Spartin

Overview
NameSpartin
Smed IDSMED30013193
Length (bp)1652
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spartin (SMED30013193) t-SNE clustered cells

Violin plots show distribution of expression levels for Spartin (SMED30013193) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Spartin (SMED30013193) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Spartin (SMED30013193) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013193

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30013193h1SMcG0013417 dd_Smed_v4_3153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013193h1SMcG0013417 dd_Smed_v4_3153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spartin vs. Ensembl Human
Match: SPART (spartin [Source:HGNC Symbol;Acc:HGNC:18514])

HSP 1 Score: 60.4622 bits (145), Expect = 5.649e-9
Identity = 58/235 (24.68%), Postives = 110/235 (46.81%), Query Frame = 1
Query:  805 VVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            +V  + +P+++  E+ E       E +A  + + +  +S G+V GA   G+ + +G+ +L  R++P E   +++P V  GL  A+  T    +VS      +         + APH+    + L+P   K K + G+ S +D   +VA S +QG   V+  L   A     + +    + +R++YG   G+ T +A+ +A N+G+ A        K ++K  A  T   +   Y+
Sbjct:  402 IVPCEPVPEEKPKELPE-----WSEKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLK-KDKDGK-SPLDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQ 629          
BLAST of Spartin vs. Ensembl Human
Match: SPART (spartin [Source:HGNC Symbol;Acc:HGNC:18514])

HSP 1 Score: 60.4622 bits (145), Expect = 5.649e-9
Identity = 58/235 (24.68%), Postives = 110/235 (46.81%), Query Frame = 1
Query:  805 VVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            +V  + +P+++  E+ E       E +A  + + +  +S G+V GA   G+ + +G+ +L  R++P E   +++P V  GL  A+  T    +VS      +         + APH+    + L+P   K K + G+ S +D   +VA S +QG   V+  L   A     + +    + +R++YG   G+ T +A+ +A N+G+ A        K ++K  A  T   +   Y+
Sbjct:  402 IVPCEPVPEEKPKELPE-----WSEKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLK-KDKDGK-SPLDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQ 629          
BLAST of Spartin vs. Ensembl Human
Match: SPART (spartin [Source:HGNC Symbol;Acc:HGNC:18514])

HSP 1 Score: 60.4622 bits (145), Expect = 5.649e-9
Identity = 58/235 (24.68%), Postives = 110/235 (46.81%), Query Frame = 1
Query:  805 VVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            +V  + +P+++  E+ E       E +A  + + +  +S G+V GA   G+ + +G+ +L  R++P E   +++P V  GL  A+  T    +VS      +         + APH+    + L+P   K K + G+ S +D   +VA S +QG   V+  L   A     + +    + +R++YG   G+ T +A+ +A N+G+ A        K ++K  A  T   +   Y+
Sbjct:  402 IVPCEPVPEEKPKELPE-----WSEKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLK-KDKDGK-SPLDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQ 629          
BLAST of Spartin vs. Ensembl Human
Match: SPART (spartin [Source:HGNC Symbol;Acc:HGNC:18514])

HSP 1 Score: 60.4622 bits (145), Expect = 5.649e-9
Identity = 58/235 (24.68%), Postives = 110/235 (46.81%), Query Frame = 1
Query:  805 VVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            +V  + +P+++  E+ E       E +A  + + +  +S G+V GA   G+ + +G+ +L  R++P E   +++P V  GL  A+  T    +VS      +         + APH+    + L+P   K K + G+ S +D   +VA S +QG   V+  L   A     + +    + +R++YG   G+ T +A+ +A N+G+ A        K ++K  A  T   +   Y+
Sbjct:  402 IVPCEPVPEEKPKELPE-----WSEKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLK-KDKDGK-SPLDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQ 629          
BLAST of Spartin vs. Ensembl Human
Match: SPART (spartin [Source:HGNC Symbol;Acc:HGNC:18514])

HSP 1 Score: 60.4622 bits (145), Expect = 5.649e-9
Identity = 58/235 (24.68%), Postives = 110/235 (46.81%), Query Frame = 1
Query:  805 VVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            +V  + +P+++  E+ E       E +A  + + +  +S G+V GA   G+ + +G+ +L  R++P E   +++P V  GL  A+  T    +VS      +         + APH+    + L+P   K K + G+ S +D   +VA S +QG   V+  L   A     + +    + +R++YG   G+ T +A+ +A N+G+ A        K ++K  A  T   +   Y+
Sbjct:  402 IVPCEPVPEEKPKELPE-----WSEKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLK-KDKDGK-SPLDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQ 629          
BLAST of Spartin vs. Ensembl Celegans
Match: spg-20 (SPG (Spastic paraplegia) [Source:UniProtKB/TrEMBL;Acc:O44735])

HSP 1 Score: 50.0618 bits (118), Expect = 2.964e-6
Identity = 78/369 (21.14%), Postives = 145/369 (39.30%), Query Frame = 1
Query:  475 AEILFSITSECQYTKISPDGE-FDIPSYPGSLEIYKYPSDTD-----NKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDTSKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIGEEL-PKTKGEIIADGLNTVSRQLSKGVVVGASKLG--------ELVSRGSDE-------LCLRLKPGEAKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNK 1515
            A++++ +    Q   I  DGE    P+ P SL+I ++P  TD     +   F+ V  WA  L+   TP+L    G  +           VA   P N    +    I + S +   ++++  I   + ++  E+  P T  E+  +  N +S  +S  ++ G  K+          ++SR  D        L    KP   +++P +K  + Y   GT  + + +      +               +S    L  S  +  G+      V     + G G+ G+  V+ SL DG+    R  A    + ++ +YG++   TT +AL+AAG+  L A        + +    A+   +++ +      K
Sbjct:  122 ADLIYFLPEGVQLFTI--DGEKTTAPTAPTSLQILRFPQPTDGGASSDTLAFMQVGPWAYPLMGAKTPVLRNEFGAYL-----------VANPTPEN---PNMTVAILLSSDIERRLIEELHIVLREFTDFKEQAEPST--ELSKEEKNRISTTISNFLIKGGQKIAWGVETTTVRVISRVEDNGEQYRTTLIATDKP--MQVSPVIKGSVVYMHKGTKTVAKCTRYLLDKIGDMG-----------VSMGKKLADSAQRRFGDGKSGGLVSGTIEILGGGITGVATVWMSLEDGSRHLCRSIANQTVQNVKLKYGDDASDTTHHALFAAGHGTLAAAQLWDLGPRSVAGRMARKAGIQMVSDLHHSRK 459          
BLAST of Spartin vs. Ensembl Fly
Match: spartin (gene:FBgn0037265 transcript:FBtr0078861)

HSP 1 Score: 65.4698 bits (158), Expect = 6.839e-11
Identity = 76/308 (24.68%), Postives = 135/308 (43.83%), Query Frame = 1
Query:  628 WAGTLIENVTPILITPQGVLMFLDNE---KDDTSKVAVTLPFNVSK-----EDFQRCICIL--STLAVIVVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPG--EAKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKG---ECGELSKVDQIAL-VAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            W   L+ ++T    T  G  +F D E     +   + +T     S+     ED Q+    L  + LA  VV  K  P  Q + +  +   +  E ++  + + +  ++  +V GA K G  + R +  +  ++ P   +A++  +V+T +E A+  THA   ++G   G +  A+       APHI    + L+     +KG   +  E +   + A+ +A   ++G+  VFD L   A   G   + +  KI+ H+YG++ G          GN+ +V+      T KGI K   K T   V + YK
Sbjct:  228 WLYPLVPSITNCYQTEYGAFIFPDMECQQPGNAFGLMLTKEGQTSRTEDELEDLQQFFLDLLEAVLAGTVVQLKS-PTSQRAGLASDT-VSGSEQVSRHIVSAADFIASNLVRGAEKTGGFMLRSTPYIISKMTPASMDAQVPSSVQTSVEVAQKVTHAAAGMTGWIAGKVGTASMAVGRYLAPHIQEQGSKLL-----QKGFGYDTSEANSTMEGAMTIAAGAVEGVSTVFDGLETSAKILGSSLSENSVKIIEHKYGQQTGNLASGTFDTVGNVFVVSQNVNYITPKGIAKKMVKRTGEAVVSDYK 528          
BLAST of Spartin vs. Ensembl Fly
Match: spartin (gene:FBgn0037265 transcript:FBtr0308820)

HSP 1 Score: 65.4698 bits (158), Expect = 6.839e-11
Identity = 76/308 (24.68%), Postives = 135/308 (43.83%), Query Frame = 1
Query:  628 WAGTLIENVTPILITPQGVLMFLDNE---KDDTSKVAVTLPFNVSK-----EDFQRCICIL--STLAVIVVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPG--EAKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKG---ECGELSKVDQIAL-VAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            W   L+ ++T    T  G  +F D E     +   + +T     S+     ED Q+    L  + LA  VV  K  P  Q + +  +   +  E ++  + + +  ++  +V GA K G  + R +  +  ++ P   +A++  +V+T +E A+  THA   ++G   G +  A+       APHI    + L+     +KG   +  E +   + A+ +A   ++G+  VFD L   A   G   + +  KI+ H+YG++ G          GN+ +V+      T KGI K   K T   V + YK
Sbjct:  228 WLYPLVPSITNCYQTEYGAFIFPDMECQQPGNAFGLMLTKEGQTSRTEDELEDLQQFFLDLLEAVLAGTVVQLKS-PTSQRAGLASDT-VSGSEQVSRHIVSAADFIASNLVRGAEKTGGFMLRSTPYIISKMTPASMDAQVPSSVQTSVEVAQKVTHAAAGMTGWIAGKVGTASMAVGRYLAPHIQEQGSKLL-----QKGFGYDTSEANSTMEGAMTIAAGAVEGVSTVFDGLETSAKILGSSLSENSVKIIEHKYGQQTGNLASGTFDTVGNVFVVSQNVNYITPKGIAKKMVKRTGEAVVSDYK 528          
BLAST of Spartin vs. Ensembl Zebrafish
Match: sparta (spartin a [Source:ZFIN;Acc:ZDB-GENE-080204-37])

HSP 1 Score: 118.627 bits (296), Expect = 6.775e-28
Identity = 114/385 (29.61%), Postives = 176/385 (45.71%), Query Frame = 1
Query:  478 EILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDTDNK------KGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKD-DTSKVAVTLPFNVS---KEDFQRCICILSTLAVIVVDQ------------KQIPDDQISEIGEELPKTK---GEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIETVDSAEKQK 1551
            EI+F + S  Q   +S +G    PSYPG L I  Y  D+D          ++ V DW   L  +  P+L++  GV  F D       S V V L  ++    ++ FQ  + +L+ L V V ++            ++IP  + S+  EE  KT     E ++  +   S  L +G+V GA   G+ + RG  +L   + P E  A+++P V  GL  A+  T    +VS      +A        + APH+      LIP   K KG+ G  SK+D   LVAGS +QGL  ++ SL     T G+  +      +RH+YG+E GQ  + A+ +  N+G+ A        KG+LK   K T  E+     +  K  E  D + K++
Sbjct:  190 EIMF-LPSGVQMFFVSAEGRVTAPSYPGYLRIIIYSQDSDGSANTGYAPAYLQVCDWIYPLYPDF-PVLLSNNGVFTFPDTTAAVPGSYVGVVLSSDLPAGERDLFQEQLSVLAQLRVQVDEEGGGATGADTNLSEKIPLSEASQTPEE--KTAPVWSEKMSQSILAGSSWLGRGLVRGAEATGKAIQRGGTKLRDNITPEETPAEVSPKVTKGLNAAKQATGGAVKVSQFLVDGVAAVAGKVGKELAPHVKKHGCKLIPESLK-KGKDGS-SKMDGAKLVAGSSIQGLSTLWSSLETAGKTIGKSLSSETVTTVRHKYGDEAGQAADTAVQSTVNVGVTAFNMDNVCLKGVLKATGKQTTKEIVKDTPKGEK-TEDKDKSPKKR 567          
BLAST of Spartin vs. Ensembl Zebrafish
Match: spartb (spartin b [Source:ZFIN;Acc:ZDB-GENE-060825-146])

HSP 1 Score: 108.227 bits (269), Expect = 1.911e-24
Identity = 99/371 (26.68%), Postives = 165/371 (44.47%), Query Frame = 1
Query:  475 AEILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDTDNK-----KGFIVVSDWAGTLIENVTPILITPQGVLMFLDN-EKDDTSKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIGEE--------------------LPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
             E LF +    Q   ++P+G    PSYPG L I K+ S+   +       F+ V DW   L+ + +P+L+   GV MF D       S V V L   + +++ +    +LS L  + V       D I+ +G++                    LP+   E +A G+ T +  LS G+V GA   G+ + +G+ +L   + P +  A+++P V   L  A+  T    +VS      L     +   + APH+      LIP   K+  +    S +D   +VA SG+QG   ++  L   A    +  A      ++H+YG + GQ T++A+ +A N+G+ A        K ++K   K TA  + + YK
Sbjct:  206 GEELFFLPQGVQIFFVTPEGHVSAPSYPGYLRIVKFTSEHSERIPNRPPAFLQVCDWLYPLMSSDSPVLLCNTGVYMFPDMMSPTPGSYVGVVLSSELPQKERELFQNVLSQLTDLRVQASDGATDTIN-LGQKVSLGPPAAEAAPSAAEEEKVLPEWS-EKVAHGILTGASWLSWGLVKGAEYTGKAIHKGASKLREHITPEDKPAQVSPTVTKSLHVAKQATGGAVKVSQFLVDGLCTVAGHVGRELAPHVKKHGGKLIPESMKKDKDG--RSNIDGAMVVAASGVQGFATMWTGLEVAAKNIAKSVATETVTTVKHKYGPDAGQATDHAVNSAINVGVTAFNIDNLGIKAMVKKTGKETAHALLSDYK 572          
BLAST of Spartin vs. Ensembl Xenopus
Match: spart (spartin [Source:NCBI gene;Acc:100170472])

HSP 1 Score: 97.4413 bits (241), Expect = 9.672e-21
Identity = 104/372 (27.96%), Postives = 167/372 (44.89%), Query Frame = 1
Query:  469 VTAEILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDTDNK------KGFIVVSDWAGTLIENVTPILITPQGVLMFLD-NEKDDTSKVAVTLPFNVS---KEDFQRCICILSTL-------AVIVVDQKQ-IPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAKL--NPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIE 1524
            V AE L  I    Q   ++ DG    PSYPG L I K+  DT+++        F+ V DW   L+   +P+L T  GV MF D   +   S V V L   +    +E F+  +  +S L       A  V+D  Q +    I E  E+      E +A G+ + +  +S G+  GA    + + +G+ +L   ++P +  L  +P V  GL  A+  T    +VS      +         + APH+    + L+P   K K + G+ S +D    VA SG+QG   V+  L        +  A      ++H+YG++ G  T+NA+++A N+G  A        K ++K  AK T+  +  +YK + K  E
Sbjct:  219 VDAEELILIPQGVQIFFVTADGLVTAPSYPGYLRIIKF-MDTNSEVAQNRPPAFLQVCDWLYPLMCTQSPVLRTNTGVYMFPDVMSQLPGSYVGVVLSSELPIADQELFEDLLRQMSDLRIQPSEAASEVIDVSQTVHIITIPEEEEKELPEWSEKVAQGILSGASWISWGLAKGAELTEKAIHKGASKLREHIQPEDKPLEVSPTVAKGLHVAKQATGGAVKVSQFLVDGVCSIASCVGRELAPHVKKHGSKLLPESLK-KDKDGK-SPLDGAMAVAASGVQGFATVWQGLEFAGKNIAKSVASETVHTIKHKYGKDAGHVTDNAVHSAMNVGATAFNIDNIGIKALVKKTAKETSHAILDEYKINKKQDE 587          
BLAST of Spartin vs. Ensembl Xenopus
Match: spart (spartin [Source:NCBI gene;Acc:100170472])

HSP 1 Score: 70.0922 bits (170), Expect = 3.859e-12
Identity = 86/315 (27.30%), Postives = 136/315 (43.17%), Query Frame = 1
Query:  469 VTAEILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDTDNK------KGFIVVSDWAGTLIENVTPILITPQGVLMFLD-NEKDDTSKVAVTLPFNVS---KEDFQRCICILSTL-------AVIVVDQKQ-IPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAKL--NPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRY 1353
            V AE L  I    Q   ++ DG    PSYPG L I K+  DT+++        F+ V DW   L+   +P+L T  GV MF D   +   S V V L   +    +E F+  +  +S L       A  V+D  Q +    I E  E+      E +A G+ + +  +S G+  GA    + + +G+ +L   ++P +  L  +P V  GL  A+  T    +VS      +         + APH+    + L+P   K K + G+ S +D    VA SG+QG   V+  L        +  A      ++H+Y
Sbjct:  219 VDAEELILIPQGVQIFFVTADGLVTAPSYPGYLRIIKF-MDTNSEVAQNRPPAFLQVCDWLYPLMCTQSPVLRTNTGVYMFPDVMSQLPGSYVGVVLSSELPIADQELFEDLLRQMSDLRIQPSEAASEVIDVSQTVHIITIPEEEEKELPEWSEKVAQGILSGASWISWGLAKGAELTEKAIHKGASKLREHIQPEDKPLEVSPTVAKGLHVAKQATGGAVKVSQFLVDGVCSIASCVGRELAPHVKKHGSKLLPESLK-KDKDGK-SPLDGAMAVAASGVQGFATVWQGLEFAGKNIAKSVASETVHTIKHKY 530          
BLAST of Spartin vs. Ensembl Xenopus
Match: spart (spartin [Source:NCBI gene;Acc:100170472])

HSP 1 Score: 62.7734 bits (151), Expect = 7.598e-10
Identity = 84/293 (28.67%), Postives = 131/293 (44.71%), Query Frame = 1
Query:  469 VTAEILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDTDNK------KGFIVVSDWAGTLIENVTPILITPQGVLMFLD-NEKDDTSKVAVTLPFNVS---KEDFQRCICILSTL-------AVIVVDQKQ-IPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAKL--NPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQG----LIMVF 1275
            V AE L  I    Q   ++ DG    PSYPG L I K+  DT+++        F+ V DW   L+   +P+L T  GV MF D   +   S V V L   +    +E F+  +  +S L       A  V+D  Q +    I E  E+      E +A G+ + +  +S G+  GA    + + +G+ +L   ++P +  L  +P V  GL  A+  T    +VS      +         + APH+    + L+P   K K + G+ S +D    VA SG+QG    LI++F
Sbjct:  219 VDAEELILIPQGVQIFFVTADGLVTAPSYPGYLRIIKF-MDTNSEVAQNRPPAFLQVCDWLYPLMCTQSPVLRTNTGVYMFPDVMSQLPGSYVGVVLSSELPIADQELFEDLLRQMSDLRIQPSEAASEVIDVSQTVHIITIPEEEEKELPEWSEKVAQGILSGASWISWGLAKGAELTEKAIHKGASKLREHIQPEDKPLEVSPTVAKGLHVAKQATGGAVKVSQFLVDGVCSIASCVGRELAPHVKKHGSKLLPESLK-KDKDGK-SPLDGAMAVAASGVQGNLHQLIILF 508          
BLAST of Spartin vs. Ensembl Mouse
Match: Spg20 (spastic paraplegia 20, spartin (Troyer syndrome) homolog (human) [Source:MGI Symbol;Acc:MGI:2139806])

HSP 1 Score: 100.138 bits (248), Expect = 9.743e-22
Identity = 99/377 (26.26%), Postives = 172/377 (45.62%), Query Frame = 1
Query:  442 QNQNEPRELVT----AEILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDT-----DNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNE-KDDTSKVAVTLPFNVSKED---FQRCICILSTLAVIVVDQKQ-------IPDDQISE-IGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            +N+++P  L T    A+ L  I +  Q   ++P GE   PSYPG L I ++  ++     +   GF+ V DW   L+ + +P+L    G  MF D   +     V V L   + ++D   F+  +  +S L +   D  +       +P +  SE   +ELP+   E +A  + + +  +S G+V GA   G+ + +G+ +L  R++P E   +++P V  GL  A+  T    +VS      +         + APH+    + L+P   K   +    S +D   +VA S +QG   V+  L   A     + +    + +R++YG   G+ T NA+ +A N+GL A        K ++K  AK T   +   Y+
Sbjct:  203 RNRSQPPPLETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTVGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQTKDSSEEVNLSQIVPCEPSSEEKSKELPEWS-EKVAHNILSGASWVSWGLVKGAEFTGKAIQKGASKLRERIQPEEKPVEVSPAVTRGLYIAKQATGGAAKVSQLLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKRDKDGK--SALDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGHNAGEATHNAVDSAINVGLTAYNIDNIGIKAMVKKTAKQTGHTLLEDYQ 576          
BLAST of Spartin vs. Ensembl Mouse
Match: Spg20 (spastic paraplegia 20, spartin (Troyer syndrome) homolog (human) [Source:MGI Symbol;Acc:MGI:2139806])

HSP 1 Score: 65.0846 bits (157), Expect = 1.349e-10
Identity = 59/222 (26.58%), Postives = 103/222 (46.40%), Query Frame = 1
Query:  844 EIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            E  +ELP+   E +A  + + +  +S G+V GA   G+ + +G+ +L  R++P E   +++P V  GL  A+  T    +VS      +         + APH+    + L+P   K   +    S +D   +VA S +QG   V+  L   A     + +    + +R++YG   G+ T NA+ +A N+GL A        K ++K  AK T   +   Y+
Sbjct:  415 EKSKELPEWS-EKVAHNILSGASWVSWGLVKGAEFTGKAIQKGASKLRERIQPEEKPVEVSPAVTRGLYIAKQATGGAAKVSQLLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKRDKDGK--SALDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGHNAGEATHNAVDSAINVGLTAYNIDNIGIKAMVKKTAKQTGHTLLEDYQ 633          
BLAST of Spartin vs. Ensembl Mouse
Match: Spg20 (spastic paraplegia 20, spartin (Troyer syndrome) homolog (human) [Source:MGI Symbol;Acc:MGI:2139806])

HSP 1 Score: 65.0846 bits (157), Expect = 1.349e-10
Identity = 59/222 (26.58%), Postives = 103/222 (46.40%), Query Frame = 1
Query:  844 EIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            E  +ELP+   E +A  + + +  +S G+V GA   G+ + +G+ +L  R++P E   +++P V  GL  A+  T    +VS      +         + APH+    + L+P   K   +    S +D   +VA S +QG   V+  L   A     + +    + +R++YG   G+ T NA+ +A N+GL A        K ++K  AK T   +   Y+
Sbjct:  415 EKSKELPEWS-EKVAHNILSGASWVSWGLVKGAEFTGKAIQKGASKLRERIQPEEKPVEVSPAVTRGLYIAKQATGGAAKVSQLLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKRDKDGK--SALDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGHNAGEATHNAVDSAINVGLTAYNIDNIGIKAMVKKTAKQTGHTLLEDYQ 633          
BLAST of Spartin vs. UniProt/SwissProt
Match: sp|A0JNJ3|SPART_BOVIN (Spartin OS=Bos taurus OX=9913 GN=SPART PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.212e-10
Identity = 63/230 (27.39%), Postives = 110/230 (47.83%), Query Frame = 1
Query:  823 IPDDQISE-IGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            +P + +SE   +ELP+   E +A  + + +  +S G+V GA   G+ + +G+ +L  R++P E   +++P V  GL  A+  T    +VS      +         + APH+    + L+P   K K   G+ S +D   +VA S +QG   V+  L   A     + +    + +R++YG   G+ T NA+ +A N+G+ A        K ++K  AK T   +   YK
Sbjct:  403 VPCEPVSEEKAKELPEWS-EKVAHNILSGASWVSWGLVKGAEFTGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYMAKQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLK-KDRNGK-STLDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGHTAGEATHNAVDSAINVGVTAYNIDNIGIKAMVKKTAKQTGHTLLEDYK 629          
BLAST of Spartin vs. UniProt/SwissProt
Match: sp|Q9VN45|SPART_DROME (Protein spartin OS=Drosophila melanogaster OX=7227 GN=spartin PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 6.855e-10
Identity = 76/308 (24.68%), Postives = 135/308 (43.83%), Query Frame = 1
Query:  628 WAGTLIENVTPILITPQGVLMFLDNE---KDDTSKVAVTLPFNVSK-----EDFQRCICIL--STLAVIVVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPG--EAKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKG---ECGELSKVDQIAL-VAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            W   L+ ++T    T  G  +F D E     +   + +T     S+     ED Q+    L  + LA  VV  K  P  Q + +  +   +  E ++  + + +  ++  +V GA K G  + R +  +  ++ P   +A++  +V+T +E A+  THA   ++G   G +  A+       APHI    + L+     +KG   +  E +   + A+ +A   ++G+  VFD L   A   G   + +  KI+ H+YG++ G          GN+ +V+      T KGI K   K T   V + YK
Sbjct:  228 WLYPLVPSITNCYQTEYGAFIFPDMECQQPGNAFGLMLTKEGQTSRTEDELEDLQQFFLDLLEAVLAGTVVQLKS-PTSQRAGLASDT-VSGSEQVSRHIVSAADFIASNLVRGAEKTGGFMLRSTPYIISKMTPASMDAQVPSSVQTSVEVAQKVTHAAAGMTGWIAGKVGTASMAVGRYLAPHIQEQGSKLL-----QKGFGYDTSEANSTMEGAMTIAAGAVEGVSTVFDGLETSAKILGSSLSENSVKIIEHKYGQQTGNLASGTFDTVGNVFVVSQNVNYITPKGIAKKMVKRTGEAVVSDYK 528          
BLAST of Spartin vs. UniProt/SwissProt
Match: sp|Q8R1X6|SPART_MOUSE (Spartin OS=Mus musculus OX=10090 GN=Spart PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 8.212e-10
Identity = 59/222 (26.58%), Postives = 103/222 (46.40%), Query Frame = 1
Query:  844 EIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            E  +ELP+   E +A  + + +  +S G+V GA   G+ + +G+ +L  R++P E   +++P V  GL  A+  T    +VS      +         + APH+    + L+P   K   +    S +D   +VA S +QG   V+  L   A     + +    + +R++YG   G+ T NA+ +A N+GL A        K ++K  AK T   +   Y+
Sbjct:  415 EKSKELPEW-SEKVAHNILSGASWVSWGLVKGAEFTGKAIQKGASKLRERIQPEEKPVEVSPAVTRGLYIAKQATGGAAKVSQLLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKRDKDGK--SALDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGHNAGEATHNAVDSAINVGLTAYNIDNIGIKAMVKKTAKQTGHTLLEDYQ 633          
BLAST of Spartin vs. UniProt/SwissProt
Match: sp|Q8N0X7|SPART_HUMAN (Spartin OS=Homo sapiens OX=9606 GN=SPART PE=1 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.713e-8
Identity = 58/235 (24.68%), Postives = 110/235 (46.81%), Query Frame = 1
Query:  805 VVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            +V  + +P+++  E+ E       E +A  + + +  +S G+V GA   G+ + +G+ +L  R++P E   +++P V  GL  A+  T    +VS      +         + APH+    + L+P   K K + G+ S +D   +VA S +QG   V+  L   A     + +    + +R++YG   G+ T +A+ +A N+G+ A        K ++K  A  T   +   Y+
Sbjct:  402 IVPCEPVPEEKPKELPE-----WSEKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIAKQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLK-KDKDGK-SPLDGAMVVAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVTAYNINNIGIKAMVKKTATQTGHTLLEDYQ 629          
BLAST of Spartin vs. TrEMBL
Match: A0A1S3J385 (spartin-like OS=Lingula unguis OX=7574 GN=LOC106169408 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.147e-37
Identity = 121/374 (32.35%), Postives = 181/374 (48.40%), Query Frame = 1
Query:  439 IQNQN-EPRELVTAEILFSITSECQYTKISPDGEFDIPSYPGSLEIYKY-------PSDTDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDN-EKDDTSKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIGEELPKTKGEI--------IADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAKLN--PNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            + N+N EP     AE ++SI    Q   I+P G    PSYP +L I+K+        S     +GF+ V DW   L    +P+L    G  MF D     + S V + LP ++   + +    IL +L  +   ++ +P ++  E   E P+  G I        I+ GL T +  +S G+   + K GEL+  G+ ++   LKP E + N  P V+ GL YAR GT    +VSG     L +AT     + APHI      L+P E K   + G  SK+D +  VAG GL+GL  V++ L   A   G+  A     +++H+YGE++G  TE++LY AG++ +      +   K I K AAK T   V   YK
Sbjct:  145 MTNENGEPSLETNAEAVYSIPEGVQIYWITPQGYVSAPSYPAALHIFKFKEQEPQGASSIPRPEGFLKVGDWVYPLQPGRSPVLHARNGAYMFPDVLSAQEGSAVGLMLPPDLPTSERENFEGILHSLTAL--QEEPLPTER-PEPPSEAPREPGIIEEDRTSAKISRGLVTAAEWVSWGLGKASEKGGELLKMGAVKMKEHLKPEEQQPNVDPRVQKGLVYARKGTGVAVKVSGFLVNKLGEATMLLGRQLAPHIKKHGTRLLPKELKASDQEGR-SKIDNVLEVAGGGLKGLGTVYNGLEVAAKALGKSIATQTVDVVQHKYGEQVGSATEHSLYTAGHIVMTGYNVKEMGIKAIAKRAAKDTGKAVLEDYK 514          
BLAST of Spartin vs. TrEMBL
Match: A0A1S3I878 (spartin-like OS=Lingula unguis OX=7574 GN=LOC106161929 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.748e-34
Identity = 123/399 (30.83%), Postives = 183/399 (45.86%), Query Frame = 1
Query:  439 IQNQN-EPRELVTAEILFSITSECQYTKISPDGEFDIPSYPGSLEIYKY-------PSDTDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLD---------------------NEKDDT-----SKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIGEELPKTKGEI--------IADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAKLN--PNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            + N+N EP     AE ++SI    Q   I+P G    PSYP +L I+K+        S     +GF+ V DW   L    +P+L    G  MF D                     N K  +     S V + LP ++   + +    IL +L  +   ++ +P ++  E   E P+  G I        I+ GL T +  +S G+   + K GEL+  G+ ++   LKP E + N  P V+ GL YAR GT    +VSG     L +AT     + APHI      L+P E K   + G  SK+D +  VAG GL+GL  V++ L   A   G+  A     +++H+YGE++G  TE++LY AG++ +      +   K I K AAK T   V   YK
Sbjct:  145 MANENGEPSMETNAEAMYSIPEGVQIYWITPQGYVSAPSYPAALHIFKFKEQEPQGASSIPRPEGFLKVGDWVYPLQPGRSPVLHARNGAYMFPDVLSAQDEIGEKPTEYGPEPGLNSKKKSVLFSGSAVGLMLPPDLPTSERENFEGILHSLTAL--QEEPLPTER-PEPPSEAPREPGIIEEDRTSAKISRGLVTAAEWVSWGLGKASEKGGELLKMGAVKMKEHLKPEEQQPNVDPRVQKGLLYARKGTGVAVKVSGFLVNKLGEATMLLGRQLAPHIKKHGTRLLPKELKASDQEGR-SKIDDVLEVAGGGLKGLGTVYNGLEVAAKALGKSIATQTVDVVQHKYGEQVGSATEHSLYTAGHVVMTGYNVKEMGIKAIAKRAAKDTGKAVLEDYK 539          
BLAST of Spartin vs. TrEMBL
Match: A0A2T7PPB9 (MIT domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06555 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 2.680e-33
Identity = 118/367 (32.15%), Postives = 172/367 (46.87%), Query Frame = 1
Query:  484 LFSITSECQYTKISPDGEFDIPSYPGSLEIYKY----------PSDTDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLD-NEKDDTSKVAVTLPFNVSK------EDFQRCI-CILSTLAVI----VVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVV-----------GASKLGELVSRGSDELCLRLKPGEA--KLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITA 1479
            LFSI    Q   I+P G    PSYP SL + K+           + ++    F+ V DW   L+   +PIL T  G  +F D   ++  + V + LP N++       ED  R    +   LA I    +V+     +D  S + EE+  +  E    G  + S ++SKG+++           GA K GEL+++GS +L  +L+P +    +NP+++ G++YAR  +HA   VSG     L KAT     + APHI      ++PS  K        SK++ +  VA SG+QG   V+ SL   A    R  A     I+ HRYGEE G  TEN LY AGN+            K I K AAK T+
Sbjct:  184 LFSIVDGVQIFFITPQGYVSAPSYPSSLHVVKFEDQIGRIQETSATSEMPPAFMQVGDWVYPLLPQASPILHTTYGAYIFPDLTSEEAGASVGLILPDNITDTEKHCLEDILRNFSAVQEQLATIHPEDLVEPSAPQEDSSSSMVEEIQISPDEA---GKQSTSSKISKGIIIASEWISWGLGKGAQKTGELINKGSVKLRTKLQPLDQTRPVNPHIQKGMDYARKASHAAQLVSGFIVSQLGKATVALGKQLAPHIREQGKKILPSSMKT---SESQSKLNSVLEVAASGVQGFGTVYLSLEKAAKALARSLANETVSIIHHRYGEEAGMLTENTLYTAGNVVATGYNINHLGVKAIAKQAAKNTS 544          
BLAST of Spartin vs. TrEMBL
Match: A0A0B6ZHF2 (Senescence domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF64818 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.704e-30
Identity = 118/384 (30.73%), Postives = 175/384 (45.57%), Query Frame = 1
Query:  484 LFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDTDNKKG-----FIVVSDWAGTLIENVTPILITPQGVLMFLD-NEKDDTSKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIGEELPKTKGEIIA-----------DGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAK-------------LNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIETVDSAEK 1545
            LF+I    Q   I+ DG    P+YP SL I +   D    +G     F+ V DW   LI   +P L T  G  +F D       + V +  P  +S+E+ QR   I+ + + +  +Q   P        +E P T G +IA           + L+T  + +SKG+ + A  +   VS+G+++  L ++ G  K             ++P V+ G+ YAR  TH   +V+G     L   T   A + APH+      ++P   K +   G+ S VD +  VAGSGL+G   V+ SL   A T G+  A    K++ H+YGEE G  TEN +Y AGN+ + A  A     K I K AA+ T   V    K+        D AEK
Sbjct:  189 LFNINDGVQLFYITADGLVSAPTYPTSLHIVRL-MDEPQTQGQGPPVFLHVGDWMYPLIPGTSPALHTNYGAYLFPDVTASQPGAAVGLIFPDTLSQEERQRFEDIIRS-STLYGEQSPSPCPL-----DERPTTSGAVIAKPGQKEIQEEEEALDTAGK-ISKGISLAAEWIAWGVSKGAEKASLLIRQGSVKFQEHYSAADHVHKIDPKVQKGVFYAREATHGAVKVTGYIVNKLGALTVAVAKELAPHVKKQGMKILPQSMKSENSQGK-STVDGVVEVAGSGLKGFGTVYMSLETAAKTLGKCLANETVKVVTHKYGEEAGCLTENTMYTAGNVFMTAHNANNLGIKAIAKRAARETGKAVLVDLKD--------DKAEK 555          
BLAST of Spartin vs. TrEMBL
Match: A0A0B6ZHM8 (Senescence domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF64815 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 5.365e-30
Identity = 112/361 (31.02%), Postives = 168/361 (46.54%), Query Frame = 1
Query:  484 LFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDTDNKKG-----FIVVSDWAGTLIENVTPILITPQGVLMFLD-NEKDDTSKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIGEELPKTKGEIIA-----------DGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAK-------------LNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKIT 1476
            LF+I    Q   I+ DG    P+YP SL I +   D    +G     F+ V DW   LI   +P L T  G  +F D       + V +  P  +S+E+ QR   I+ + + +  +Q   P        +E P T G +IA           + L+T  + +SKG+ + A  +   VS+G+++  L ++ G  K             ++P V+ G+ YAR  TH   +V+G     L   T   A + APH+      ++P   K +   G+ S VD +  VAGSGL+G   V+ SL   A T G+  A    K++ H+YGEE G  TEN +Y AGN+ + A  A     K I K AA+ T
Sbjct:  189 LFNINDGVQLFYITADGLVSAPTYPTSLHIVRL-MDEPQTQGQGPPVFLHVGDWMYPLIPGTSPALHTNYGAYLFPDVTASQPGAAVGLIFPDTLSQEERQRFEDIIRS-STLYGEQSPSPCPL-----DERPTTSGAVIAKPGQKEIQEEEEALDTAGK-ISKGISLAAEWIAWGVSKGAEKASLLIRQGSVKFQEHYSAADHVHKIDPKVQKGVFYAREATHGAVKVTGYIVNKLGALTVAVAKELAPHVKKQGMKILPQSMKSENSQGK-STVDGVVEVAGSGLKGFGTVYMSLETAAKTLGKCLANETVKVVTHKYGEEAGCLTENTMYTAGNVFMTAHNANNLGIKAIAKRAARET 540          
BLAST of Spartin vs. Ensembl Cavefish
Match: sparta (spartin a [Source:ZFIN;Acc:ZDB-GENE-080204-37])

HSP 1 Score: 112.079 bits (279), Expect = 8.337e-26
Identity = 97/366 (26.50%), Postives = 166/366 (45.36%), Query Frame = 1
Query:  472 TAEILFSITSECQYTKISPDGEFDIPSYPGSLEIY------KYPSDTDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDTSKVAVTLPFNVSKEDFQRCICILSTLAV---------------IVVDQKQIPDD----QISEIGEE--LPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGE-CGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITA 1479
            + E L  +    Q   ++ DG+   P YPG L I+      +  SD  +   ++ V DW   L  + +P+L++  GV  F D           T+P +  +  FQ  + +L+ L V               + + +K + D      + +  EE  LP+   E ++ G+   +  LS+G+V GA   G+ +S+G+ +L   + P E  A++NP V  GL+ A+  T    +VS    G L+   +    +  PH+    + LIP  +K   E C  +        VA S L+GL  ++  L   A T G+  +    + ++H+YG++  Q T+ A+ +  N+G+ A     F  K +LK A K TA
Sbjct:  186 SGEDLLFLPHGVQIFFVTADGQVSTPLYPGYLRIFLNSKQNRDSSDCRHPPAYLQVCDWLYPLFPD-SPVLLSNTGVFTFPD--------TTATVPGSSDRALFQEHLSVLTQLRVQPEDVESDEPTRMDTVNLSEKALNDSADETDLEQAKEEKVLPEWS-EKMSQGILAGASWLSRGLVQGAEATGKAISKGATKLREHMTPEETPAEVNPRVTRGLQVAKQATGGAAKVSNFLVGGLSSVVELVGKELTPHVKKHGSKLIPESFKTNKEACANMGGAKA---VAASSLKGLSTIWSGLETAAKTVGKSASSETVQTVKHKYGDQASQATDTAVQSVLNVGVTAFNIDNFGLKAVLKGAGKQTA 538          
BLAST of Spartin vs. Ensembl Cavefish
Match: spartb (spartin-like [Source:NCBI gene;Acc:103039147])

HSP 1 Score: 108.612 bits (270), Expect = 1.346e-24
Identity = 99/371 (26.68%), Postives = 164/371 (44.20%), Query Frame = 1
Query:  478 EILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDTDNK-----KGFIVVSDWAGTLIENVTPILITPQGVLMFLDN-EKDDTSKVAVTLPFNVS---KEDFQRCICILSTLAVIVVDQ--------KQIPDDQISEI-------GEE---LPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK 1503
            E LF +    Q   ++PDG+   PSYPG L I ++ ++   +       F+ V DW   L+   +P+L+   GV MF D       S V V L   +    +E FQ  +  ++ L V   D         +++P     E+       G+E   LP+   E +A G+ T +  LS G+V GA   G+ + +G+ +L   + P +   +++P V  GL  A+  T    +VS      L     +   + APH+      L+P   K+  +    S +D   +VA SG+QG   ++  L   A       A      ++H+YG   GQ T++A+ +A N+G+ A        K ++K   K TA  +   Y+
Sbjct:  225 EELFFLPHGVQIFFVTPDGQVSAPSYPGYLRIVRFTNEVSERVPGRPPAFLQVCDWLYPLMATDSPVLLCNTGVYMFPDMMAPSPGSYVGVVLSSELPLSEREHFQDLLSQMTDLRVQASDGAADTINLGQKVPMGPPPELEKPGAAEGDEDKVLPEWS-EKVAHGILTGASWLSWGLVKGAEYTGKAIHKGASKLREHITPEDRPTQVSPTVTRGLHVAKQATGGAVKVSQFLVDGLCTVAGHVGRELAPHVKKHGGKLLPDSMKKDKDG--RSNIDGAMVVAASGVQGFATMWTGLESAAKNIATSAATETVNTVKHKYGAAAGQATDHAVNSAINMGVTAFNIDNLGIKAMVKKTGKETAHAILKDYR 592          
BLAST of Spartin vs. Ensembl Cavefish
Match: spartb (spartin-like [Source:NCBI gene;Acc:103039147])

HSP 1 Score: 84.3445 bits (207), Expect = 8.019e-17
Identity = 83/321 (25.86%), Postives = 139/321 (43.30%), Query Frame = 1
Query:  478 EILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDTDNK-----KGFIVVSDWAGTLIENVTPILITPQGVLMFLD-NEKDDTSKVAVTLPFNVS---KEDFQRCICILSTLAVIVVD--------QKQIPDDQISEI-------GEE---LPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRY 1353
            E LF +    Q   ++PDG+   PSYPG L I ++ ++   +       F+ V DW   L+   +P+L+   GV MF D       S V V L   +    +E FQ  +  ++ L V   D         +++P     E+       G+E   LP+   E +A G+ T +  LS G+V GA   G+ + +G+ +L   + P +   +++P V  GL  A+  T    +VS      L     +   + APH+      L+P   K+  +    S +D   +VA SG+QG   ++  L   A       A      ++H++
Sbjct:  225 EELFFLPHGVQIFFVTPDGQVSAPSYPGYLRIVRFTNEVSERVPGRPPAFLQVCDWLYPLMATDSPVLLCNTGVYMFPDMMAPSPGSYVGVVLSSELPLSEREHFQDLLSQMTDLRVQASDGAADTINLGQKVPMGPPPELEKPGAAEGDEDKVLPEWS-EKVAHGILTGASWLSWGLVKGAEYTGKAIHKGASKLREHITPEDRPTQVSPTVTRGLHVAKQATGGAVKVSQFLVDGLCTVAGHVGRELAPHVKKHGGKLLPDSMKKDKDG--RSNIDGAMVVAASGVQGFATMWTGLESAAKNIATSAATETVNTVKHKF 542          
BLAST of Spartin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005913.1 (pep scaffold:Pmarinus_7.0:GL480199:14065:18993:-1 gene:ENSPMAG00000005342.1 transcript:ENSPMAT00000005913.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 4.377e-16
Identity = 65/227 (28.63%), Postives = 104/227 (45.81%), Query Frame = 1
Query:  877 EIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLK--------------PGEAKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNK 1515
            E IA+G+NT +  +S G+  GAS  G  V+ G  E+  RL+              P    ++P V+  +  +R+       VS      ++ A  +     APH+ +    ++P E   + + GE S +D   +VA SG+QG   V+  +   A T     + +  + ++HRYG E G+TTE+AL AA + G+          KG++K  AK T   V   Y    K
Sbjct:  136 EKIANGINTGAGWVSWGLESGASLAGRAVAWGGAEVRSRLQAADAAGQEGAAGGPPVATAVDPRVQEAMRVSRSVAGGALTVSRFMVDGVSWAAGHLGRGLAPHVRACGERILP-ESLTRAQPGEGSTLDGALVVAASGVQGFATVWQGMESAAHTIASSVSNATVQTVQHRYGAEAGETTESALQAALSAGVCVYNLSHLGVKGLVKRTAKETGRAVLHDYTRPPK 361          
BLAST of Spartin vs. Ensembl Sea Lamprey
Match: spartb (spartin b [Source:ZFIN;Acc:ZDB-GENE-060825-146])

HSP 1 Score: 53.1434 bits (126), Expect = 9.199e-8
Identity = 82/334 (24.55%), Postives = 137/334 (41.02%), Query Frame = 1
Query:  442 QNQNEPRELVTAEI----------LFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSD-TDNKKG----FIVVSDWAGTLIENVTPILITPQGVLMFLDN-EKDDTSKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQIS-----------------EIG-EELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAKLNPNVKTGLEYARTGTHALFEVSGKA-----FGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARS 1326
            Q Q +P  L  A +          LF I    Q   +S  G    PSYPG L I  + S   D   G    F+ VS W   L+   +P+L + QG+ +F D    +  + V V L   +  E  +     L  LA   V   Q P+D  +                 E G  +L     E ++ G+ + +  +S+G++ GA   G+++++G+  +   + P E+++ P  +     AR  T A +E   ++      G +  A    + + APH+      ++P   K+    G  + +    +VA S  QGL  ++D L   A T  R  + S
Sbjct:  138 QCQEKPSGLQVAPVQQVLGPDAVELFLIADGAQIFFVSVAGLVSAPSYPGFLRIATFRSQGPDAPPGRPPAFLQVSGWLHPLVPGSSPVLRSSQGIYVFPDMCSGEAGATVGVLLSPELPAEQRRLFEEHLGRLAQFCV---QAPEDGAAGGQAMSADAPKAAAPDPEKGTPQLMPEWSEKMSHGILSGASWISRGLLRGAEATGKVLNKGATAVREHI-PAESQVPPQARAN---ARP-TAAAYEECVRSSSYITMGGVVDAMSSVSKEVAPHLKRYGEKIMPESLKQPDSDGARA-LHGAKMVASSSAQGLSTIWDGLSSAAKTIARSVSSS 462          
BLAST of Spartin vs. Ensembl Medaka
Match: spartb (spartin [Source:NCBI gene;Acc:101155128])

HSP 1 Score: 108.227 bits (269), Expect = 2.026e-24
Identity = 102/390 (26.15%), Postives = 164/390 (42.05%), Query Frame = 1
Query:  478 EILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSD-----TDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDTS-----KVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIG---------------------EE--LPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK-----EHNKMIET 1527
            E L  I +  Q   ++PDG+   PSYPG L + ++  D      D    F+ V DW   L+   +P+L+   GV MF D             ++  LP +  +E FQ  +  ++ L V      Q PD+   EI                      EE  LP+   E +A G+ T +  LS G+V GA+  G+ + +G+  L   + P +   +++P V   L  A+  T    +VS      +         + APH+      LIP   K+  +    S +D   +VA SG+QG   ++  L   A       A      ++H+YG   GQ T++A+ +A N+G+ A        K ++K   K TA  +   Y+     E  K +E+
Sbjct:  216 EELIYIPNGVQIFFVTPDGQVSAPSYPGFLRLVRFTDDRSEGMPDRPPAFLQVCDWLYPLMAANSPVLLCNTGVFMFPDMMAQAPGFYVGVVLSSELP-DAQREQFQELLSQMTDLRV------QAPDEAAEEINLSQKVPIATPEETAPAPTEKEEENVLPEWS-EKVASGILTGASWLSWGLVKGAAYTGKAIHKGASMLREHITPEDKPTQVSPTVTKSLHVAKQATGGAVKVSQFLVDGVCTVAGCVGRELAPHVKKHGGKLIPESMKKDKDG--RSNIDGAMVVAASGVQGFATMWTGLESAAKDIASSVAAETVTTVKHKYGAAAGQATDHAVNSAINVGITAFNIDNLGIKAVVKRTGKQTAQAILEDYRLQEKPESGKQVES 595          
BLAST of Spartin vs. Ensembl Medaka
Match: spartb (spartin [Source:NCBI gene;Acc:101155128])

HSP 1 Score: 108.227 bits (269), Expect = 2.026e-24
Identity = 102/390 (26.15%), Postives = 164/390 (42.05%), Query Frame = 1
Query:  478 EILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSD-----TDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDTS-----KVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIG---------------------EE--LPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYK-----EHNKMIET 1527
            E L  I +  Q   ++PDG+   PSYPG L + ++  D      D    F+ V DW   L+   +P+L+   GV MF D             ++  LP +  +E FQ  +  ++ L V      Q PD+   EI                      EE  LP+   E +A G+ T +  LS G+V GA+  G+ + +G+  L   + P +   +++P V   L  A+  T    +VS      +         + APH+      LIP   K+  +    S +D   +VA SG+QG   ++  L   A       A      ++H+YG   GQ T++A+ +A N+G+ A        K ++K   K TA  +   Y+     E  K +E+
Sbjct:  216 EELIYIPNGVQIFFVTPDGQVSAPSYPGFLRLVRFTDDRSEGMPDRPPAFLQVCDWLYPLMAANSPVLLCNTGVFMFPDMMAQAPGFYVGVVLSSELP-DAQREQFQELLSQMTDLRV------QAPDEAAEEINLSQKVPIATPEETAPAPTEKEEENVLPEWS-EKVASGILTGASWLSWGLVKGAAYTGKAIHKGASMLREHITPEDKPTQVSPTVTKSLHVAKQATGGAVKVSQFLVDGVCTVAGCVGRELAPHVKKHGGKLIPESMKKDKDG--RSNIDGAMVVAASGVQGFATMWTGLESAAKDIASSVAAETVTTVKHKYGAAAGQATDHAVNSAINVGITAFNIDNLGIKAVVKRTGKQTAQAILEDYRLQEKPESGKQVES 595          
BLAST of Spartin vs. Ensembl Medaka
Match: ENSORLT00000004851.2 (spartin [Source:NCBI gene;Acc:101169630])

HSP 1 Score: 88.9669 bits (219), Expect = 2.981e-18
Identity = 92/343 (26.82%), Postives = 149/343 (43.44%), Query Frame = 1
Query:  484 LFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSD-----TDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDT-SKVAVTLPFNVSKEDFQRCICILSTLAVI-VVDQKQ-----------IPDDQISEIGE-----------ELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVA 1419
            L  I+S  Q   + P+GE      PG L I  + S      +     F+ V D    L  + TP+L+   G+ MF D   D   S V + L   +   D +    +LS LA + V DQ++           +P   +S+  E           +LP    E +A G+ + + +LS+ +  GA   G  + +G+ ++  R+ P E  + ++P V   L+ A+  T     VS      L+    +   K +PH+    + L+P   K K + G  S  D    VA  G+QG   V+ SL  GA    +  A      ++++YG  +GQ T+ AL +  N+GL A
Sbjct:  212 LLRISSGVQLFFVEPNGEVSALMCPGYLRIITFESQHKDLASGKHSSFLHVCDQMYPLTTD-TPVLLANSGIYMFPDTMTDALGSYVGIVLSSELPAADHEIFQDLLSQLADLKVQDQEETGVDIMNLSTKVPVGPLSKQTELTVSAEEEEKLQLPGWS-EKMAQGILSGATRLSQSLAKGAEATGSFIHKGAAKIRDRITPEETPSDVSPQVAKRLQTAKQATGGAVRVSQFLVNGLSHIAGHVVDKVSPHMKKHGSKLVPESLK-KSQDGHASNWDGTKYVAARGVQGFSTVWSSLESGAKEVCKSVATETVTTVKYKYGHNVGQATDTALQSVANIGLTA 551          
BLAST of Spartin vs. Ensembl Medaka
Match: spartb (spartin [Source:NCBI gene;Acc:101155128])

HSP 1 Score: 83.5741 bits (205), Expect = 1.427e-16
Identity = 83/327 (25.38%), Postives = 134/327 (40.98%), Query Frame = 1
Query:  478 EILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSD-----TDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDTS-----KVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIG----------EE-------------LPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRY 1353
            E L  I +  Q   ++PDG+   PSYPG L + ++  D      D    F+ V DW   L+   +P+L+   GV MF D             ++  LP +  +E FQ  +  ++ L V      Q PD+   EI           EE             LP+   E +A G+ T +  LS G+V GA+  G+ + +G+  L   + P +   +++P V   L  A+  T    +VS      +         + APH+      LIP   K+  +    S +D   +VA SG+QG   ++  L   A       A      ++H++
Sbjct:  216 EELIYIPNGVQIFFVTPDGQVSAPSYPGFLRLVRFTDDRSEGMPDRPPAFLQVCDWLYPLMAANSPVLLCNTGVFMFPDMMAQAPGFYVGVVLSSELP-DAQREQFQELLSQMTDLRV------QAPDEAAEEINLSQKVPIATPEETAPAPTEKEEENVLPEWS-EKVASGILTGASWLSWGLVKGAAYTGKAIHKGASMLREHITPEDKPTQVSPTVTKSLHVAKQATGGAVKVSQFLVDGVCTVAGCVGRELAPHVKKHGGKLIPESMKKDKDG--RSNIDGAMVVAASGVQGFATMWTGLESAAKDIASSVAAETVTTVKHKF 532          
BLAST of Spartin vs. Ensembl Medaka
Match: spartb (spartin [Source:NCBI gene;Acc:101155128])

HSP 1 Score: 83.1889 bits (204), Expect = 1.799e-16
Identity = 83/327 (25.38%), Postives = 134/327 (40.98%), Query Frame = 1
Query:  478 EILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSD-----TDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDTS-----KVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIG----------EE-------------LPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGE--AKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRY 1353
            E L  I +  Q   ++PDG+   PSYPG L + ++  D      D    F+ V DW   L+   +P+L+   GV MF D             ++  LP +  +E FQ  +  ++ L V      Q PD+   EI           EE             LP+   E +A G+ T +  LS G+V GA+  G+ + +G+  L   + P +   +++P V   L  A+  T    +VS      +         + APH+      LIP   K+  +    S +D   +VA SG+QG   ++  L   A       A      ++H++
Sbjct:  216 EELIYIPNGVQIFFVTPDGQVSAPSYPGFLRLVRFTDDRSEGMPDRPPAFLQVCDWLYPLMAANSPVLLCNTGVFMFPDMMAQAPGFYVGVVLSSELP-DAQREQFQELLSQMTDLRV------QAPDEAAEEINLSQKVPIATPEETAPAPTEKEEENVLPEWS-EKVASGILTGASWLSWGLVKGAAYTGKAIHKGASMLREHITPEDKPTQVSPTVTKSLHVAKQATGGAVKVSQFLVDGVCTVAGCVGRELAPHVKKHGGKLIPESMKKDKDG--RSNIDGAMVVAASGVQGFATMWTGLESAAKDIASSVAAETVTTVKHKF 532          
BLAST of Spartin vs. Planmine SMEST
Match: SMESG000068710.1 (SMESG000068710.1)

HSP 1 Score: 889.026 bits (2296), Expect = 0.000e+0
Identity = 463/467 (99.14%), Postives = 465/467 (99.57%), Query Frame = 1
Query:  175 MQKSLSFEYDNFVLQYKYALQKSNEALTIESKGNKYEAYSVYKSIIVDIDNILVLNVTNEKFSSNSDVIXXXXXXXXXXXXICDCINRIQNQNEPRELVTAEILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDTDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDTSKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIETVDSAEKQKGFHNDKHI 1575
            MQKSL+FEYDNFVLQYKYALQKSNEALTIESKGNK EAYSVY+SIIVDIDNILVLNVTNEKFSSNSDVIKKLNNLKALRNNICDCINRIQNQNEPRELVTAEILFSITSECQYTKISPDG FDIPSYPGSLEIYKYPSDTDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDTSKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAKLNPNVKTGLEYARTGTHALFEVSGKAFGALAKATKYAATKAAPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIETVDSAEKQKGFHNDKHI
Sbjct:    1 MQKSLNFEYDNFVLQYKYALQKSNEALTIESKGNKNEAYSVYRSIIVDIDNILVLNVTNEKFSSNSDVIKKLNNLKALRNNICDCINRIQNQNEPRELVTAEILFSITSECQYTKISPDGVFDIPSYPGSLEIYKYPSDTDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDTSKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAKLNPNVKTGLEYARTGTHALFEVSGKAFGALAKATKYAATKAAPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIETVDSAEKQKGFHNDKHI 467          
BLAST of Spartin vs. Planmine SMEST
Match: SMESG000068715.1 (SMESG000068715.1)

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 389/394 (98.73%), Postives = 391/394 (99.24%), Query Frame = 1
Query:  175 MQKSLSFEYDNFVLQYKYALQKSNEALTIESKGNKYEAYSVYKSIIVDIDNILVLNVTNEKFSSNSDVIXXXXXXXXXXXXICDCINRIQNQNEPRELVTAEILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDTDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDTSKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAKLNPNVKTGLEYARTGTHALFEVSGKAFGXXXXXXXXXXXXXXPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYG 1356
            MQKSL+FEYDNFVLQYKYALQKSNEALTIESKGNK EAYSVY+SIIVDIDNILVLNVTNEKFSSNSDVIKKLNNLKALRNNICDCINRIQNQNEPRELVTAEILFSITSECQYTKISPDG FDIPSYPGSLEIYKYPSDTDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDTSKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAKLNPNVKTGLEYARTGTHALFEVSGKAFGALAKATKYAATKAAPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRY 
Sbjct:    1 MQKSLNFEYDNFVLQYKYALQKSNEALTIESKGNKNEAYSVYRSIIVDIDNILVLNVTNEKFSSNSDVIKKLNNLKALRNNICDCINRIQNQNEPRELVTAEILFSITSECQYTKISPDGVFDIPSYPGSLEIYKYPSDTDNKKGFIVVSDWAGTLIENVTPILITPQGVLMFLDNEKDDTSKVAVTLPFNVSKEDFQRCICILSTLAVIVVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSKGVVVGASKLGELVSRGSDELCLRLKPGEAKLNPNVKTGLEYARTGTHALFEVSGKAFGALAKATKYAATKAAPHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYA 394          
BLAST of Spartin vs. Planmine SMEST
Match: SMESG000068710.1 (SMESG000068710.1)

HSP 1 Score: 300.827 bits (769), Expect = 2.345e-100
Identity = 145/145 (100.00%), Postives = 145/145 (100.00%), Query Frame = 1
Query: 1141 PHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIETVDSAEKQKGFHNDKHI 1575
            PHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIETVDSAEKQKGFHNDKHI
Sbjct:   24 PHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIETVDSAEKQKGFHNDKHI 168          
BLAST of Spartin vs. Planmine SMEST
Match: SMESG000068710.1 (SMESG000068710.1)

HSP 1 Score: 300.827 bits (769), Expect = 3.622e-100
Identity = 145/145 (100.00%), Postives = 145/145 (100.00%), Query Frame = 1
Query: 1141 PHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIETVDSAEKQKGFHNDKHI 1575
            PHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIETVDSAEKQKGFHNDKHI
Sbjct:   35 PHIISSANNLIPSEWKEKGECGELSKVDQIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQTTENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIETVDSAEKQKGFHNDKHI 179          
The following BLAST results are available for this feature:
BLAST of Spartin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPART5.649e-924.68spartin [Source:HGNC Symbol;Acc:HGNC:18514][more]
SPART5.649e-924.68spartin [Source:HGNC Symbol;Acc:HGNC:18514][more]
SPART5.649e-924.68spartin [Source:HGNC Symbol;Acc:HGNC:18514][more]
SPART5.649e-924.68spartin [Source:HGNC Symbol;Acc:HGNC:18514][more]
SPART5.649e-924.68spartin [Source:HGNC Symbol;Acc:HGNC:18514][more]
back to top
BLAST of Spartin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spg-202.964e-621.14SPG (Spastic paraplegia) [Source:UniProtKB/TrEMBL... [more]
back to top
BLAST of Spartin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spartin6.839e-1124.68gene:FBgn0037265 transcript:FBtr0078861[more]
spartin6.839e-1124.68gene:FBgn0037265 transcript:FBtr0308820[more]
back to top
BLAST of Spartin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sparta6.775e-2829.61spartin a [Source:ZFIN;Acc:ZDB-GENE-080204-37][more]
spartb1.911e-2426.68spartin b [Source:ZFIN;Acc:ZDB-GENE-060825-146][more]
back to top
BLAST of Spartin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
spart9.672e-2127.96spartin [Source:NCBI gene;Acc:100170472][more]
spart3.859e-1227.30spartin [Source:NCBI gene;Acc:100170472][more]
spart7.598e-1028.67spartin [Source:NCBI gene;Acc:100170472][more]
back to top
BLAST of Spartin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Spg209.743e-2226.26spastic paraplegia 20, spartin (Troyer syndrome) h... [more]
Spg201.349e-1026.58spastic paraplegia 20, spartin (Troyer syndrome) h... [more]
Spg201.349e-1026.58spastic paraplegia 20, spartin (Troyer syndrome) h... [more]
back to top
BLAST of Spartin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|A0JNJ3|SPART_BOVIN1.212e-1027.39Spartin OS=Bos taurus OX=9913 GN=SPART PE=2 SV=1[more]
sp|Q9VN45|SPART_DROME6.855e-1024.68Protein spartin OS=Drosophila melanogaster OX=7227... [more]
sp|Q8R1X6|SPART_MOUSE8.212e-1026.58Spartin OS=Mus musculus OX=10090 GN=Spart PE=1 SV=... [more]
sp|Q8N0X7|SPART_HUMAN2.713e-824.68Spartin OS=Homo sapiens OX=9606 GN=SPART PE=1 SV=1[more]
back to top
BLAST of Spartin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J3853.147e-3732.35spartin-like OS=Lingula unguis OX=7574 GN=LOC10616... [more]
A0A1S3I8781.748e-3430.83spartin-like OS=Lingula unguis OX=7574 GN=LOC10616... [more]
A0A2T7PPB92.680e-3332.15MIT domain-containing protein OS=Pomacea canalicul... [more]
A0A0B6ZHF23.704e-3030.73Senescence domain-containing protein OS=Arion vulg... [more]
A0A0B6ZHM85.365e-3031.02Senescence domain-containing protein (Fragment) OS... [more]
back to top
BLAST of Spartin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sparta8.337e-2626.50spartin a [Source:ZFIN;Acc:ZDB-GENE-080204-37][more]
spartb1.346e-2426.68spartin-like [Source:NCBI gene;Acc:103039147][more]
spartb8.019e-1725.86spartin-like [Source:NCBI gene;Acc:103039147][more]
back to top
BLAST of Spartin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005913.14.377e-1628.63pep scaffold:Pmarinus_7.0:GL480199:14065:18993:-1 ... [more]
spartb9.199e-824.55spartin b [Source:ZFIN;Acc:ZDB-GENE-060825-146][more]
back to top
BLAST of Spartin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spartin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spartin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spartb2.026e-2426.15spartin [Source:NCBI gene;Acc:101155128][more]
spartb2.026e-2426.15spartin [Source:NCBI gene;Acc:101155128][more]
ENSORLT00000004851.22.981e-1826.82spartin [Source:NCBI gene;Acc:101169630][more]
spartb1.427e-1625.38spartin [Source:NCBI gene;Acc:101155128][more]
spartb1.799e-1625.38spartin [Source:NCBI gene;Acc:101155128][more]
back to top
BLAST of Spartin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000068710.10.000e+099.14SMESG000068710.1[more]
SMESG000068715.10.000e+098.73SMESG000068715.1[more]
SMESG000068710.12.345e-100100.00SMESG000068710.1[more]
SMESG000068710.13.622e-100100.00SMESG000068710.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013193 ID=SMED30013193|Name=Spartin|organism=Schmidtea mediterranea sexual|type=transcript|length=1652bp
GTTACATTTAATTTTAAATATTTCATGAATGCCTAATTTTGTTATTTTTA
TGATATTGTAGGAATTTACATATCAAACTATCAGCTCAAATTAGTTGTAT
ATCAAGTGATTTAGAAATACTTGGTCTAGCCAATTTTATTTAAAATACAG
ATTAGATATAGATTCATTATAAAAATGCAGAAATCATTGAGTTTTGAATA
TGATAATTTTGTATTGCAATATAAGTATGCCCTACAAAAGTCTAATGAAG
CATTAACAATCGAATCAAAAGGAAATAAATACGAGGCATATTCTGTTTAC
AAGAGTATTATTGTAGATATTGACAATATTTTAGTATTAAATGTAACTAA
TGAAAAATTTTCGTCTAATAGCGATGTAATTAAGAAGTTAAATAATCTTA
AAGCATTAAGAAATAATATATGCGATTGTATCAACCGTATTCAAAATCAA
AATGAACCGAGAGAACTAGTCACAGCCGAAATATTATTTTCAATTACCTC
AGAGTGTCAATACACTAAAATCAGTCCAGATGGAGAATTCGATATTCCAA
GTTATCCTGGCTCTTTAGAAATTTACAAATACCCATCGGACACAGATAAT
AAAAAGGGATTTATTGTAGTTTCAGACTGGGCTGGTACATTGATTGAAAA
TGTCACCCCAATCCTTATTACTCCCCAAGGAGTTTTGATGTTTCTTGATA
ACGAAAAGGATGACACCTCTAAAGTGGCTGTAACTCTGCCATTTAATGTG
TCAAAAGAAGATTTTCAGCGTTGTATTTGTATTTTATCGACTCTTGCAGT
AATAGTTGTTGATCAAAAACAGATCCCGGATGATCAGATTTCCGAAATAG
GCGAAGAGTTACCTAAAACCAAAGGGGAAATAATTGCAGATGGATTAAAT
ACGGTTTCTCGTCAGTTATCCAAAGGTGTTGTTGTTGGAGCTAGTAAATT
AGGTGAATTAGTTAGCAGAGGTTCTGATGAATTGTGTCTACGTTTGAAAC
CCGGCGAAGCAAAACTAAATCCAAATGTTAAAACTGGACTAGAGTACGCT
CGAACTGGAACTCATGCCTTGTTTGAAGTTAGTGGAAAAGCGTTTGGAGC
TCTAGCAAAAGCTACTAAGTACGCAGCTACAAAGGCGGCTCCACATATAA
TTTCCTCTGCCAATAATTTAATACCTTCTGAATGGAAGGAAAAAGGTGAA
TGTGGAGAACTATCAAAAGTCGATCAAATTGCTCTTGTGGCTGGATCAGG
CTTACAAGGATTAATAATGGTATTTGACAGTCTCCACGATGGTGCAGTAA
CTTTTGGCCGACATACTGCTCGTAGTGGTGGTAAAATAATGCGACATCGA
TATGGGGAAGAAATTGGACAGACAACTGAAAACGCGTTGTATGCTGCTGG
TAATTTGGGGTTGGTGGCTATGGTGGCGCTTCAGTTTACAAAGAAAGGTA
TTTTGAAAACAGCTGCAAAAATAACAGCTTTAGAAGTCACAACTAAATAT
AAAGAACATAATAAAATGATTGAAACTGTCGATAGCGCGGAGAAGCAAAA
AGGTTTCCATAATGACAAGCATATTTGATTGCCAATAATTGTGATTTATT
TATGTTTTAATTCAAATGTTAATCAAATAAATTATTTTCCCGTCAAAAAA
AA
back to top

protein sequence of SMED30013193-orf-1

>SMED30013193-orf-1 ID=SMED30013193-orf-1|Name=SMED30013193-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=468bp
MQKSLSFEYDNFVLQYKYALQKSNEALTIESKGNKYEAYSVYKSIIVDID
NILVLNVTNEKFSSNSDVIKKLNNLKALRNNICDCINRIQNQNEPRELVT
AEILFSITSECQYTKISPDGEFDIPSYPGSLEIYKYPSDTDNKKGFIVVS
DWAGTLIENVTPILITPQGVLMFLDNEKDDTSKVAVTLPFNVSKEDFQRC
ICILSTLAVIVVDQKQIPDDQISEIGEELPKTKGEIIADGLNTVSRQLSK
GVVVGASKLGELVSRGSDELCLRLKPGEAKLNPNVKTGLEYARTGTHALF
EVSGKAFGALAKATKYAATKAAPHIISSANNLIPSEWKEKGECGELSKVD
QIALVAGSGLQGLIMVFDSLHDGAVTFGRHTARSGGKIMRHRYGEEIGQT
TENALYAAGNLGLVAMVALQFTKKGILKTAAKITALEVTTKYKEHNKMIE
TVDSAEKQKGFHNDKHI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005741mitochondrial outer membrane
GO:0005829cytosol
GO:0030496midbody
GO:0005768endosome
GO:0005769early endosome
GO:0005811lipid particle
GO:0005886plasma membrane
GO:0016020membrane
GO:0030054cell junction
GO:0042734presynaptic membrane
GO:0043195terminal bouton
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0009838abscission
GO:0034389lipid particle organization
GO:0048698negative regulation of collateral sprouting in absence of injury
GO:0050905neuromuscular process
GO:0051301cell division
GO:0051881regulation of mitochondrial membrane potential
GO:0060612adipose tissue development
GO:0007274neuromuscular synaptic transmission
GO:0007275multicellular organism development
GO:0007399nervous system development
GO:0030514negative regulation of BMP signaling pathway
GO:0045886negative regulation of synaptic growth at neuromuscular junction
Vocabulary: molecular function
TermDefinition
GO:0031625ubiquitin protein ligase binding
GO:0003674molecular_function
GO:0017137Rab GTPase binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR009686Senescence/spartin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009686Senescence/spartin-associatedPFAMPF06911Senescencecoord: 245..422
e-value: 1.2E-24
score: 87.6
NoneNo IPR availablePANTHERPTHR21068:SF20SPARTINcoord: 84..458
NoneNo IPR availablePANTHERPTHR21068FAMILY NOT NAMEDcoord: 84..458