+AL+ +++R+A++IA+ ++V  L++DRE F + +G   EL           +++ E    K+  SS      + +E   +    +          +LE+I+TLGVGGFG+VELV+ KN++ + FA+K + K++IV+ KQ+EH+ SE++IL E+  PFI +LY+TF+DNKYVY+L+EACLGGE+W+ LR++  FD+  +KF +     A  YLH   IIYRDL+PEN++ D  G++KL DFGFAK IG+G+KT+TFCGTPEYVAPE+ILNKGHD SVD W++GIL +ELLTG+PPF G + M+ YN ILKG+EK++F RKI R    LI+ LC+ NPTERLG  K+GI+ I  H++  GFNWE L ++ +   +  +L   ID  YFD++  +  VP DE SGWD +F
Sbjct:   51 LKELREQLAKQTVAIAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQ--FLKRLDPQQIKDMVECMYGEKLSTGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRSMSSWKLSKALSLE-MIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKNEN-VAFAMKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACVTEAFDYLHLLGIIYRDLKPENLILDADGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLKARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF 762          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: V3Z912 (cGMP-dependent protein kinase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_127769 PE=3 SV=1)

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 355/738 (48.10%), Postives = 488/738 (66.12%), Query Frame = 2
Query:  296 NSPNFVINDEKYDEKKVKELIQTNNVLSQEIEELHKRITEKDFRIRQL--------------THEVNDLRQNYDKVKSVLYQKSQVVEDN------TLHRSE-----SNLRSKKQVVYGESFSLS--SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXX--XXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            ++   V++ E YD  K+K L            E+   + +KD +IR+L                E+  L++   K+KSVL  K  V +D       T+  +E       +RSKKQ V GES S S  ++E+K H+K   +  LI+ AI    +DFLK L+  Q+++I  CMY K +K   YII+EGE G H+YV A G++EV K+G  L  M  G  FGELA+L NC RTASVKA+TE   W ++R ++QAI+ K+ +Q+ +E  ++L+SV L + L  D+L K+ D L ++ Y  GEYI++EG  G +F+I+  G+VKV Q +QG   PQEIR L  GDYFGE++LL E+ RTA+VIA    VE L +DR+ F +LIG   EL +K+Y D   + + +S +  E T       +       I+ +DL+V++TLG+GGFG+VELV+  ND    +ALK L K++IV+ +Q+EHI SE++I+L  + PFI  L+KTFRDNKYVY++MEACLGGE+WT LR++  FDD+ T+F +   + A +YLH K IIYRDL+PEN++ DN+G++KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD + D W++GIL FELLTGSPPF G +PM  YN ILKG++ +EF RKI+R A  LIK LC+D P ERLGYGK+GI+ I  HK+F GF+WE LL+  +TP IIPK++N  D   FD + + N +P DETSGWD +F
Sbjct:    6 SATQMVVDGETYDIAKLKLLFP----------EMKSELKDKDAKIRKLEIESRDKTKQINENNKEITRLKEEVHKLKSVLQLK--VHKDGKPDILATIQETEPPVVVQEVRSKKQGVSGESSSNSQSNVELKHHDKDFRSKQLIKDAI--LDNDFLKNLDSTQVREIVDCMYDKKIKEGHYIIKEGESGNHLYVSADGEVEVQKEGTILGRMASGRAFGELAILYNCTRTASVKALTEVRVWVLDRAMFQAIMMKTGIQRRDENIRYLRSVPLLRDLPADKLAKLADVLEIDFYHEGEYIIREGATGDSFFILNKGEVKVTQRIQGHNNPQEIRKLKRGDYFGEKSLLSEDRRTANVIALPPGVECLTVDRDSFNQLIGDLNELRTKDYGD---EARGASRLSGELTPGSRDKDRILEEFVNIKIDDLDVVATLGMGGFGRVELVQLSNDKMKTYALKCLKKKHIVDTRQQEHIYSEKQIMLTSRTPFIARLFKTFRDNKYVYMMMEACLGGELWTILRDRGSFDDKTTRFYVSCVVEAFKYLHHKGIIYRDLKPENLLLDNKGYIKLVDFGFAKKIGAGKKTWTFCGTPEYVAPEIILNKGHDHAADYWSLGILMFELLTGSPPFSGSDPMKTYNIILKGIDVIEFPRKISRNAHALIKKLCRDAPVERLGYGKNGITDIKKHKWFQGFDWEGLLNHSITPPIIPKVKNPTDYSNFDSYPKDNDIPADETSGWDADF 726          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A4D5RA32 (cGMP-dependent protein kinase OS=Scolopendra viridis OX=118503 PE=3 SV=1)

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 336/708 (47.46%), Postives = 466/708 (65.82%), Query Frame = 2
Query:  344 VKELIQTNNVLSQEIEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDN-------TLHRSES----NLRSKKQVVYGESFS----LSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            V EL        Q +EEL  ++     +++    E   LRQ   ++KSVL   +     N       TL    S       SK+Q V GESFS      +I+++ +EK   +  LI+ AI   ++DFL+ L+  Q+ +I  CMY +T      +I+EGEPG H+YV A G++ V KDG  L  M  G  FGELA+L NC RTAS++A+T+A  W ++R+V+QAI+ +S + + E++  FL+SV LFK+LS + L KI D L +E +   EYI+++G  G TFYII NG+VKV Q + G    +EIR L  GDYFGE+ALL+E+ RTA+VIA S  VE L LDRE F +LIG   EL +K+Y D +++  Q       +T ++               L+V++TLGVGGFG+VELV+H+ D S+ FALK L+KQ+I+E +Q+ HI SE+ I++  + PFI  LYKTF+D KYVY+LMEACLGGE+WT LR+KT FDD  T+F     + A +YLHS  IIYRDL+PEN++ D +G+VKL DFGF+K +GNG+KT+TFCGTPEYVAPEIILNKGHD +VD W++G+L FEL TGSPPF   +PM  YN ILKG++ ++F + I+R A  LIK LC+D+P+ERLGY K+GIS I  HK+F GF+W+ L+++ + P IIP++++  D   FD +  +  +P DE SGWD +F
Sbjct:   50 VSELKAVIRQRDQRVEELETQLEALFVQLQSREEENVKLRQEIHQLKSVLQATASEARSNGKMDLLATLQEHHSMAGQGAISKRQGVSGESFSPNKTTDNIKVQFYEKDFRSKQLIKDAI--MRNDFLQNLDSSQVNEIVDCMYPRTFPRGSLVIKEGEPGSHLYVSAEGELIVTKDGGILGKMGSGRAFGELAILYNCTRTASIEALTDAQVWVLDRRVFQAIMMRSGLLRQEQHINFLRSVPLFKNLSSEVLVKIADVLEIEFFPDDEYIIRQGTTGDTFYIIANGRVKVTQRIPGTDTEEEIRILERGDYFGEQALLREDSRTANVIALSPGVECLTLDRESFNQLIGDLQELQNKDYGD-QVRSLQRPPSANSATSENEFSDIWLED------LDVVATLGVGGFGRVELVQHRFDKSVTFALKCLTKQHILETQQQHHIHSEKTIMMSCRSPFIARLYKTFKDVKYVYMLMEACLGGEVWTILRDKTTFDDHTTRFYTACVVEAFEYLHSHGIIYRDLKPENLLLDTKGYVKLVDFGFSKRLGNGQKTWTFCGTPEYVAPEIILNKGHDRAVDYWSLGVLMFELFTGSPPFAASDPMKTYNIILKGIDMIDFPKHISRHAQSLIKRLCRDSPSERLGYQKNGISDIKKHKWFQGFDWDGLINQTLPPPIIPEVKSPTDVSNFDCYPREFEIPPDEVSGWDADF 748          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A1S3HLV4 (cGMP-dependent protein kinase OS=Lingula unguis OX=7574 GN=LOC106156342 PE=3 SV=1)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 334/734 (45.50%), Postives = 478/734 (65.12%), Query Frame = 2
Query:  278 KITTSRNSPNFVINDEKYDEKKVKELIQTNNVLSQEIEELHKRITEKDFRIRQLT-------HEVNDLRQNYDKVKSVLYQK----------SQVVEDNTLHRSESNLRSKKQVVYGES--FSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            K+    ++ + V+  E  D  K++ L+     L +E+ +  ++I +  +++  LT       ++V  L +  DK++SVL             + + ED+ +    +  R KKQ V GES  FS SS+ +K  +K   +  LI+ AI    +DFLK L++ Q++++  CMY +T +   +II EGE G H++V A G++ V+KDG+ L  M  G  FGELA+L NC RTASVKA+++A  W ++R V+QAI+ K+ +Q+  E  KFL+SV+L K L  ++L KI   L M+ +  GE I++EGE G TF+II  G+V+V Q ++G  +PQ+IR L  GDYFGE+ALL E+ RTASV+A +  VE L +DRE F +LIG   EL  K+Y D     Q++S   I ++     + +    +     LEV++TLG+GGFG+VEL++   D +  +ALK L K++IVE +Q+EHI SE+KI++  +  FI  LY+TF+DNKYVY+LMEACLGGE+WT LR++  FD+   +F +   I A  YLHSK IIYRDL+PEN++ D +G+VKL DFGFAK +G+G KT+TFCGTPEYVAPEIILNKGHD +VD W++GIL +ELLTGSPPF   +PM  YN ILKG++ VEF + I + A  LIK LC+DNP ERLGY K+GI+ I  HK+F GF+W  L  + +TP I P++    D   FD + +   +P DE SGWD++F
Sbjct:   24 KMGNGASASHVVVEGEALDIVKLRTLLSE---LKRELRQKEEQIEQYQYQVEDLTKSLAFKENDVQKLEREIDKLRSVLELTVHKDGKPDILATIQEDSVMVGQAT--RGKKQGVSGESTNFSRSSVALKHFDKDFRSKQLIKDAI--LDNDFLKNLDKAQLREVIDCMYERTTQKGQFIITEGEAGQHLFVSAEGELNVLKDGRSLGTMTAGRAFGELAILYNCTRTASVKALSDARLWVLDRSVFQAIMMKTGLQRQAENIKFLRSVSLLKRLPSEKLAKIASVLEMDFFHEGECIIREGEAGDTFFIINKGEVEVQQKLKGFSDPQKIRNLKRGDYFGEKALLSEDYRTASVVAKAPGVECLTIDRESFTQLIGDLNELREKDYGDEARNAQRASESDIPASPGRQKMERELANVGLHQ-LEVLATLGLGGFGRVELIQLSTDRTKTYALKCLKKKHIVETRQQEHIYSEKKIMMNARSNFIARLYRTFKDNKYVYMLMEACLGGELWTILRDRGHFDEVTARFCVACVIEAFDYLHSKGIIYRDLKPENLLLDTKGYVKLVDFGFAKRVGHGSKTWTFCGTPEYVAPEIILNKGHDHAVDYWSLGILMYELLTGSPPFSTSDPMKTYNIILKGIDVVEFTQHIRKNAQNLIKKLCRDNPAERLGYQKNGIADIKKHKWFQGFDWHGLHRQILTPPIQPRVRGPTDFSNFDNYPKDKDIPQDELSGWDNDF 749          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: Q6USR9 (cGMP-dependent protein kinase OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 338/731 (46.24%), Postives = 479/731 (65.53%), Query Frame = 2
Query:  290 SRNSPNFVINDEKYDEKKVKELI-QTNNVLSQE---IEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVL--------YQKSQ-----VVEDNTLHRSESNLRSKKQVVYGESFS---LSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            + ++ +F I+ E  D  KVK L+ +  + L +    IE+   ++ +KD  +++   E+  L++   K+KSVL         Q+S+      +++N    +     +KKQ V GES S   L  +++  HEK   +  LI+ AI S  ++F+K L   Q+++I  CMY K V    YII+ GE G H+YV A G +EV K+ K+L ++  G LFGELA+L NC RTASVKAVT  + W ++R+V+QAI+ K+ +Q+ EE   FL+SV L K+L  D+L K+ D L  + +   EYI++EG  G TF+I+  G+VKV Q + G  EP+E+R L  GDYFGE+ALL E+ RTA+VIA    VE L +DRE F + +G   EL +K+Y D     ++ S      +      +  +++    +DL++++TLG+GGFG+VELV+   +    FALK L K++IVE +Q+EHI SE+KI++E   PFI +L+KTFRD KYVY+LME CLGGE+WT LR++  FDD   +F +   + A  YLH+K IIYRDL+PEN++ D RG+VKL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELL G+PPF G +PM  YN ILKG++ +EF +KI+R+A  LIK LC+DNP ERLGYGK+GIS I  +K+F GF+W+ L+   +TP I+PK++N  DT  FD +     +  DE SGWD +F
Sbjct:    5 ASSNTHFTIDGESMDVHKVKALVPELRHELRRRDKIIEQYDSQVRQKDELLKEKEAEIARLKEEVHKLKSVLQLKVDTLKAQESKPDLLSTIDENQAEPTAPRGPAKKQGVSGESPSSKTLGYVDLTHHEKDFKSKQLIKDAILS--NEFIKVLAATQLREIIDCMYEKRVPKACYIIKGGERGEHLYVCADGLLEVHKEDKRLGEIKSGGLFGELAILYNCKRTASVKAVTHTTLWVLDRRVFQAIMMKTGLQRREENMAFLKSVPLLKNLPSDKLAKMSDVLEYDFFHENEYIIREGAAGDTFFILNKGEVKVTQKIAGHAEPKEVRRLKRGDYFGEKALLSEDRRTANVIALPPGVECLTVDRESFTQFVGDLNELRNKDYGDEARGAERRSGSDSTVSPVSERPVAKEFENCSLDDLQLVTTLGMGGFGRVELVQLSKEKGKTFALKCLKKKHIVETRQQEHIYSEKKIMMEADSPFITKLHKTFRDRKYVYMLMEVCLGGELWTILRDRGNFDDLTARFCVACVLEAFSYLHAKGIIYRDLKPENLLLDARGYVKLVDFGFAKKIGVGKKTWTFCGTPEYVAPEIILNKGHDHSADYWSLGILMYELLNGTPPFSGSDPMRTYNIILKGIDHIEFPKKISRSAHVLIKKLCRDNPMERLGYGKNGISDIRKNKWFQGFDWDGLMDLTLTPPIVPKVKNPTDTSNFDSYPRDMDIAADELSGWDIDF 733          
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Match: A0A1B6FHY7 (Uncharacterized protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.23298 PE=4 SV=1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 337/755 (44.64%), Postives = 481/755 (63.71%), Query Frame = 2
Query:  206 NSQTNSNLTNHLGINKVNNYPNLNKITTSRNSPNFVINDEKYDEKKVKELIQTNNVLSQEIEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRS--------ESNLRSKKQVVYGESF----SLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQ---QSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIG-NGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
             + TN+   N  G+   N + + NK   +  S        +++EK  +        L +E+  L + +  KD  I +L  EV+       K+KSVL Q +    D+ L  S         S    KKQ V  ES     + + I+++ ++K   +  +I+ AI    +DFLK L+  Q++++ + MY +      Y+I+EGE G H+YV A G+ EVIK+ K L  M PG+ FGELA+L NC RTAS++ V ++  W ++R+V+Q I+ ++ +Q+ E+   FL+SV L  +LS D L+KI D L +E Y  G +IV++G  G TF+I+  G VKV Q   G  E Q++R L  GDYFGE+ALLKE+ RTA+VIA +  VE L LDRE FI+LIG   EL+ KEY D    ++   +S+++P E        +    Q +Q  DL++++TLGVGGFG+VELV+  ++ S  +ALK L KQ+IVE  Q+EH+ SE++I++  + PFIC LYKTF+D+KYVY+++EACLGGE+WT LR++  FDD    FI    I A+ YLHSKNI+YRDL+PEN++ D+RG+VKL DFGFAK +G N  KT+TFCGTPEYVAPEIILNKGHD +VD WA+GIL  ELLTG+PPF G +PM +YN ILKG++ V+F R + RTA  LIK LC+D P ERLG  K G++ I  +++F GF+W+ L  + + P I+P++ + +DT  FD + +   VP DE S WD +F
Sbjct:   80 GASTNNKEKNGHGLCSTNPFVDCNKGVEAPASLR------QWEEKTAE--------LGEELTTLRREVKLKDHEILRLQREVH-------KLKSVLQQAASFRPDSDLLSSLHGHGLSQSSGTAHKKQGVSAESSQPSQTATDIQIQRYDKDFRSKQMIKEAIMD--NDFLKNLDLSQVRELVESMYPREFTKGSYVIREGEVGAHLYVSAEGEFEVIKENKVLGRMGPGKAFGELAILYNCTRTASIRVVKDSKVWVLDRRVFQRIMMRTGLQRLEDNVNFLRSVPLLHNLSTDVLSKISDVLEVEFYPTGHHIVRQGASGDTFFILSQGSVKVTQRQPGSSEDQDLRVLHRGDYFGEQALLKEDCRTATVIALAPGVECLTLDRESFIQLIGDLSELHEKEYSDLSRTERPPSRSNSVPSE--------VDQDLQNVQLEDLDIVATLGVGGFGRVELVQCLHEKSKTYALKCLKKQHIVETHQQEHVYSEKEIMMSCRHPFICRLYKTFKDSKYVYMMLEACLGGEVWTILRDRGCFDDLSACFITACVIEALDYLHSKNIVYRDLKPENLLLDSRGYVKLVDFGFAKRLGLNSSKTWTFCGTPEYVAPEIILNKGHDRAVDCWALGILMHELLTGAPPFSGSDPMKIYNMILKGIDMVDFPRHVTRTAQALIKKLCRDMPAERLGCQKGGLADIKKNRWFQGFDWDGLRHQTLVPPIVPQVRSPVDTSNFDHYAKDPQVPYDEDSNWDADF 803          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 281/578 (48.62%), Postives = 405/578 (70.07%), Query Frame = 2
Query:  725 MYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIG---------QNY-ELNSKEYEDYKIKKQQSSTIPIE--STXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            MY +T +   ++I++GEPG H++VLA G ++V ++ K L  +     FGELA+L NC RTASVKA +    W ++R+V+  I++ +   + E+++ FL+SV+L  SL +D+LTKIVD L +E Y  G+Y+++EGEEG TFYII  GKVKV Q+ +   EPQ I TL  GDYFGE+AL+ +++R+A++IAD D VE L++DRE F + +G         Q Y E  +++ +    K+  S+T P    S  +  +  KN    +  ++LE+I+TLG+GGFG+VELV+ KN++ + FALK + K++IV+ +QEEHI SER+IL E   PFI ++Y+TF+D+KYVY+L+EACLGGEIW+ LR++  F++   KF +G    A +YLH+K IIYRDL+PEN++ D+ G+VKL DFGFAK +  G+KT+TFCGTPEYVAPEIILNKGH  SVD WA+GIL FELLTGSPPF G + M+ Y  ILKG+EK++F +KI++    LI+ LCK NP+ERLG  K+GI  I  H++FTGF+W  L ++ +   +  +++   D  YFD +  ++ +P DE SGWD +F
Sbjct:  191 MYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQSTKDHEEPQVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTFDELKKYLQGYVETLARDDKKRNAKRSGSNTPPSSPLSLDRIQLREKNFTSTLSFSNLEIIATLGIGGFGRVELVKVKNEN-VTFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDSDGYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDFPKKISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWDMDF 767          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg1b (protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:ZDB-GENE-080225-40])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 305/676 (45.12%), Postives = 430/676 (63.61%), Query Frame = 2
Query:  401 KRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESFS-LSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKN-FVPLDETSGWDDEF 2422
            +RI E + R+ +   E+ +L++   K +SVL   + ++   T  R    + ++ Q     SF  L+S  ++ H KS+ +  LI+ AI    +DF+K LE            S+  +    II+EG+ G  +YV+  GK+EV K+G KL  M PG++FGELA+L NC RTA+V+ +T    W I+R+ +Q I+ ++ + +  EY +FL+SV  F+ L+++ L+K+ D L    Y  GEYI+++G  G TF+II  GKV V +       P  +R L  GD+FGE+AL  E+IRTA+VIA +D V  L++DR+ F  LIG   +++SK YED   K +  +     S  K                  +I TLGVGGFG+VELV+ K++ +  FA+K L K++IV+ +Q+EHI SE+ I+ E    FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  F+D  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP+ERLG  K+G+  I  HK+F GFNWE L    +TP IIP + +  DT  FD F E +   P D+ SGWD +F
Sbjct:   17 ERIREMELRLAEKEEEIAELKRKLHKCQSVL-PSAPLMGPRT--RRAQGISAEPQPF--TSFQQLTSEALRKHAKSDRSKELIKEAI--LDNDFMKNLE-----------LSQIQEIESCIIKEGDVGSLVYVMEDGKVEVTKEGMKLCTMGPGKVFGELAILYNCTRTATVQTLTNVKLWAIDRQCFQTIMMRTGLIKHAEYMEFLKSVPTFQGLAEEILSKLADVLEETHYDDGEYIIRQGARGDTFFIISKGKVNVTREDSPSDTPVYLRALGKGDWFGEKALQGEDIRTANVIA-ADAVTCLVIDRDSFKHLIGGLDDVSSKGYEDAGAKAKYEAENAFFSNLKLAD-------------FNIIDTLGVGGFGRVELVQLKSEETKTFAMKILKKRHIVDTRQQEHIRSEKHIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPDVSSPTDTSNFDSFPEDSEDPPPDDNSGWDTDF 660          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: ENSAMXT00000002114.2 (cGMP-dependent protein kinase 2-like [Source:NCBI gene;Acc:103041230])

HSP 1 Score: 543.502 bits (1399), Expect = 0.000e+0
Identity = 287/622 (46.14%), Postives = 413/622 (66.40%), Query Frame = 2
Query:  596 SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNS--KEY-------EDYKIKKQQSS----TIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            SIE     K      LI  AI +  +DFLKKLE Q  +++  CMY K   AN  +IQEGEPG ++YVLA G +EVI++GK L  M PG  FGELA+L NC RTA+VKAVT++  W ++R+ +Q+I+ +S   + EEY  FL+SV+L K L +++L KIVD L ++ +  GEYI++EGEEG TF+II  G+V V Q+ +G  EP EI+ L  GDYFGE+AL+ E++R+A++IA  ++ + L++DR++F +++G   EL +  +EY       ++ +I   QS     +      +  +              L++I+TLG+GGFG+VELV+ KN+ +  FALK + K++IV+ +Q+EHI SE+ IL +    FI  L++TFRD KYVY+L+E CLGGE+W+ LR+ + F++   +F +G  + A  YLH   I+YRDL+PEN++ D  G+VK+ DFGFAK IG G+KT+TFCGTPEYVAPE+I+NKGHD   D W++GIL FELL GSPPF G +P+ +Y  +L G+EKV+  ++I++    LI+ LCK NP ERLG  K+GI  I  HK+F GFNWE L  +++   +  +L   +D  +FD F  +   P DE SGWD +F
Sbjct:  152 SIERTRIRKDSGIKKLINEAIMN--NDFLKKLEPQHTREMVDCMYEKVYTANQLVIQEGEPGNYLYVLAEGLLEVIQNGKLLGQMRPGTAFGELAILYNCKRTATVKAVTQSHIWALDRQTFQSIMMRSTQARHEEYFSFLRSVSLLKDLPEEKLAKIVDCLEIDYFDKGEYIIREGEEGNTFFIIAKGEVSVTQSTEGYSEPLEIKILGVGDYFGEKALISEDVRSANIIAKENDTQCLVVDRDNFNQMVGTYEELQAYLREYVEQLSINDERRIAATQSPLYERSPQAAELRSLHEKAARLSSCSFLQQLQIIATLGMGGFGRVELVKLKNEDT-AFALKCIKKKHIVDTRQQEHIYSEKNILQQTNCNFIVRLFRTFRDEKYVYMLLEVCLGGELWSVLRDMSFFEEATARFCIGCVLEAFDYLHGMGIVYRDLKPENLLLDAEGYVKMTDFGFAKRIGLGKKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILIFELLIGSPPFSGSDPIKIYTMVLHGIEKVDIPKRISKRPEDLIRRLCKLNPAERLGNKKNGIIDIKKHKWFQGFNWEGLRRRKLASPLRRELNGPLDHSHFDMFPPELEEPPDELSGWDKDF 770          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 519.62 bits (1337), Expect = 1.125e-173
Identity = 266/575 (46.26%), Postives = 381/575 (66.26%), Query Frame = 2
Query:  725 MYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEY---------EDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            MY +T +   ++I++GEPG H++VLA G ++V ++ K L  +     FGELA+L NC RTASVKA +    W ++R+V+  I++ +   + E+++ FL+SV+L  SL +D+LTKIVD L +E Y  G+Y+++EGEEG TFYII  GKVKV Q+ +   EPQ I TL  GDYFGE+AL+ +++R+A++IAD D VE L++DRE F + +G   EL  K+Y          D K +  +   I + S++                                  V+ KN++ + FALK + K++IV+ +QEEHI SER+IL E   PFI ++Y+TF+D+KYVY+L+EACLGGEIW+ LR++  F++   KF +G    A +YLH+K IIYRDL+PEN++ D+ G+VKL DFGFAK +  G+KT+TFCGTPEYVAPEIILNKGH  SVD WA+GIL FELLTGSPPF G + M+ Y  ILKG+EK++F +KI++    LI+ LCK NP+ERLG  K+GI  I  H++FTGF+W  L ++ +   +  +++   D  YFD +  ++ +P DE SGWD +F
Sbjct:  191 MYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVEYYDKGDYVIREGEEGNTFYIIARGKVKVTQSTKDHEEPQVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTFDEL--KKYLQGYVETLARDDKKRNAKWFLIAVCSSQ----------------------------------VKVKNEN-VTFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDSDGYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDFPKKISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWDMDF 728          
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:103030142])

HSP 1 Score: 516.924 bits (1330), Expect = 1.559e-172
Identity = 262/578 (45.33%), Postives = 385/578 (66.61%), Query Frame = 2
Query:  725 MYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIG---------QNY-ELNSKEYEDYKIKKQQSSTIPIE--STXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            MY +T +   ++I++GEPG H++VLA G ++V ++ K L  +     FGELA+L NC RTASVKA +    W ++R+V+  I++ +   + E+++ FL+SV+L  SL +D+LTKIVD L + +      + Q  ++ +                    EPQ I TL  GDYFGE+AL+ +++R+A++IAD D VE L++DRE F + +G         Q Y E  +++ +    K+  S+T P    S  +  +  KN    +  ++LE+I+TLG+GGFG+VELV+ KN++ + FALK + K++IV+ +QEEHI SER+IL E   PFI ++Y+TF+D+KYVY+L+EACLGGEIW+ LR++  F++   KF +G    A +YLH+K IIYRDL+PEN++ D+ G+VKL DFGFAK +  G+KT+TFCGTPEYVAPEIILNKGH  SVD WA+GIL FELLTGSPPF G + M+ Y  ILKG+EK++F +KI++    LI+ LCK NP+ERLG  K+GI  I  H++FTGF+W  L ++ +   +  +++   D  YFD +  ++ +P DE SGWD +F
Sbjct:  191 MYERTYQQGEFVIKQGEPGNHLFVLADGNIDVYQNNKLLTSIAVWTTFGELAILYNCTRTASVKAASGVRTWVLDREVFHNIMRMTAEARHEQHRSFLRSVSLLASLPEDKLTKIVDCLEVVK------VTQSTKDHE--------------------EPQVINTLQKGDYFGEKALISDDVRSANIIADEDGVECLVIDRETFTQTVGTFDELKKYLQGYVETLARDDKKRNAKRSGSNTPPSSPLSLDRIQLREKNFTSTLSFSNLEIIATLGIGGFGRVELVKVKNEN-VTFALKCIKKRHIVDNRQEEHIHSERRILSETNSPFIVKMYRTFKDSKYVYMLLEACLGGEIWSMLRDRGSFEENTAKFCVGCVTEAFEYLHNKAIIYRDLKPENLMLDSDGYVKLVDFGFAKKMKCGQKTWTFCGTPEYVAPEIILNKGHGLSVDFWALGILIFELLTGSPPFTGSDQMMTYTFILKGMEKMDFPKKISKRPGDLIRKLCKQNPSERLGNMKNGIMDIKKHRWFTGFSWSGLKARTLNSPLKREVKGPTDHSYFDNYPPEDEIPPDEISGWDMDF 741          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002200.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 353.214 bits (905), Expect = 2.390e-115
Identity = 156/311 (50.16%), Postives = 220/311 (70.74%), Query Frame = 2
Query: 1490 LEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            ++VI+TLGVGGFG+V+LV+ K D  + FALK L K+++VE +Q+EH+ SE++IL E   PFI   Y+TFRD K+V+LLMEACLGGE+W+ LR+   F +   +F +   + A+ YLH++ I+YRDL+PEN++ D RG++K+ DFGFAK +  GRK +TFCGTPEYV PE+I+N+GHD   D WA+G+L +ELL G PPF G +PM  YN IL G+E+V F  ++ + A  +I+ LC+ NP+ERLG  K G+  +  HK+F GF+WE+L S ++   +  ++    D   FD F E   VP DETSGWD +F
Sbjct:   34 MDVIATLGVGGFGRVQLVKLK-DSDVTFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVRFYRTFRDQKFVFLLMEACLGGELWSVLRDSGGFQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDARGYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVHFPNEVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESLRSNQLASPLKREVSGPTDFKNFDWFPEDLDVPPDETSGWDHDF 343          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002201.1 (pep scaffold:Pmarinus_7.0:GL479132:31244:36797:-1 gene:ENSPMAG00000001993.1 transcript:ENSPMAT00000002201.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 288.5 bits (737), Expect = 1.380e-91
Identity = 137/308 (44.48%), Postives = 193/308 (62.66%), Query Frame = 2
Query: 1499 ISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            I+TLGVGGFG+V+LV+ K D  + FALK L K+++VE +Q+EH+ SE++IL E   PFI                     GG           F +   +F +   + A+ YLH++ I+YRDL+PEN++ D RG++K+ DFGFAK +  GRK +TFCGTPEYV PE+I+N+GHD   D WA+G+L +ELL G PPF G +PM  YN IL G+E+V F  ++ + A  +I+ LC+ NP+ERLG  K G+  +  HK+F GF+WE+L S ++   +  ++    D   FD F E   VP DETSGWD +F
Sbjct:    1 IATLGVGGFGRVQLVKLK-DSDVTFALKCLKKKFVVESRQQEHVYSEKRILQECSCPFIVR-------------------GG-----------FQEVSARFCVACVVEALAYLHARGILYRDLKPENLLLDARGYIKMADFGFAKKLACGRKAWTFCGTPEYVCPEMIVNRGHDRGADCWALGVLVYELLAGVPPFSGTDPMKTYNAILWGMERVHFPNEVGKRAEDIIRRLCRQNPSERLGNQKHGVGDVRKHKWFQGFDWESLRSNQLASPLKREVSGPTDFKNFDWFPEDLDVPPDETSGWDHDF 277          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 232.261 bits (591), Expect = 2.469e-70
Identity = 110/268 (41.04%), Postives = 178/268 (66.42%), Query Frame = 2
Query: 1574 ALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEK 2377
            +LK+  +  +V+LKQ EH ++E++IL  I FPF+  L  +F+DN  +Y+++E   GGE+++HLR    F +  ++F     +LA +YLHS ++IYRDL+PEN++ D +G++++ DFGFAK +  GR T+T CGTPEY+APEIIL+KG++ +VD WA+G+L +E+  G PPF  D+P+ +Y KI+ G  KV F    +     L++ L + + T+R G  K+G++ I NHK+F+  +W A+  +++    IPK +   D   FD + E+
Sbjct:    8 SLKATKRTKVVKLKQVEHTLNEKRILQAISFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV-KGR-TWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG--KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYQRKVEAPFIPKCKGPGDASNFDDYEEE 271          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.682 bits (522), Expect = 2.958e-58
Identity = 119/350 (34.00%), Postives = 196/350 (56.00%), Query Frame = 2
Query: 1322 DREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHS-KNIIYRDLEPENMVFDNRGFVKLCDFGFAKL-IGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQ 2365
            +RE+++R I Q      ++ ED  +  + SS     ST++ + I+      +  N+ + +  LG G FGKV LVR K      +A+K L K+ IV   +  H ++E ++L   K PF+  L  +F+ +  +  +ME   GGE++ HL  + VF +  T+F     + A+ YLH+ KN++YRDL+ EN++ D  G +K+ DFG  K  I +G    TFCGTPEY+APE++ +  +  +VD W +G++ +E++ G  PF   +   ++  IL  +E + F R ++  A  L+  L K +P +RLG G D    IM H +F G  W+ +  ++MTP   P++ +  DT YFD+
Sbjct:   95 EREEWLRAI-QTVADRLQQQEDETMDCKPSSPEDGSSTEQMDTILSKPKSKVTMNNFDYLKLLGKGTFGKVILVREKAT-GQYYAMKILKKEVIVAKDEVAHTLTENRVLQTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELIL--MEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDE 440          
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.052 bits (497), Expect = 2.337e-55
Identity = 105/293 (35.84%), Postives = 168/293 (57.34%), Query Frame = 2
Query: 1490 LEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLE-IKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAK-LIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFD 2362
             + ++ LG G FGKV L +HK+D  + +A+K + K  I++ K+E+HI++ER +L++ ++ PF+  L+ +F+    +Y +M+   GGE++ HL+ +  F +   +F       AI YLHS NI+YRDL+PEN++ D +G + L DFG  K  I     T TFCGTPEY+APE++    +D +VD W +G + +E+L G PPF       +Y  IL   + ++        A+ +++ L   +P +RLG   D I  I NH +F+  NW  L +K +     P +    D H FD
Sbjct:   92 FDFLTVLGKGSFGKVLLAKHKSD-GIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILH--QPLQLRPCTTNAAISVLEGLLHKDPHQRLGATSD-ILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFD 380          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 230.335 bits (586), Expect = 1.466e-68
Identity = 117/299 (39.13%), Postives = 183/299 (61.20%), Query Frame = 2
Query: 1490 LEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNI-DTHYFDQFTEKNF 2383
             +++ TLG G FG+V LVR  ++    +A+K L KQ +V++KQ EH   ER++L  ++ PF+  ++ TF+D + ++++M+   GGE+++ LR    F + + KF     ILA++YLH+ NIIYRDL+PEN++ D  G +K+ DFGFAK +     T+T CGTP+Y+APE+I  K ++ SVD W++G+L +E+L G  PF    PM  Y KIL+G  KV +    +   V L+  L   + T R+G  + G   I  H +F+   WE LL+K++     P + + I DT  FDQ+ E+  
Sbjct:   70 FQIMRTLGTGSFGRVHLVRSVHN-GRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT--VTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQG--KVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSGIGDTSLFDQYPEEQL 363          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 230.335 bits (586), Expect = 1.894e-68
Identity = 118/299 (39.46%), Postives = 183/299 (61.20%), Query Frame = 2
Query: 1490 LEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEM-TPVIIPKLENNIDTHYFDQFTEKNF 2383
             +++ TLG G FG+V L+R  N +   +ALK+L K  IV+LKQ EH   ER++L  +  PFI  ++ TF+D++ V+++M+   GGE+++ LR    F + + KF      LA++YLHSK+IIYRDL+PEN++ D  G +K+ DFGFAK + +   T+T CGTP+Y+APE++  K ++ SVD W+ G+L +E+L G  PF     M  Y  IL    +++F    +  A  L+K L   + +ERLG  ++G   + NH +F    WE LL++ + TP   P  +   DT  FD++ E+ F
Sbjct:   88 FQILRTLGTGSFGRVHLIR-SNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNA--ELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEEF 381          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 224.942 bits (572), Expect = 2.107e-66
Identity = 113/298 (37.92%), Postives = 179/298 (60.07%), Query Frame = 2
Query: 1490 LEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEM-TPVIIPKLENNIDTHYFDQFTEKN 2380
             +++ TLG G FG+V L+R +++    +A+K L K+ +V LKQ EH   ER +L  +  PFI  ++ TF+D + ++++M+   GGE+++ LR    F + + KF      LA++YLHSK+IIYRDL+PEN++ D  G +K+ DFGFAK + +   T+T CGTP+Y+APE++  K ++ S+D W+ GIL +E+L G  PF     M  Y KIL    ++ F    N     L+  L   + ++RLG  ++G   + NH +F    WE LLS+ + TP   P  +   DT  FD++ E++
Sbjct:   87 FQILRTLGTGSFGRVHLIRSRHN-GRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNA--ELRFPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEED 379          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 219.935 bits (559), Expect = 7.090e-62
Identity = 117/304 (38.49%), Postives = 181/304 (59.54%), Query Frame = 2
Query: 1490 LEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKL-IGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFD-QFTEKNFVPLD 2395
             +++  +G G FGKV  VR K D   V+ALK++ K YIV   +  H ++ER +L  +  PFI  L  +F+  + +Y ++    GGE++ HL+ +  FD    +F     + A+  LH  +++YRDL+PEN++ D +G + LCDFG  KL + +  KT TFCGTPEY+APE++L  G+  +VD W +G+L +E+LTG PP+  ++   +Y KIL+  E + F    +R A  L+  L   +PT RLGY  +G   I NH +F+  +W+ LL K   P   P + N++DT  FD +FT +   P+D
Sbjct:  347 FDLLKVIGKGSFGKVMQVR-KKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ--EPLVFPDGFDRDAKDLLIGLLSRDPTRRLGY--NGADEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREK--PID 643          
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 214.157 bits (544), Expect = 6.377e-60
Identity = 116/304 (38.16%), Postives = 183/304 (60.20%), Query Frame = 2
Query: 1490 LEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKL-IGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQ-FTEKNFVPLD 2395
             +++  +G G FGKV  VR K D   ++ALK+L K YIV   +  H ++ER +L  +  PFI  L  +F+  + +YL++    GGE++ HL+++  F    ++F +   + A+  LH  ++IYRDL+PEN++ D +G + LCDFG  KL + +  KT TFCGTPEY+APEI+L +G+  +VD W +GIL +E++TG PP+  +   ++Y KIL+  + + F    +  A  L+  L   +P+ RLG   +G   I NH +F   +W+ LL K   P   P +++ IDT  FDQ FT++   P+D
Sbjct:  344 FDLLKVIGKGSFGKVMQVR-KKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQ--QPLLFPDGFDPAAKDLLIGLLSRDPSRRLGV--NGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEK--PID 640          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 314/681 (46.11%), Postives = 438/681 (64.32%), Query Frame = 2
Query:  395 LHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESFSL-----SSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            L + +  KD  IR+L  E+       DK +SVL   +            S  R+++Q +  E  S      SS  ++ H K+  +  LI+ AI    +DFLK LE  Q++++ +CM  +  K + YII+E EPG H+YVL  GK +V K+G  L  M PG+ FGELA+L NC RTASV+A T    W I+R+ +Q I+ K+ + ++ E+ +FL+SVNL K L++  L KI D +    Y  GEYI+++G  G TF+IIK+G V + Q      +P  +R L+ G YFGE+AL  E++RTA+ IA    V  L+LDRE F++ IG   ++   +Y+D      Q    P   T       ++++  ++  DL V+ TLG+GGFG+VELV+   D    FALK+L K +IVE +Q++HI+SE+KI++E   PFI  L+KTF+D KY+Y+L+E CLGGE+WT LR++  FDD  T+F +G  I A QYLHSK I+YRDL+PEN++ D  G+ KL DFGFAK IG GRKT+TFCGTPEYVAPEIILNKGHD S D W++GIL +ELLTGSPPF G +PM  YN ILKG++ ++F RKI R A  LIK LC+DNP ERLGY K G+  IM HK+F GFNW+ L S+++   I PK+++ +D   FD +   + +P D+ +GWD +F
Sbjct:    3 LEQELRRKDELIRRLESEL-------DKYRSVLQPPASAGPGG-----RSRARNQRQGISAEPQSAKQVADSSKPLQRHPKNSRSKELIKEAI--LDNDFLKNLEASQVREVVECMCERMFKRDEYIIKEKEPGSHLYVLEEGKCQVTKEGTVLGHMGPGKAFGELAILYNCTRTASVRAQTSGKLWAIDRQTFQTIMMKTGLMRTAEHMEFLRSVNLLKDLAESYLLKIADVIEETFYEEGEYIIRQGARGDTFFIIKSGNVDITQRTNVHSDPVHVRNLSKGAYFGEKALKGEDLRTANCIAGKGGVTCLVLDREAFVQFIGNLDDIQRDQYDD-----SQRGVDP--QTASHLRAQQDEFANVRLEDLTVVKTLGIGGFGRVELVQVAGDKR-TFALKTLKKHHIVETRQQDHIMSEKKIMMESNSPFIVRLHKTFKDKKYLYMLLEVCLGGELWTILRDRGSFDDSTTRFYVGCVIEAFQYLHSKGIVYRDLKPENLLLDGHGYCKLVDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMYELLTGSPPFSGTDPMKTYNIILKGIDMIDFPRKITRNAHALIKKLCRDNPVERLGYQKGGLKDIMKHKWFDGFNWDGLRSRKLNSPIAPKIKSPVDASNFDDYPADDDIPPDDMTGWDKDF 661          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO38399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCY8])

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 300/653 (45.94%), Postives = 423/653 (64.78%), Query Frame = 2
Query:  551 RSKKQVVYGESF------SLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEAL----------------------LSKEMTPV-IIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            + K+Q V GES       S +  E++   K   +  LI+ AI   ++DFLK LE  Q+++I  CMYS T + N  IIQEG+ G  +Y +A G+++V ++ K L +M  G +FGELA+L NC RTA+V A+     W I+R+V+Q I+ ++ M +  E+  FL+SV L K L   EL+K+ D L ++ Y  G+YI++E E G TFYII  G  +V Q ++G   P+EIR L  GDYFGE+ALL E+ RTA+VIA+ + VE L++DR  F+ +IG   EL  K+Y D K   +++  +P E        +  ++  +   DLEV++TLG GGFG+VELV         +ALK L K++I++ +Q+EH+ SE++IL+E   PFIC++Y+TF+D KYVY+L+EACLGGE+WT LR++  F+D   +F +   +   +YLHSK I+YRDL+PEN++ D +G+VKL DFGFAK IG+GRKT+TFCGTPEYVAPEIILNKGHD S D W++GIL FELLTGSPPF   +PM  YN IL+G++ VEF ++I R    LIK LCKDNP ERLGY KDG+S I  HKY     W  L                      LS + +P+ ++ ++E++ D   FD +++   +P DE SGWD+ F
Sbjct:   19 KEKRQAVSGESSTKAQEESRTGKELERFPKDFRSKQLIKDAI--FENDFLKNLEAAQVREIVDCMYSNTFQRNDVIIQEGDAGNALYAIADGRLQVTRENKVLGEMVAGMVFGELAILYNCRRTATVTAMEPTKLWKIDRRVFQIIMMRTGMIRQAEHMAFLKSVPLLKELPNAELSKLADVLEVDFYHAGDYIIRENERGDTFYIITKGSARVTQRIEGQTGPKEIRKLQKGDYFGEKALLSEDRRTANVIAEENGVECLVVDRTVFMTVIGNMDELREKDYGDEKRGAKRTLDVPEEE-----RKVSKEFADLTLEDLEVVATLGTGGFGRVELV--------TYALKCLKKKHILDTRQQEHVYSEKRILMETNSPFICKIYRTFKDRKYVYMLLEACLGGELWTILRDRGTFEDATARFCIACVVEGFEYLHSKGIVYRDLKPENLLLDAKGYVKLVDFGFAKKIGSGRKTWTFCGTPEYVAPEIILNKGHDLSSDYWSLGILIFELLTGSPPFSSSDPMKTYNIILRGLDMVEFPKRIGRNPQNLIKRLCKDNPVERLGYQKDGLSDIKKHKYVV--PWFPLAGTHRRDPRTSNQTRFWLMTTTLSFKTSPIYLLIRVESSTDYSNFDVYSKDMDIPPDEMSGWDENF 654          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO35228 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM62])

HSP 1 Score: 248.44 bits (633), Expect = 1.425e-75
Identity = 131/300 (43.67%), Postives = 192/300 (64.00%), Query Frame = 2
Query: 1490 LEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSIL-AIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQ-LIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNF 2383
             E+  TLG G FG+V L R +      +ALK ++   ++ LKQ EH+ +E+ IL+ I+ PFI  L  T  D  ++Y+L+E   GGE++T+LR    F++  T    GS I+ A+ YLH  +I+YRDL+PEN++ D  G VKL DFGFAK + +  KT+T CGTPEY+APEII +KGH+ +VD WA+GIL +E+L G PPF  D P  +Y KIL G  KVE+ + ++ T+ + LIK L   + T RLG  K+G   + NHK+F   +W  +L +++ P I PK+ +  DT  FD + E+++
Sbjct:   18 FELSKTLGTGTFGRVLLARDRRG-GEFYALKIMNISEVIRLKQVEHVQNEKNILMSIEHPFIVNLLWTQHDQTFLYMLLEYACGGELFTYLRTAGRFNNG-TGLFFGSEIVSAMDYLHGHSIVYRDLKPENILLDRDGHVKLTDFGFAKEVHD--KTWTLCGTPEYLAPEIIQSKGHNKAVDWWALGILIYEMLVGYPPFFDDNPFGIYEKILSG--KVEWPKHMDNTSAKDLIKKLLVHDRTRRLGSMKNGSEDVKNHKWFKVIDWNLVLQRKLKPPINPKISHPGDTRNFDDYPEEDW 311          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO31895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWM6])

HSP 1 Score: 213.386 bits (542), Expect = 7.103e-60
Identity = 117/300 (39.00%), Postives = 171/300 (57.00%), Query Frame = 2
Query: 1490 LEVISTLGVGGFGKVELVRH--KNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFD-QFTEKN 2380
             E++  LG G FGKV LVR     D   ++A+K L K+  ++++     + ER IL++++ PFI  L   F+    VYL+++   GG+++T L  + +F +   KF L    LA+ +LH   IIYRDL+PEN++ D  G V L DFG +K   + +KT++FCGT EY+APE++  +GH  + D W+ G+L FE+LTGS PF G +     N ILK   K+   + +   A  L++ L K NP  RLG G  GI  I  H +F+  NWE L  +E+ P   P      D  YFD +FT K 
Sbjct:    9 FELLKVLGQGSFGKVFLVRKVIGADAGTLYAMKVL-KKATLKVRDRMRTMKERDILVDVQHPFIVRLNYAFQTEGKVYLILDFLRGGDLFTRLSKEIMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLDASGHVALTDFGLSKESEHDQKTYSFCGTVEYMAPEVVNRRGHSQAADWWSYGVLMFEMLTGSLPFQGKDRKDTMNMILKA--KLGMPQFLTPEAQSLLRQLFKRNPLNRLGAGDLGIEDIKKHPFFSTINWELLYKREIKPPFKPAAGRADDAFYFDPEFTSKT 305          

HSP 2 Score: 101.293 bits (251), Expect = 3.595e-22
Identity = 65/196 (33.16%), Postives = 110/196 (56.12%), Query Frame = 2
Query: 1580 KSLSKQYIVEL--KQEEHIISERKILLEI-KFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVF-DNRGF---VKLCDFGFAKLI--GNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPF-VG--DEPMIVYNKILKG 2131
            K+  K+Y V++  K ++    E +ILL     P I  L   +   K VY++ME   GGE+   +       +R    I+ +    I +LH + +++RDL+P N+++ D+ G    +++ DFGFAK +   NG    T C T  +VAPE++  +G+DA+ DIW++G+L + +L+G  PF VG  D P ++  +I +G
Sbjct:  376 KADGKEYAVKIFEKPKKDPSEEMEILLRFGHHPNIVHLRDAYEAGKQVYIVMELMRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPESLRIVDFGFAKQMRATNGL-LMTPCYTANFVAPEVLKKQGYDAACDIWSLGVLLYTMLSGLTPFAVGPEDTPSVILKRIGEG 570          
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 203.756 bits (517), Expect = 5.614e-58
Identity = 117/307 (38.11%), Postives = 172/307 (56.03%), Query Frame = 2
Query: 1490 LEVISTLGVGGFGKVELVRHKNDHSM--VFALKSLSKQYIVELKQE-EHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAK-LIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFD-QFTEKNFVPLD 2395
             E++  LG GG+GKV LV+  + HS   +FA+K L K  I+  +++  H  +ER IL  +K PFI +L   F+    +YL++E   GGE++  L  + +F +    F L    +A+++LH + I+YRDL+PEN++ D  G VKL DFG  K  I     T TFCGT EY+APEI+   GH  +VD W++G L +++LTG+PPF  D      +KILKG  K+     +   A   I+ L K +P  RLG      + I  H +F    WE LL+K++ P   P +    D   FD +FT +   P+D
Sbjct:   65 FELLKVLGKGGYGKVFLVKKNHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNILECVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFLEDTACFYLSEISMALEHLHKQGIVYRDLKPENILLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKKTIDKILKG--KLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRHICWEDLLAKKVEPPFRPSISGEEDVSQFDSKFTRQ--TPVD 367          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 319/694 (45.97%), Postives = 443/694 (63.83%), Query Frame = 2
Query:  371 VLSQEIEELHKR---ITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVV-EDNTLHRSESNLRSKKQVVYGESFS-----LSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKN-FVPLDETSGWDDEF 2422
             L ++IEEL +R   I E +  + Q    +  L+   DK +SV+   +Q V + N LH  +   R+K+Q +  E  +     LS + +  + KS  +  LI+ AI    +DF+K LE  QI++I  CMY      +  II+EG+ G  +YV+  GK+EV K+  KL  M PG++FGELA+L NC RTA+VK +T    W I+R+ +Q I+ ++ + +  EY  FL+SV  F  L +D L+K+ D L    Y+ GEYI+++G  G TF+II  GKV V +      EP  +R+L  GD+FGE+AL  E+IRTASVIA ++ V  L++DR+ F  LIG   +++SK ++D   K +  +                 +  +   D  +I TLGVGGFG+VELV+ K+D +  FA+K L K++IV+ +Q+EHI SE+ I+ E    FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  F+D  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL FELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP ERLG  K+G+  I  HK+F GFNWE L    +TP IIP + + +DT  FD F E N   P D+ SGWD +F
Sbjct:   10 ALQEKIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQNELHEQQ---RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAI--LDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLPNGEPVYLRSLGKGDWFGEKALQGEDIRTASVIA-AEAVTCLVIDRDSFKHLIGGLEDVSSKGHDDADAKAKYEA-------------ENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNVTSPVDTSNFDSFPEDNEDPPPDDNSGWDVDF 684          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg2 (protein kinase cGMP-dependent 2 [Source:NCBI gene;Acc:101158535])

HSP 1 Score: 559.681 bits (1441), Expect = 0.000e+0
Identity = 279/580 (48.10%), Postives = 394/580 (67.93%), Query Frame = 2
Query:  725 MYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYEL--------------NSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            MY +  +    +I++GEPG H++VLA GK+EV +  K L  +     FGELA+L NC RTASV+AV +   W ++R+ +Q I++++   + E+Y+ FL+SV+L  +L  D+L+KIVD L +E Y  GEYI++EGEEG TFYII  GKVKV Q  +    PQ I  L  GDYFGE+AL+ +++R+A++IAD + VE L++DRE F + +G   EL              + K +    + + QS ++      +   ++         + LEVI+TLGVGGFG+VELV+ K +  + FALK++ K+++VE KQEEHI SER+IL E + PFI  LY+TF+D+KYVY+L+EACLGGE+W+ LR++  FDD   KF +G    A +YLH K ++YRDL+PEN++ D  G+VKL DFGFAK I +G+KT+TFCGTPEYVAPEIILNKGH+ SVD WA+GIL FELLTGSPPF G + M +Y  ILKG+EK++F + I++    LI+ LC+ NP+ERLG  K+GI+ I  H++FTGFNWE L ++ +   +  +L+  +D  YFD +      P DE SGWD++F
Sbjct:  192 MYERNYQQGECVIKQGEPGNHLFVLAEGKLEVFQHNKLLTWITVWTTFGELAILYNCTRTASVRAVNKVKTWALDREAFQNIMRRTAETRHEQYRNFLRSVSLLANLPDDKLSKIVDCLEVEYYDKGEYIIREGEEGSTFYIIAQGKVKVTQTTEAHKLPQIINALQKGDYFGEKALVSDDVRSANIIADDNGVECLVIDRETFDQTVGNFNELQKHLQGYVASLDRDDKKRHLKKSVSRHQSQSLS-PGFMQLKDMVSLFTSSRPFHHLEVIATLGVGGFGRVELVKVKGE-DVTFALKAIKKKHVVENKQEEHIHSERRILAEARSPFIVRLYRTFKDSKYVYMLLEACLGGEVWSLLRDRGSFDDPTAKFCIGCVTEAFEYLHRKGVLYRDLKPENLLLDMEGYVKLVDFGFAKKIRSGQKTWTFCGTPEYVAPEIILNKGHNFSVDFWALGILVFELLTGSPPFSGSDQMTIYTFILKGIEKMDFPKMISKRPEDLIRKLCRRNPSERLGNLKNGITDIKKHRWFTGFNWEGLKARTLASPLKRELKGPMDHSYFDSYPPDEDSPPDELSGWDEDF 769          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: ENSORLT00000001302.2 (cGMP-dependent protein kinase 2 [Source:NCBI gene;Acc:101165996])

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 285/621 (45.89%), Postives = 418/621 (67.31%), Query Frame = 2
Query:  596 SIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELN------------SKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            S    +H+ S++  L+ E AI S  +DFLKKLE Q ++++  CMY K       +IQEG+ G ++YVLA G +EVI++GK L +M+PG  FGELA+L NC RTA+VKAV ++  WT+ER+ +Q I+ ++   + +EY  FL+SV+L K L +++L +IVD L +E +  GEYI++EGEEG TF+II  G+V V Q+ +G  +PQEI+TL  GDYFGERAL+ E++R+A++I + ++ + L++DR++F +++G   EL             S E   +    QQS +   +   +               +LEVI+TLG+GGFG+VELV+ K++ S  FALK + K+++V+ +Q++HI SE+KIL +    FI  L++TFRDNKY+Y+L+E CLGGE+WT LR+ + F+++  +F +G  + A  YLHS  IIYRDL+PEN++ D  G+VK+ DFGFAK IG GRKT+TFCGTPEYVAPE+I+NKGHD   D W++GIL FELLTG+PPF G +P+ +Y  +L G+++V+F ++I +    LI+ LCK NP ER+G  K+GI  I  HK+F GFNWE L  +++   +  +L   +D   FD F   +    DE SGWD +F
Sbjct:  152 STARTVHKNSDTKRLINE-AILS--NDFLKKLEPQHMREMVDCMYEKVYSEGQLVIQEGDAGNYLYVLAEGLLEVIQNGKLLGEMHPGTAFGELAILYNCKRTATVKAVLQSHIWTLERQTFQTIMMQTTQARHQEYFTFLRSVSLLKQLPEEKLGRIVDCLEVEYFEKGEYIIREGEEGNTFFIIAKGQVTVTQSSEGFTQPQEIKTLGVGDYFGERALISEDVRSANIICNENDTQCLVVDRDNFNQMVGTYEELQTYLKEYVGELSKSDERRHFLPHSQQSDSPEAQELSRLRERTARIPANQPFQELEVIATLGMGGFGRVELVKLKDEES-TFALKCIKKKHVVDTRQQQHIYSEKKILQQTNSSFIIRLFRTFRDNKYIYMLLEVCLGGELWTVLRDMSCFEEQTARFCIGCVLEAFDYLHSMGIIYRDLKPENLLLDADGYVKMADFGFAKQIGIGRKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILVFELLTGNPPFSGSDPIKIYTMVLHGIDRVDFPKRIGKRPDDLIRRLCKLNPVERIGNKKNGIMDIKKHKWFQGFNWEGLQGRKLPSPLKRELRGPMDHSNFDMFPPNSEEAPDELSGWDKDF 768          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 305/663 (46.00%), Postives = 425/663 (64.10%), Query Frame = 2
Query:  371 VLSQEIEELHKR---ITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVV-EDNTLHRSESNLRSKKQVVYGESFS-----LSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKL 2332
             L ++IEEL +R   I E +  + Q    +  L+   DK +SV+   +Q V + N LH  +   R+K+Q +  E  +     LS + +  + KS  +  LI+ AI    +DF+K LE  QI++I  CMY      +  II+EG+ G  +YV+  GK+EV K+  KL  M PG++FGELA+L NC RTA+VK +T    W I+R+ +Q I+ ++ + +  EY  FL+SV  F  L +D L+K+ D L    Y+ GEYI+++G  G TF+II  GKV V +      EP  +R+L  GD+FGE+AL  E+IRTASVIA ++ V  L++DR+ F  LIG   +++SK ++D   K +  +                 +  +   D  +I TLGVGGFG+VELV+ K+D +  FA+K L K++IV+ +Q+EHI SE+ I+ E    FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  F+D  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL FELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP ERLG  K+G+  I  HK+F GFNWE L    +TP IIP +
Sbjct:   10 ALQEKIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQVHKQNELHEQQ---RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAI--LDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLPNGEPVYLRSLGKGDWFGEKALQGEDIRTASVIA-AEAVTCLVIDRDSFKHLIGGLEDVSSKGHDDADAKAKYEA-------------ENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNV 653          
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Match: prkg1 (protein kinase cGMP-dependent 1 [Source:NCBI gene;Acc:100049290])

HSP 1 Score: 533.102 bits (1372), Expect = 6.796e-180
Identity = 295/644 (45.81%), Postives = 415/644 (64.44%), Query Frame = 2
Query:  401 KRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKL 2332
            +RI + + R+     E+ +L++   K +SVL   +Q++   T  R    + ++ Q        LS   ++ + KS+ +  LI+ AI    +DF+K LE  QI++I  CMY      +  II+EG+ G  +YV+  GK+EV K+  KL  M PG++FGELA+L NC RTA+VK +T    W I+R+ +Q I+ ++ + +  EY  FL+SV  F  L +D L+K+ D L    Y+ GEYI+++G  G TF+II  GKV V +      EP  +R+L  GD+FGE+AL  E+IRTASVIA ++ V  L++DR+ F  LIG   +++SK ++D   K +  +                 +  +   D  +I TLGVGGFG+VELV+ K+D +  FA+K L K++IV+ +Q+EHI SE+ I+ E    FI  LY+TF+D+KY+Y+LMEACLGGE+WT LR++  F+D  T+F     + A  YLHSK IIYRDL+PEN++ D+RG+ KL DFGFAK IG G+KT+TFCGTPEYVAPEIILNKGHD S D W++GIL FELLTGSPPF G +PM  YN IL+G++ +EF +KI + A  LIK LC+DNP ERLG  K+G+  I  HK+F GFNWE L    +TP IIP +
Sbjct:   17 ERIRDLERRLADREDEIQELKRKLHKCQSVL-PSAQLIGPRT--RRAQGISAEPQT----HQDLSRQALRRYPKSDWSKDLIKEAI--LDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKENLKLCTMGPGKVFGELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMDFLKSVPTFHDLQEDILSKLADVLEETHYAGGEYIIRQGARGDTFFIISKGKVNVTREDLPNGEPVYLRSLGKGDWFGEKALQGEDIRTASVIA-AEAVTCLVIDRDSFKHLIGGLEDVSSKGHDDADAKAKYEA-------------ENAFFFSLNLADFNIIDTLGVGGFGRVELVQLKSDENKTFAMKILKKRHIVDTRQQEHIRSEKLIMQEAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMFELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKNAGNLIKKLCRDNPCERLGNLKNGVKDIQKHKWFEGFNWEGLKKGTLTPPIIPNV 637          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000074822.1 (SMESG000074822.1)

HSP 1 Score: 1451.8 bits (3757), Expect = 0.000e+0
Identity = 778/779 (99.87%), Postives = 779/779 (100.00%), Query Frame = 2
Query:   92 MKKQTPRAQTSNRLXXXXXXXXXXXXXXXKTEIAPNKPNSQTNSNLTNHLGINKVNNYPNLNKITTSRNSPNFVINDEKYDEKKVKELIQTNNVLSQEIEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEFEF 2428
            MKKQTPRAQTSNRLVPIIKANPVPPKPANKTEIAPNKPNSQTNSNLTNHLGINKVNNYPNLNKITTSRNSPNFVINDEKYDEKKVKELIQTNNVLSQEIEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFLKKLEQQQIKQICQCMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKNGKVKVVQNVQGVVEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTKKDNIIIKNKYQIIQKNDLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDL+PENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEFEF
Sbjct:    1 MKKQTPRAQTSNRLVPIIKANPVPPKPANKTEIAPNKPNSQTNSNLTNHLGINKVNNYPNLNKITTSRNSPNFVINDEKYDEKKVKELIQTNNVLSQEIEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNLRSKKQVVYGESFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFLKKLEQQQIKQICQCMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKNGKVKVVQNVQGVVEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTKKDNIIIKNKYQIIQKNDLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLKPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEFEF 779          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000005347.1 (SMESG000005347.1)

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 335/763 (43.91%), Postives = 467/763 (61.21%), Query Frame = 2
Query:  260 NYPNLNKITTSRNSPNFVINDEKYDEKKVKELIQT-NNVLSQEIEELHKRIT----------EKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHR--------------------------SESN-LRSKKQVVYGES---FSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADS-DNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            N   LN+ ++   SPN   N   Y + +++E+I      L +  +ELHK+ T           ++  I  L  E N LR  + K K    + S+V  DN  +R                          ++SN +R+K+  + GES    + + I MK  EK   +  LI  AI    +D++K L+  QI +I +CM   T     +IIQEGE G  +Y L  G +EV K G  +R+M PG +FGELA+L NC RTASV+A TE   W I+R+ +Q+I+ K+ +++ E+Y +FL+SV  F+ ++ + L KI   L    YS G+YI++EGE+G TFYII+ G+VKV +      E   IR L  G +FGE+AL  E++RTAS+IA+S   V+ L+LDRE +  LIG     + K+Y D    ++++S  P                 +   DL VI+TLGVGGFG+VELVR  ND    FALK L K +IVE  Q+EH+++ER IL+E+   FI +LYKTF+D +Y+Y+LME CLGGE+WT LR K  FDD  TKF   S ILA++YLH K I++RDL+PEN + D +G+ KL DFGFAK IG  RKT+TFCGTPEYVAPEIILNKGHD +VDIW++GIL +EL TG+PPF   +PM  YN ILKG++ ++F  KI++ A  LIK LC++NP+ERLGYGK G++    H +F GFNWE LLSK+  P IIP++++ +D   FD ++     P ++ SGWD +F
Sbjct:  119 NNTKLNRASSQILSPNQENNS--YHDNRLEEIIHDLQWALQKRKQELHKKNTIIGHLEMELENRNCLIANLERENNQLRSIFKK-KGNSNKLSKVSMDNNYYRKLPQPPPSRPSNFGAKLSVSVAKSTKTDSNKMRAKRNAISGESAKYLTTNGITMKRVEKPSKSKELIRSAI--YDNDYMKHLDPSQITEIVECMSPVTYHEGSWIIQEGEIGSIVYALEDGLVEVTKSGAIIREMGPGTVFGELAILYNCTRTASVRATTECKLWAIDRQCFQSIMMKTGLRKQEDYIRFLKSVPTFQDMNMETLGKIAGVLGENHYSQGDYIIREGEKGATFYIIEKGRVKVTKKTSKSDEEVFIRHLDRGSWFGEKALRDEDVRTASIIAESPSGVDCLVLDRESYNLLIGDIVNFD-KQYPDEDKARRRASKFP----------------ELALRDLCVITTLGVGGFGRVELVRIGNDDRRTFALKVLKKYHIVETHQQEHVMNERDILMEVDSEFIVKLYKTFKDRRYLYMLMEVCLGGEVWTILREKVSFDDATTKFYTASVILALEYLHRKGIVFRDLKPENCLLDEKGYCKLTDFGFAKKIGFARKTWTFCGTPEYVAPEIILNKGHDFAVDIWSLGILMYELFTGTPPFTSSDPMKTYNIILKGIQTIDFSSKISKHAQSLIKKLCRENPSERLGYGKLGVAEAQKHAWFEGFNWEGLLSKKTKPPIIPQVKSAVDVSNFDLYSPDEETPAEDISGWDKDF 859          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000008788.1 (SMESG000008788.1)

HSP 1 Score: 560.066 bits (1442), Expect = 0.000e+0
Identity = 313/688 (45.49%), Postives = 444/688 (64.53%), Query Frame = 2
Query:  374 LSQEIEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNL--RSKKQVVYGESF-SLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEF--GRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            L  +++   + + EK+ RI +L  E+N       K+ SVL Q    +E N +  S +++  RSKKQ V GES    +++++  ++KS S   L+  +I   ++  L  L   Q+ ++ + MY + +    Y+I EGE G H+YV  SG  EV K  + L  +     FGELA+L NC RTASVKA+T+A  W ++R+V+QAI+ ++ +Q+ EE  +FL+SV L K L + +L K+V+ L ++ +  GE I+++GE    F+II++G VKV Q   G  E Q IRTLT G+YFGE+ALL  E RTA+V A+S   +VL L R+ F+ LIG   EL +K YED K       +         N     K   ++  DLE++ TLGVGGFG+VELVR  +DH   +ALK + K +IV+ KQ++H+ISE+KILLE +  FIC LY TF+D K+VY+LME CLGGE+WT LR+K  FDD +TKF LG  + A  YLHS+ IIYRDL+PEN++    G++KLCDFGFAK IG G++T+TFCGTPEYV+PEIILNK HD + D W++GIL +ELLTG+PPF G++PM +Y  ILKG+E  +    R+I   A   I+ LCK N  ERLG G  G+  I +HKYF GF+WE++  +++     PK+ ++ D   FD F +++ +P DE SGWD+EF
Sbjct:  191 LRNQLKLTQEELNEKNIRIEELQREIN-------KLTSVLDQTQISLESNDMISSVNSIQNRSKKQGVSGESNKDQTNLKLIKYKKSNSIKSLLRESI--LKNLLLSNLPTYQVDEMIEYMYERQIDRGCYVIIEGEEGDHLYVAESGDFEVWKAERLLCYLDGNRCFGELALLYNCRRTASVKALTDAKLWVLDREVFQAIMMRTGIQRQEELLRFLKSVPLLKGLPEIKLNKLVELLELQRHEEGECIIRQGESADCFFIIQSGSVKVTQRYDG--EEQVIRTLTMGEYFGEKALLSAETRTANVYANSSVTDVLCLYRKPFLELIGDLNELKNKNYEDEK----HLLSKSSSKVSICNDAEMEKLVNVKLKDLELVCTLGVGGFGRVELVRLSHDHQSTYALKCMKKYHIVQTKQQDHVISEKKILLECRSIFICRLYNTFKDVKFVYMLMEVCLGGELWTCLRDKIHFDDIITKFCLGCVLEAFDYLHSRGIIYRDLKPENLLITTSGYLKLCDFGFAKRIGIGKRTWTFCGTPEYVSPEIILNKSHDFTSDYWSVGILTYELLTGTPPFTGNDPMKIYTLILKGIEATDIFHNRRITFRASSFIQALCKFNAAERLGNGAGGLEEIKSHKYFQGFDWESIRKQDLVSPFHPKVTSSTDHSNFDDFQDEDELPPDEYSGWDEEF 863          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000007783.1 (SMESG000007783.1)

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 311/682 (45.60%), Postives = 435/682 (63.78%), Query Frame = 2
Query:  401 KRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSESNL-----RSKKQVVYGESFSLSSIE-MKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYIIKXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIADSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEK--VEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            + I EK+ +I +L  E+       DK+KSVL    Q   D +     S+L     RSK+  + GES +    + +    KS     +I  AI +  +  L KL+  Q+ +I +CMY K    N Y+I+EGE G  +YV   G+ EV KD K +  M   + FGELA+L NC RTASVKA+   + W ++R ++Q I+ K+ +++ ++ K FL+SVNLF+ LS+ +L KIV+ + ++ YS G+ I+++GEE  +F+II+ G VKV Q + G  +  E+R +++G+YFGE+ALL+E  RTA++ A     EVL L R+ F  LIG+   L +KEY+D    K   S      ++        K +    ND E+++TLG GGFG+VELV +  D +  +ALK + KQYIV+ KQ++H++SE+KILLE K  +IC LY TF DNKYVYLL E CLGGE+W  LR++  FDD +T F L   + A+ YLHS+ I+YRDL+PEN++  N G++KLCDFGFAK IG G +T+TFCGTPEYVAPEIILNK HD SVD W+IGIL +ELL G+PPFV ++PM +YN  LKG+E+  +    KI   A  LI+ LC+  P ERLG GK+GI  I  HKYF GF+WE + S  +     PK+   IDT  FD+FT ++ +P DE SGWD +F
Sbjct:   53 REIDEKNLKIEELQREI-------DKLKSVL---DQTHSDLSFDHDSSSLNDIKARSKRLGISGESSNHQRFQTLNKFPKSNEVKKVIRQAIMN--NHLLNKLDPSQVNEIIECMYEKHAVENCYVIREGEEGEQLYVAQEGEFEVYKDEKLIGKMSNKKCFGELALLYNCKRTASVKALKTCTLWVLDRTMFQTIMMKTGLERQKDLKTFLESVNLFEHLSERKLLKIVELVEVQSYSDGQCIIRQGEEADSFFIIRTGWVKVTQKING--DEIEVREMSSGEYFGEKALLEEGKRTANIYAVKGPTEVLCLYRQAFSELIGELNVLQAKEYDDESRAKMSLSM----HSRNSAESNNLKRESFHLNDFEIVATLGFGGFGRVELVVNSKDPTKSYALKYMKKQYIVQTKQQDHVMSEKKILLECKSSYICRLYATFHDNKYVYLLTEVCLGGELWAILRDRIHFDDYITSFCLACVLEALSYLHSRGIVYRDLKPENLLVGNSGYLKLCDFGFAKKIGIGGRTWTFCGTPEYVAPEIILNKSHDFSVDFWSIGILTYELLNGAPPFVANDPMKIYNMTLKGIEQSNILHNFKITIKAASLIQRLCRYLPIERLGNGKNGIEEIRMHKYFQGFDWEGMKSMTVKSPFNPKINGPIDTSNFDKFTNESDIPPDENSGWDKDF 716          
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Match: SMESG000016927.1 (SMESG000016927.1)

HSP 1 Score: 535.413 bits (1378), Expect = 1.258e-180
Identity = 293/685 (42.77%), Postives = 433/685 (63.21%), Query Frame = 2
Query:  386 IEELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVL--YQKSQVVEDNTLHRSESNLRSKKQVVYGESFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFXXXXXXXXXXXXXXXMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKLRDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQQSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQTFYII---KXXXXXXXXXXXXXXEPQEIRTLTTGDYFGERALLKEEIRTASVIA-DSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTXXXXXXXXXXXXXXXXXXLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLSKQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLGGEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFDNRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWAIGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKMLCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENNIDTHYFDQFTEKNFVPLDETSGWDDEF 2422
            +++L K + +KD +I +LT ++       DK +SV    QK   V+    H +++ +R        ++  +++ +    +K      LI+ +I   ++DF+K LEQ QIK I  CM      AN  II+EGE G  +YV+  GK+ V K+G  LR+M    +FGELA+L NC RTA+V A+T+   W I+R  +Q+I+ ++ + + EE   FL+SV +FK L +  L KI   L    Y+ G+YI+++G +G TF+II   K    +  +      + Q IR +  G++FGE+AL  E++RTA++IA D   V+ L+LDRE +I+LIG    L  + YED            +  + K+ +    +Y+ +   DL VI+TLG+GGFG+VELV+  ++    +ALK L K +IVE +Q+EHI++ER IL  ++  FI  L++TF+D K++Y+LME CLGGE+W+ LR+++ FD+  TKF     I A+ YLHS+ I+YRDL+PEN++ DN+GF K+ DFGFAK IG GRKT+TFCGTPEYVAPEIILNKGHD   D W++GIL FELLTG PPF   +PM +YN ILKG++ +EF +KI++ A  LIK LC+DNP ER+GYGK G+     H +   FNW+ LLS  + P I+P++ +  D   FD++  +  +P D+ SGWD +F
Sbjct:   19 VKKLEKLLQQKDEKIAELTSQL-------DKYQSVFSATQKQNNVQSGP-HNNQTRVRGLGISAEPQTAKIANFQPSFFQKDSKTKELIKRSI--LENDFMKNLEQSQIKMIVDCMRPVKFAANSIIIKEGEVGSLVYVMEDGKVSVSKEGHHLREMKNETVFGELAILYNCTRTATVTAITDCKLWAIDRHSFQSIMMRTGLLKYEENLNFLKSVPIFKDLEESTLGKISGVLEETHYANGDYIIRQGTKGDTFFIISSGKVQVTRKNKPDDTKEKEQFIRQMQRGEWFGEKALKDEDLRTANIIAADPAGVDCLVLDRESYIQLIGDLTSLQ-RTYED-----------GVNDSPKEILGPSKEYKNLALKDLVVIATLGIGGFGRVELVQIGDNAKKTYALKQLKKHHIVETRQQEHIMNERNILYMVQSDFIVRLHRTFKDRKFLYMLMEVCLGGELWSILRDRSAFDENTTKFYTACVIEALHYLHSRGIVYRDLKPENLLLDNQGFCKITDFGFAKKIGFGRKTWTFCGTPEYVAPEIILNKGHDTYADCWSLGILMFELLTGMPPFTAPDPMKIYNIILKGIDAIEFPKKISKDAQNLIKKLCRDNPNERVGYGKGGVKECQKHLWLESFNWDGLLSHTIKPPIVPQINSPTDCSNFDEYPPETEMPPDDISGWDRDF 681          
The following BLAST results are available for this feature:
BLAST of cGMP-dependent protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKG10.000e+044.88protein kinase cGMP-dependent 1 [Source:HGNC Symbo... [more]
PRKG20.000e+043.50protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG20.000e+043.50protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
PRKG10.000e+045.31protein kinase cGMP-dependent 1 [Source:HGNC Symbo... [more]
PRKG29.572e-17943.08protein kinase cGMP-dependent 2 [Source:HGNC Symbo... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-40.000e+041.98cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+041.98cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+042.72cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+042.72cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-40.000e+043.00cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkg21D0.000e+047.79gene:FBgn0000442 transcript:FBtr0078042[more]
for1.080e-17541.00gene:FBgn0000721 transcript:FBtr0446099[more]
for1.802e-17547.18gene:FBgn0000721 transcript:FBtr0473363[more]
for1.802e-17547.18gene:FBgn0000721 transcript:FBtr0473364[more]
for2.381e-17241.14gene:FBgn0000721 transcript:FBtr0089310[more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg1b0.000e+045.17protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg1b0.000e+044.96protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
prkg20.000e+048.62protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
prkg20.000e+048.62protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
prkg20.000e+048.62protein kinase cGMP-dependent 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk40.000e+045.24calcium/calmodulin-dependent protein kinase IV [So... [more]
camk40.000e+045.24calcium/calmodulin-dependent protein kinase IV [So... [more]
camk40.000e+045.19calcium/calmodulin-dependent protein kinase IV [So... [more]
ptafr0.000e+047.59platelet activating factor receptor [Source:Xenbas... [more]
tnpo24.643e-17841.92transportin 2 [Source:Xenbase;Acc:XB-GENE-968452][more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkg10.000e+044.73protein kinase, cGMP-dependent, type I [Source:MGI... [more]
Prkg20.000e+043.85protein kinase, cGMP-dependent, type II [Source:MG... [more]
Prkg10.000e+045.16protein kinase, cGMP-dependent, type I [Source:MGI... [more]
Prkg21.224e-17943.37protein kinase, cGMP-dependent, type II [Source:MG... [more]
Prkg13.660e-11747.81protein kinase, cGMP-dependent, type I [Source:MGI... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q03042|KGP1_DROME0.000e+047.79cGMP-dependent protein kinase, isozyme 1 OS=Drosop... [more]
sp|O76360|EGL4_CAEEL0.000e+041.98cGMP-dependent protein kinase egl-4 OS=Caenorhabdi... [more]
sp|Q64595|KGP2_RAT0.000e+043.99cGMP-dependent protein kinase 2 OS=Rattus norvegic... [more]
sp|Q13237|KGP2_HUMAN0.000e+043.50cGMP-dependent protein kinase 2 OS=Homo sapiens OX... [more]
sp|Q61410|KGP2_MOUSE0.000e+043.85cGMP-dependent protein kinase 2 OS=Mus musculus OX... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3Z9120.000e+048.10cGMP-dependent protein kinase OS=Lottia gigantea O... [more]
A0A4D5RA320.000e+047.46cGMP-dependent protein kinase OS=Scolopendra virid... [more]
A0A1S3HLV40.000e+045.50cGMP-dependent protein kinase OS=Lingula unguis OX... [more]
Q6USR90.000e+046.24cGMP-dependent protein kinase OS=Aplysia californi... [more]
A0A1B6FHY70.000e+044.64Uncharacterized protein (Fragment) OS=Cuerna arida... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg20.000e+048.62protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
prkg1b0.000e+045.12protein kinase cGMP-dependent 1b [Source:ZFIN;Acc:... [more]
ENSAMXT00000002114.20.000e+046.14cGMP-dependent protein kinase 2-like [Source:NCBI ... [more]
prkg21.125e-17346.26protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
prkg21.559e-17245.33protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002200.12.390e-11550.16pep scaffold:Pmarinus_7.0:GL479132:31244:36905:-1 ... [more]
ENSPMAT00000002201.11.380e-9144.48pep scaffold:Pmarinus_7.0:GL479132:31244:36797:-1 ... [more]
ENSPMAT00000001814.12.469e-7041.04pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
ENSPMAT00000008480.12.958e-5834.00pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
ENSPMAT00000006766.12.337e-5535.84pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TPK21.466e-6839.13cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK31.894e-6839.46cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK12.107e-6637.92cAMP-dependent protein kinase catalytic subunit; p... [more]
YPK17.090e-6238.49S/T protein kinase; phosphorylates, downregulates ... [more]
YPK26.377e-6038.16Protein kinase similar to S/T protein kinase Ypk1p... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO384070.000e+046.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383990.000e+045.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352281.425e-7543.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318957.103e-6039.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411665.614e-5838.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkg10.000e+045.97protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
prkg20.000e+048.10protein kinase cGMP-dependent 2 [Source:NCBI gene;... [more]
ENSORLT00000001302.20.000e+045.89cGMP-dependent protein kinase 2 [Source:NCBI gene;... [more]
prkg10.000e+046.00protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
prkg16.796e-18045.81protein kinase cGMP-dependent 1 [Source:NCBI gene;... [more]
back to top
BLAST of cGMP-dependent protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074822.10.000e+099.87SMESG000074822.1[more]
SMESG000005347.10.000e+043.91SMESG000005347.1[more]
SMESG000008788.10.000e+045.49SMESG000008788.1[more]
SMESG000007783.10.000e+045.60SMESG000007783.1[more]
SMESG000016927.11.258e-18042.77SMESG000016927.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013197 ID=SMED30013197|Name=cGMP-dependent protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2490bp
CGATATTTAATTACATTTTGGTGTCGAACAAATAATCGCCAAACCATGTC
TTCACTTATTATTTATTAATTCGATTTTTGTTTATTTAAAAATGAAGAAA
CAAACCCCAAGAGCGCAGACGTCAAATAGATTGGTACCAATCATAAAAGC
GAATCCCGTTCCTCCAAAGCCAGCCAATAAAACTGAAATTGCTCCGAATA
AGCCAAACTCACAAACCAATAGCAATTTAACCAATCATTTGGGAATAAAT
AAGGTCAATAACTATCCAAATTTAAATAAAATAACCACTAGTCGAAATTC
CCCAAACTTTGTAATCAATGATGAGAAATACGACGAGAAAAAAGTTAAAG
AATTAATACAGACAAACAATGTTCTCAGTCAGGAAATTGAAGAATTACAC
AAAAGAATTACTGAAAAAGATTTCCGAATTCGTCAATTGACTCATGAAGT
CAATGACCTTCGACAGAACTATGACAAAGTAAAATCGGTGTTATATCAGA
AATCACAAGTTGTAGAGGATAACACTTTACATCGATCCGAATCCAATCTT
AGATCAAAGAAACAAGTTGTATATGGAGAAAGCTTTTCACTATCTTCAAT
AGAAATGAAAATTCATGAAAAATCTGAAAGTGCAACTTTACTAATTGAGA
TGGCCATAAAAAGTTGTCAGGATGATTTCCTTAAAAAGCTCGAGCAACAA
CAAATCAAACAGATCTGCCAATGTATGTATTCTAAAACCGTGAAAGCTAA
TGTTTATATCATACAAGAAGGGGAGCCAGGTTATCACATGTATGTACTGG
CAAGTGGTAAAATGGAAGTTATAAAAGACGGAAAGAAATTACGTGATATG
TATCCAGGAGAACTATTTGGTGAATTAGCTGTGCTTCAAAATTGTCTAAG
AACAGCATCGGTCAAAGCTGTCACGGAAGCCTCATTTTGGACAATTGAAC
GAAAAGTTTACCAAGCTATCCTTCAAAAAAGTAATATGCAACAATCAGAA
GAATATAAAAAGTTTTTACAAAGTGTCAATCTTTTTAAAAGCCTTTCTAA
AGACGAATTAACCAAAATTGTGGATGCTTTACTCATGGAGGAGTACTCTC
TCGGAGAATATATTGTCCAAGAAGGAGAAGAAGGACAAACCTTTTACATT
ATAAAAAATGGAAAAGTAAAAGTTGTGCAAAACGTCCAAGGCGTGGTTGA
GCCACAAGAAATTCGCACATTGACGACTGGAGATTATTTTGGAGAAAGAG
CTTTATTAAAAGAAGAAATTAGAACTGCCTCAGTCATCGCGGATTCTGAT
AATGTGGAGGTTTTGCTGTTAGATAGAGAAGATTTCATTCGGCTTATTGG
CCAAAATTACGAATTAAACTCAAAGGAATATGAAGATTACAAAATAAAAA
AGCAACAATCAAGCACAATTCCAATTGAATCCACAAAAAAGGATAACATA
ATAATAAAAAATAAATATCAAATAATACAAAAGAATGATTTAGAAGTCAT
TTCAACTCTCGGTGTTGGTGGATTTGGGAAAGTGGAATTGGTGAGACACA
AAAATGATCATTCTATGGTTTTTGCTCTAAAAAGTCTGAGTAAACAATAT
ATAGTCGAATTGAAACAGGAAGAGCATATCATTTCTGAAAGGAAAATTCT
CCTCGAAATAAAATTTCCATTTATTTGCGAACTTTATAAGACTTTTCGAG
ATAACAAATATGTCTATTTGCTGATGGAGGCATGCCTTGGTGGAGAAATA
TGGACTCATTTGAGAAACAAAACTGTTTTCGACGACAGAATGACTAAATT
CATTCTCGGATCCTCCATTCTTGCAATTCAATACCTTCACTCCAAAAACA
TTATATACAGAGATCTTGAACCGGAAAATATGGTTTTCGACAATCGAGGT
TTTGTAAAATTGTGTGATTTTGGATTTGCAAAATTAATTGGAAATGGAAG
AAAAACATTTACATTTTGCGGGACGCCAGAATACGTAGCTCCGGAAATCA
TATTAAATAAAGGGCATGATGCTTCCGTAGATATTTGGGCAATTGGAATT
TTAGCGTTTGAGCTTCTTACCGGAAGCCCGCCATTTGTTGGAGATGAACC
AATGATAGTCTACAACAAAATTTTGAAAGGAGTTGAAAAAGTGGAATTCG
GACGGAAAATTAATAGAACTGCTGTGCAATTAATCAAAATGTTGTGTAAA
GACAATCCAACAGAAAGACTCGGTTACGGAAAAGATGGAATAAGCGCTAT
CATGAATCACAAATATTTCACAGGTTTTAATTGGGAAGCATTGTTATCTA
AAGAAATGACTCCAGTAATTATTCCAAAACTTGAAAATAATATTGATACT
CACTATTTCGATCAATTTACAGAAAAAAACTTTGTACCCCTCGATGAAAC
TTCAGGATGGGATGATGAATTTGAATTTTAATCATATTTTGTATGTATAA
TTTGTTTGTTTTCTAGAGAGATATTTTCTGTAATAAATAT
back to top

protein sequence of SMED30013197-orf-1

>SMED30013197-orf-1 ID=SMED30013197-orf-1|Name=SMED30013197-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=780bp
MKKQTPRAQTSNRLVPIIKANPVPPKPANKTEIAPNKPNSQTNSNLTNHL
GINKVNNYPNLNKITTSRNSPNFVINDEKYDEKKVKELIQTNNVLSQEIE
ELHKRITEKDFRIRQLTHEVNDLRQNYDKVKSVLYQKSQVVEDNTLHRSE
SNLRSKKQVVYGESFSLSSIEMKIHEKSESATLLIEMAIKSCQDDFLKKL
EQQQIKQICQCMYSKTVKANVYIIQEGEPGYHMYVLASGKMEVIKDGKKL
RDMYPGELFGELAVLQNCLRTASVKAVTEASFWTIERKVYQAILQKSNMQ
QSEEYKKFLQSVNLFKSLSKDELTKIVDALLMEEYSLGEYIVQEGEEGQT
FYIIKNGKVKVVQNVQGVVEPQEIRTLTTGDYFGERALLKEEIRTASVIA
DSDNVEVLLLDREDFIRLIGQNYELNSKEYEDYKIKKQQSSTIPIESTKK
DNIIIKNKYQIIQKNDLEVISTLGVGGFGKVELVRHKNDHSMVFALKSLS
KQYIVELKQEEHIISERKILLEIKFPFICELYKTFRDNKYVYLLMEACLG
GEIWTHLRNKTVFDDRMTKFILGSSILAIQYLHSKNIIYRDLEPENMVFD
NRGFVKLCDFGFAKLIGNGRKTFTFCGTPEYVAPEIILNKGHDASVDIWA
IGILAFELLTGSPPFVGDEPMIVYNKILKGVEKVEFGRKINRTAVQLIKM
LCKDNPTERLGYGKDGISAIMNHKYFTGFNWEALLSKEMTPVIIPKLENN
IDTHYFDQFTEKNFVPLDETSGWDDEFEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR008271Ser/Thr_kinase_AS
IPR035014STKc_cGK
IPR000961AGC-kinase_C
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR002374cGMP_dep_kinase
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0004692cGMP-dependent protein kinase activity
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0030553cGMP binding
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 85..105
NoneNo IPR availableCOILSCoilCoilcoord: 113..133
NoneNo IPR availablePRINTSPR00103CAMPKINASEcoord: 350..364
score: 35.11
coord: 381..390
score: 70.33
coord: 335..349
score: 29.56
coord: 393..404
score: 36.39
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 552..746
e-value: 3.0E-102
score: 343.5
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 465..757
e-value: 3.0E-102
score: 343.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..43
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..16
NoneNo IPR availablePANTHERPTHR24353CYCLIC NUCLEOTIDE-DEPENDENT PROTEIN KINASEcoord: 98..777
NoneNo IPR availablePANTHERPTHR24353:SF90coord: 98..777
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 196..309
e-value: 9.4E-23
score: 91.6
coord: 314..434
e-value: 3.4E-22
score: 89.7
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 333..422
e-value: 2.5E-20
score: 72.3
coord: 215..296
e-value: 2.5E-16
score: 59.5
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 314..436
score: 35.9
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 196..311
score: 29.343
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 196..297
e-value: 1.16834E-21
score: 88.9221
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 314..425
e-value: 6.22007E-29
score: 109.338
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 467..726
e-value: 1.5E-81
score: 286.9
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 468..726
e-value: 7.4E-66
score: 222.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 467..726
score: 44.301
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 727..777
e-value: 2.7E-6
score: 36.9
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 727..779
score: 10.933
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 302..440
e-value: 7.9E-40
score: 137.7
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 166..301
e-value: 1.9E-39
score: 136.4
IPR002374cGMP-dependent kinasePIRSFPIRSF000559cGMP-dep_kinasecoord: 30..777
e-value: 1.3E-265
score: 880.8
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 473..497
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 341..357
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 383..400
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 223..239
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00889CNMP_BINDING_2coord: 259..276
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 587..599
IPR035014cGMP-dependent protein kinase, catalytic domainCDDcd05572STKc_cGKcoord: 473..733
e-value: 1.72747E-139
score: 410.078
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 302..425
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 195..296
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 450..766