Rho GTPase-activating protein

Overview
NameRho GTPase-activating protein
Smed IDSMED30013182
Length (bp)4423
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho GTPase-activating protein (SMED30013182) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho GTPase-activating protein (SMED30013182) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho GTPase-activating protein (SMED30013182) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho GTPase-activating protein (SMED30013182) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013182

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30013182SMESG000017186.1 SmedASXL_015910SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30013182SMESG000017186.1 dd_Smed_v4_12363_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013182SMESG000017186.1 dd_Smed_v4_12363_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013182SMESG000017186.1 dd_Smed_v4_12363_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013182SMESG000017186.1 dd_Smed_v6_12363_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30013182SMESG000017186.1 dd_Smed_v4_12363_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: SYDE2 (synapse defective Rho GTPase homolog 2 [Source:HGNC Symbol;Acc:HGNC:25841])

HSP 1 Score: 211.46 bits (537), Expect = 1.072e-54
Identity = 124/370 (33.51%), Postives = 203/370 (54.86%), Query Frame = 1
Query: 2671 YVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTS-TEIFEWDEIFELDVEDNDWLAFLFYQWDPRNR-HRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDAL-FGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSL-----------PGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQA---------QTLLYILNIWP 3711
            Y+SG++ +H      L   +   +D++C +++DSV +AR+ + T  T   + D  F +++E+   L  + + W+P  R +R+C +G V L  L   FR   T + +LA+ LEP+G++++++  ++  E      + +N + + FGV ++ +V        E +     VP+++++C  E+EKRG  VV +YRL G+  +K  +RE  E+D  A  L  +  PDI+ IT VL+D+LRELP PL T  LY  +LDA+  S            PGD    +K  +++LDCLP + + T+  LLDHLK V+S  EVNKMT + LA   GPVL     E +   ++   D ++ A         + L Y+L +WP
Sbjct:  677 YISGLMSVHFYGAEDLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRKNRVCCHGTVVLPTL---FR--VTKTHQLAVKLEPRGLIYVKVTLMEQWE-NSLHGLDINQEPIIFGVDIQKVV--------EKENIGLMVPLLIQKCIMEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKAVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSNGCENDPGD----SKYTVDLLDCLPEIEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQRQEPSTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWP 1028          
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:HGNC Symbol;Acc:HGNC:25824])

HSP 1 Score: 183.726 bits (465), Expect = 4.331e-47
Identity = 127/356 (35.67%), Postives = 186/356 (52.25%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVV-RDLYCVLEIDSVRRARSM-IRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPR-NRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDA-LFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLF-------FPSPEEAXXXXXXXXXXXXQAQTLLYILNIWPD 3714
            G L +H+    GL  +     RDL C+L++D   RAR+  +R   +    D  F L++E    L  L   WDP   RHR C  G V L  +   FR     +++LA+ LEP+G+L+ +L   +  E       P   +  +FG+PL +LV R+        GQ   VP+I+++C  ++E+RGL VV +YRL G+  +K  +R+  E+D  A  LS D  PDI+ IT +L+D+LRELP PL T  LY+++L+A+    P       +    +L CLP V + T+  LLDHL+ VSS    N+MT + LA   GPVL         P    +     S +D K   + L Y+L  WPD
Sbjct:  266 GRLSLHLYGLGGLRPAPGATPRDLCCLLQVDGEARARTGPLRGGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTV---FRG--CQAQQLAVRLEPQGLLYAKLTLSEQQEA------PATAEPRVFGLPLPLLVERE-----RPPGQ---VPLIIQKCVGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLRELPTPLITQPLYKVVLEAMARDPPNRVPPTTEGTRGLLSCLPDVERATLTLLLDHLRLVSSFHAYNRMTPQNLAVCFGPVLLPARQAPTRPRARSSGPGLASAVDFKHHIEVLHYLLQSWPD 602          
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:HGNC Symbol;Acc:HGNC:25824])

HSP 1 Score: 182.57 bits (462), Expect = 4.711e-47
Identity = 127/356 (35.67%), Postives = 186/356 (52.25%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVV-RDLYCVLEIDSVRRARSM-IRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPR-NRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDA-LFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLF-------FPSPEEAXXXXXXXXXXXXQAQTLLYILNIWPD 3714
            G L +H+    GL  +     RDL C+L++D   RAR+  +R   +    D  F L++E    L  L   WDP   RHR C  G V L  +   FR     +++LA+ LEP+G+L+ +L   +  E       P   +  +FG+PL +LV R+        GQ   VP+I+++C  ++E+RGL VV +YRL G+  +K  +R+  E+D  A  LS D  PDI+ IT +L+D+LRELP PL T  LY+++L+A+    P       +    +L CLP V + T+  LLDHL+ VSS    N+MT + LA   GPVL         P    +     S +D K   + L Y+L  WPD
Sbjct:  199 GRLSLHLYGLGGLRPAPGATPRDLCCLLQVDGEARARTGPLRGGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTV---FRG--CQAQQLAVRLEPQGLLYAKLTLSEQQEA------PATAEPRVFGLPLPLLVERE-----RPPGQ---VPLIIQKCVGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLRELPTPLITQPLYKVVLEAMARDPPNRVPPTTEGTRGLLSCLPDVERATLTLLLDHLRLVSSFHAYNRMTPQNLAVCFGPVLLPARQAPTRPRARSSGPGLASAVDFKHHIEVLHYLLQSWPD 535          
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:HGNC Symbol;Acc:HGNC:25824])

HSP 1 Score: 139.043 bits (349), Expect = 1.419e-34
Identity = 96/258 (37.21%), Postives = 140/258 (54.26%), Query Frame = 1
Query: 2962 SYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFF-------PSPEEAXXXXXXXXXXXXQAQTLLYILNIWPD 3714
            S   +++LA+ LEP+G     LLY K+    Q+         +FG+PL +LV R+        GQ   VP+I+++C  ++E+RGL VV +YRL G+  +K  +R+  E+D  A  LS D  PDI+ IT +L+D+LRELP PL T  LY+++L+A+    P       +    +L CLP V + T+  LLDHL+ VSS    N+MT + LA   GPVL         P    +     S +D K   + L Y+L  WPD
Sbjct:   15 SGCQAQQLAVRLEPQG-----LLYAKLTLSEQQEAPATAEPRVFGLPLPLLVERE-----RPPGQ---VPLIIQKCVGQIERRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVCLSEDLYPDINVITGILKDYLRELPTPLITQPLYKVVLEAMARDPPNRVPPTTEGTRGLLSCLPDVERATLTLLLDHLRLVSSFHAYNRMTPQNLAVCFGPVLLPARQAPTRPRARSSGPGLASAVDFKHHIEVLHYLLQSWPD 259          
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: BCR (BCR activator of RhoGEF and GTPase [Source:HGNC Symbol;Acc:HGNC:1014])

HSP 1 Score: 138.272 bits (347), Expect = 5.164e-32
Identity = 119/372 (31.99%), Postives = 174/372 (46.77%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQW----------DPRNRHRLCFYGNVAL--RQLIERFRHSYTNSEKLALYLEPKGVLFIEL-LYLKINE-VFQRFKMPVNTD-ALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVP-DIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEA----------XXXXXXXXXXXXQAQTLLYILNI 3705
            G L + V +  G   S     +LYC LE+DS    V +A++ +   T    W+E FE+++E +  L  L Y+           D  +  RL   G V L  + L +R      + ++  + +       IE+ L +K N   F   +MP      +FGV + V+  R          +  +VP IVR+C EE+E+RG++ V IYR+SG       ++     DV   D+S      D++AI   L+ + RELPEPLFT+  Y    + + +S   D  A    MLN+L  LP  N  T L LLDHLKRV+ +  VNKM+   LA   GP L  PS +E+             D   L+   Q Q LLY L +
Sbjct:  911 GFLNVIVHSATGFKQSS----NLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDR------DWQRTVIAMNG-----IEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKR----------ERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAF--DVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALS---DPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQL 1252          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: syd-1 (Rho GTPase-activating protein syd-1 [Source:UniProtKB/Swiss-Prot;Acc:Q86NH1])

HSP 1 Score: 215.312 bits (547), Expect = 4.266e-58
Identity = 131/395 (33.16%), Postives = 215/395 (54.43%), Query Frame = 1
Query: 2620 PVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLN---SSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKL-ALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFP----SP----EEAXXXXXXXXXXXXQAQTLLYILNIWPDESDHQYHSRDSKSKEPQK 3768
            P+ A+G     ++ +   ++G+L +H+V G GL      + +  ++YCVLE+D   RAR+ + T  + F+W E F +DV +     F  Y W P+ RH+LC  G++   +L+E F     N +++ AL LEP+G L + + +  +  VF+R   P   + +FG+ L  LV R+              PI++ R  +E+EKRG+D   +Y L G+V+ K  +R  LE + +  +L+A+++PD + I  +++DFLRELPEPL +  ++ M+L+A  V+LP D      L+L I+DCL +  ++ +L +LDHL  V   S  N +T   L+    P+LFF     SP      +K      LD  + + +L  IL+IWP   + +  S DS +   QK
Sbjct:  330 PLRAAGPGINVDRLSVSSLTGILYVHIVEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSL---KLLEAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRRTVNP-RLNGVFGISLSRLVQRERRD----------TPIVLTRLIQEIEKRGVDYSGLYVLCGSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVLKIIDCLQLSAKNCLLLVLDHLSTVLCSSPHNGLTPTRLSLIFAPLLFFCLDTFSPYTISPTSKMAAVRTLDINQASSSLQMILSIWPSRVNSESGS-DSPATTCQK 709          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: syd-1 (Rho GTPase-activating protein syd-1 [Source:UniProtKB/Swiss-Prot;Acc:Q86NH1])

HSP 1 Score: 216.083 bits (549), Expect = 4.656e-57
Identity = 131/395 (33.16%), Postives = 215/395 (54.43%), Query Frame = 1
Query: 2620 PVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLN---SSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKL-ALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFP----SP----EEAXXXXXXXXXXXXQAQTLLYILNIWPDESDHQYHSRDSKSKEPQK 3768
            P+ A+G     ++ +   ++G+L +H+V G GL      + +  ++YCVLE+D   RAR+ + T  + F+W E F +DV +     F  Y W P+ RH+LC  G++   +L+E F     N +++ AL LEP+G L + + +  +  VF+R   P   + +FG+ L  LV R+              PI++ R  +E+EKRG+D   +Y L G+V+ K  +R  LE + +  +L+A+++PD + I  +++DFLRELPEPL +  ++ M+L+A  V+LP D      L+L I+DCL +  ++ +L +LDHL  V   S  N +T   L+    P+LFF     SP      +K      LD  + + +L  IL+IWP   + +  S DS +   QK
Sbjct:  596 PLRAAGPGINVDRLSVSSLTGILYVHIVEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSL---KLLEAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRRTVNP-RLNGVFGISLSRLVQRERRD----------TPIVLTRLIQEIEKRGVDYSGLYVLCGSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVLKIIDCLQLSAKNCLLLVLDHLSTVLCSSPHNGLTPTRLSLIFAPLLFFCLDTFSPYTISPTSKMAAVRTLDINQASSSLQMILSIWPSRVNSESGS-DSPATTCQK 975          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: syd-1 (Rho GTPase-activating protein syd-1 [Source:UniProtKB/Swiss-Prot;Acc:Q86NH1])

HSP 1 Score: 214.157 bits (544), Expect = 1.509e-56
Identity = 126/376 (33.51%), Postives = 207/376 (55.05%), Query Frame = 1
Query: 2620 PVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLN---SSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKL-ALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFP----SP----EEAXXXXXXXXXXXXQAQTLLYILNIWP 3711
            P+ A+G     ++ +   ++G+L +H+V G GL      + +  ++YCVLE+D   RAR+ + T  + F+W E F +DV +     F  Y W P+ RH+LC  G++   +L+E F     N +++ AL LEP+G L + + +  +  VF+R   P   + +FG+ L  LV R+              PI++ R  +E+EKRG+D   +Y L G+V+ K  +R  LE + +  +L+A+++PD + I  +++DFLRELPEPL +  ++ M+L+A  V+LP D      L+L I+DCL +  ++ +L +LDHL  V   S  N +T   L+    P+LFF     SP      +K      LD  + + +L  IL+IWP
Sbjct:  528 PLRAAGPGINVDRLSVSSLTGILYVHIVEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSL---KLLEAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRRTVNP-RLNGVFGISLSRLVQRERRD----------TPIVLTRLIQEIEKRGVDYSGLYVLCGSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVLKIIDCLQLSAKNCLLLVLDHLSTVLCSSPHNGLTPTRLSLIFAPLLFFCLDTFSPYTISPTSKMAAVRTLDINQASSSLQMILSIWP 889          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 89.7373 bits (221), Expect = 6.726e-19
Identity = 56/150 (37.33%), Postives = 81/150 (54.00%), Query Frame = 1
Query: 3166 VPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLF 3615
            VP  +R  TE +E +GL+   IYR+SG +    +IR   +QD   A +S +   DIH +T  L+ F REL +PLF  +L++    A+Q+      +   K    +L  LP  N++T+  LL HL RV+S S  N+M    LA   GP LF
Sbjct:  107 VPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALVSEE---DIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQMPNATTRF---KKFEELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLF 250          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 91.6633 bits (226), Expect = 2.583e-18
Identity = 56/150 (37.33%), Postives = 81/150 (54.00%), Query Frame = 1
Query: 3166 VPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLF 3615
            VP  +R  TE +E +GL+   IYR+SG +    +IR   +QD   A +S +   DIH +T  L+ F REL +PLF  +L++    A+Q+      +   K    +L  LP  N++T+  LL HL RV+S S  N+M    LA   GP LF
Sbjct:  626 VPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALVSEE---DIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQMPNATTRF---KKFEELLSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLF 769          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0304595)

HSP 1 Score: 296.59 bits (758), Expect = 3.744e-81
Identity = 159/390 (40.77%), Postives = 233/390 (59.74%), Query Frame = 1
Query: 2575 LDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGL---------NSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMP---VNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIW 3708
            ++P EF K + ++  P++  GG           +SGML IH++AG GL          ++Q   RDLYCV+E D V +AR+++R+    F+WDE FELD+  N  L  L Y WDP++RH+LC+ G ++L  ++ +     +   +LAL +EP+G ++I + +     +++R  +P        LFG  LE +V    NR+ +       VPI++RRC EEVE+RGLD++ +YRL G+   K  +RE  E++  A +L+ + VPDI+ IT VL+D+LRELPEPLFT  L++M +DAL V LP D    AKLML+ILDCLP  N+ T++ LLDHL  V S SE NKM+ +ALA  +GP L   S   A     + +D  +    L Y+L IW
Sbjct:  767 INPAEFAKYKLDK--PIVDIGG-----------ISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQ-----SPLHQLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFGADLETVV----NRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLMLHS---ASAQPGADIDHAQPIAVLKYLLQIW 1131          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0309829)

HSP 1 Score: 296.59 bits (758), Expect = 3.756e-81
Identity = 159/390 (40.77%), Postives = 233/390 (59.74%), Query Frame = 1
Query: 2575 LDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGL---------NSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMP---VNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIW 3708
            ++P EF K + ++  P++  GG           +SGML IH++AG GL          ++Q   RDLYCV+E D V +AR+++R+    F+WDE FELD+  N  L  L Y WDP++RH+LC+ G ++L  ++ +     +   +LAL +EP+G ++I + +     +++R  +P        LFG  LE +V    NR+ +       VPI++RRC EEVE+RGLD++ +YRL G+   K  +RE  E++  A +L+ + VPDI+ IT VL+D+LRELPEPLFT  L++M +DAL V LP D    AKLML+ILDCLP  N+ T++ LLDHL  V S SE NKM+ +ALA  +GP L   S   A     + +D  +    L Y+L IW
Sbjct:  770 INPAEFAKYKLDK--PIVDIGG-----------ISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQ-----SPLHQLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFGADLETVV----NRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLMLHS---ASAQPGADIDHAQPIAVLKYLLQIW 1134          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0302180)

HSP 1 Score: 296.59 bits (758), Expect = 3.818e-81
Identity = 159/390 (40.77%), Postives = 233/390 (59.74%), Query Frame = 1
Query: 2575 LDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGL---------NSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMP---VNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIW 3708
            ++P EF K + ++  P++  GG           +SGML IH++AG GL          ++Q   RDLYCV+E D V +AR+++R+    F+WDE FELD+  N  L  L Y WDP++RH+LC+ G ++L  ++ +     +   +LAL +EP+G ++I + +     +++R  +P        LFG  LE +V    NR+ +       VPI++RRC EEVE+RGLD++ +YRL G+   K  +RE  E++  A +L+ + VPDI+ IT VL+D+LRELPEPLFT  L++M +DAL V LP D    AKLML+ILDCLP  N+ T++ LLDHL  V S SE NKM+ +ALA  +GP L   S   A     + +D  +    L Y+L IW
Sbjct:  769 INPAEFAKYKLDK--PIVDIGG-----------ISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQ-----SPLHQLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFGADLETVV----NRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLMLHS---ASAQPGADIDHAQPIAVLKYLLQIW 1133          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0302181)

HSP 1 Score: 296.59 bits (758), Expect = 4.106e-81
Identity = 159/390 (40.77%), Postives = 233/390 (59.74%), Query Frame = 1
Query: 2575 LDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGL---------NSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMP---VNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIW 3708
            ++P EF K + ++  P++  GG           +SGML IH++AG GL          ++Q   RDLYCV+E D V +AR+++R+    F+WDE FELD+  N  L  L Y WDP++RH+LC+ G ++L  ++ +     +   +LAL +EP+G ++I + +     +++R  +P        LFG  LE +V    NR+ +       VPI++RRC EEVE+RGLD++ +YRL G+   K  +RE  E++  A +L+ + VPDI+ IT VL+D+LRELPEPLFT  L++M +DAL V LP D    AKLML+ILDCLP  N+ T++ LLDHL  V S SE NKM+ +ALA  +GP L   S   A     + +D  +    L Y+L IW
Sbjct:  780 INPAEFAKYKLDK--PIVDIGG-----------ISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQ-----SPLHQLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFGADLETVV----NRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLMLHS---ASAQPGADIDHAQPIAVLKYLLQIW 1144          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP100F (gene:FBgn0039883 transcript:FBtr0343538)

HSP 1 Score: 296.204 bits (757), Expect = 5.239e-81
Identity = 159/390 (40.77%), Postives = 233/390 (59.74%), Query Frame = 1
Query: 2575 LDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGL---------NSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMP---VNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIW 3708
            ++P EF K + ++  P++  GG           +SGML IH++AG GL          ++Q   RDLYCV+E D V +AR+++R+    F+WDE FELD+  N  L  L Y WDP++RH+LC+ G ++L  ++ +     +   +LAL +EP+G ++I + +     +++R  +P        LFG  LE +V    NR+ +       VPI++RRC EEVE+RGLD++ +YRL G+   K  +RE  E++  A +L+ + VPDI+ IT VL+D+LRELPEPLFT  L++M +DAL V LP D    AKLML+ILDCLP  N+ T++ LLDHL  V S SE NKM+ +ALA  +GP L   S   A     + +D  +    L Y+L IW
Sbjct:  780 INPAEFAKYKLDK--PIVDIGG-----------ISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQ-----SPLHQLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFGADLETVV----NRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLMLHS---ASAQPGADIDHAQPIAVLKYLLQIW 1144          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: SYDE2 (synapse defective 1, Rho GTPase, homolog 2 (C. elegans) [Source:NCBI gene;Acc:100333199])

HSP 1 Score: 199.904 bits (507), Expect = 8.829e-53
Identity = 131/404 (32.43%), Postives = 214/404 (52.97%), Query Frame = 1
Query: 2569 SRLDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTS-TEIFEWDEIFELDVEDNDWLAFLFYQWD--PRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTD----ALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVS--LPGDNY-----AGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQA---------QTLLYILNIWP 3711
            + LD + FR     + P  L              Y+SG++ +H      L   +   RD+YC +++DSV +AR+ + T  T   + D  F +++E+   L  + + W+  PR R+R+C +G V L  L   FR S T+  +LA+ LEP+G+++++L       + ++ +  ++ D     +FGV    +V R      E  G    VP+++ +C  E+E+RG  VV +YRL G+  +K  +RE  E+D  + +LS    PDI+ IT VL+D+LRELP PL T  LY  +L+A+     L G+       A ++L +++LD LP V + ++  LLDHLKRV+S  E+NKM  + LA   GPVL     E + +  +  +D ++ A         + L Y+L +WP
Sbjct:  140 TELDIDAFRSYSFTEQPKCLT-------------YISGLMSLHFYGAEDLKLPRVDSRDIYCAIQVDSVNKARTALLTCRTSFLDMDHTFNIELENAQHLKLVVFSWESTPR-RNRVCCHGTVVLPGL---FRVSKTH--QLAVRLEPRGMIYVKL------SLMEQRQNSLDGDHPQMQVFGVEARHVVER------EASG--LMVPLLIEKCISEIERRGCQVVGLYRLCGSAAVKKELREAFERDSHSVELSESNYPDINVITGVLKDYLRELPHPLITQQLYECVLEAMMKRPLLMGNAGCENTPADSQLTVSLLDILPDVEKASLKKLLDHLKRVASHHELNKMPCQNLAVCFGPVLLSQRQEASSQAKRVFIDSEELASALHFKKHIEVLHYLLQLWP 510          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:NCBI gene;Acc:568166])

HSP 1 Score: 186.422 bits (472), Expect = 1.688e-47
Identity = 111/331 (33.53%), Postives = 181/331 (54.68%), Query Frame = 1
Query: 2674 VSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRAR-SMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRN------RHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTD--ALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKL---MLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPE 3630
            +SG+L +H++    L  +    ++++C +++D V RAR S++         +  F L++E    L  +       N      R+R+C  G VA+  L +  R     S+ L + LEP+G+L+++L  L+  +    F  P +    A+FGV L  LV        E +    RVP+I+++C  E+++RGL VV +YRL G+  +K  +R+  E+D  A  L+ +  PD++ IT +L+D+LRELP PL T  LY ++L+A+ V     N + A+     +++L CLP   + T+  LLDHL  V+S S+ N+MT + LA   GPVL  PS E
Sbjct:  435 LSGLLTVHLLGVEELLRANKASKEVFCAIQVDGVTRARTSLLTCRGACLPLNHTFNLELERARLLKLVILTPATANASSAPARNRVCCVGAVAIPALFKACR-----SQHLCVRLEPRGLLYVKLTLLE--QFVSPFPRPGDLPPPAVFGVELRPLV--------EKESTALRVPLIIQKCVSEIQRRGLRVVGLYRLCGSAAVKKELRDAFERDSAAVTLNEELYPDVNVITGILKDYLRELPSPLITRTLYEVVLEAMTVRPAYRNDSDAQKSQSTVSLLHCLPEPERATLCFLLDHLSLVASYSDSNRMTCQNLAVCFGPVLLTPSQE 750          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: si:dkey-91m11.5 (si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-932])

HSP 1 Score: 137.502 bits (345), Expect = 5.885e-32
Identity = 115/374 (30.75%), Postives = 175/374 (46.79%), Query Frame = 1
Query: 2662 ATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQW------DPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPV-NTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQD-----VIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAX----------XXXXXXXXXXXQAQTLLYILNI 3705
            +TG + G L + V +  GL  S     +LYC LE+DS    V +A++ +   T    W+E FE+++E +  L  L Y        D  N  R+   G + L         S    +     +   G+  ++L     +  F   +MP      +FGV +  +  R          +  +VP+IVR+C EE+E+RG++ V IYR+SG       ++   + +     VI +++      D++AI   L+ + RELPEPLFT+ LY    + + +S   D+ A    MLN+L  LP  N  T L LLDHLKRV+    VNKM+   LA   GP L  PS +++K            D   L+   Q Q LLY L +
Sbjct:  929 STG-LCGFLNVIVHSATGLKQS----LNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRLLCYSKIKQCRDDGENIDRVMAKGQIQLDP------QSLQGKDWQRTVISMNGIE-VKLSMRFTSREFSLKRMPSRKQSGVFGVKIGAVTKR----------EHSKVPLIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDANNKDVSVIMSEM------DVNAIAGTLKLYFRELPEPLFTDELYINFTEGIALS---DSVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENEIVNKMSFHNLATVFGPTLLRPSEKDSKIPSNPTQPISMSDSWSLEVMSQVQVLLYFLQL 1271          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: si:dkey-91m11.5 (si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-932])

HSP 1 Score: 137.117 bits (344), Expect = 5.906e-32
Identity = 115/374 (30.75%), Postives = 175/374 (46.79%), Query Frame = 1
Query: 2662 ATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQW------DPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPV-NTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQD-----VIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAX----------XXXXXXXXXXXQAQTLLYILNI 3705
            +TG + G L + V +  GL  S     +LYC LE+DS    V +A++ +   T    W+E FE+++E +  L  L Y        D  N  R+   G + L         S    +     +   G+  ++L     +  F   +MP      +FGV +  +  R          +  +VP+IVR+C EE+E+RG++ V IYR+SG       ++   + +     VI +++      D++AI   L+ + RELPEPLFT+ LY    + + +S   D+ A    MLN+L  LP  N  T L LLDHLKRV+    VNKM+   LA   GP L  PS +++K            D   L+   Q Q LLY L +
Sbjct:  866 STG-LCGFLNVIVHSATGLKQS----LNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRLLCYSKIKQCRDDGENMDRVMAKGQIQLDP------QSLQGKDWQRTVISMNGIE-VKLSMRFTSREFSLKRMPSRKQSGVFGVKIGAVTKR----------EHSKVPLIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDANNKDVSVIMSEM------DVNAIAGTLKLYFRELPEPLFTDELYINFTEGIALS---DSVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENEIVNKMSFHNLATVFGPTLLRPSEKDSKIPSNPTQPISMSDSWSLEVMSQVQVLLYFLQL 1208          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: si:dkey-91m11.5 (si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-932])

HSP 1 Score: 137.117 bits (344), Expect = 6.950e-32
Identity = 115/374 (30.75%), Postives = 175/374 (46.79%), Query Frame = 1
Query: 2662 ATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQW------DPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPV-NTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQD-----VIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAX----------XXXXXXXXXXXQAQTLLYILNI 3705
            +TG + G L + V +  GL  S     +LYC LE+DS    V +A++ +   T    W+E FE+++E +  L  L Y        D  N  R+   G + L         S    +     +   G+  ++L     +  F   +MP      +FGV +  +  R          +  +VP+IVR+C EE+E+RG++ V IYR+SG       ++   + +     VI +++      D++AI   L+ + RELPEPLFT+ LY    + + +S   D+ A    MLN+L  LP  N  T L LLDHLKRV+    VNKM+   LA   GP L  PS +++K            D   L+   Q Q LLY L +
Sbjct:  878 STG-LCGFLNVIVHSATGLKQS----LNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRLLCYSKIKQCRDDGENMDRVMAKGQIQLDP------QSLQGKDWQRTVISMNGIE-VKLSMRFTSREFSLKRMPSRKQSGVFGVKIGAVTKR----------EHSKVPLIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDANNKDVSVIMSEM------DVNAIAGTLKLYFRELPEPLFTDELYINFTEGIALS---DSVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENEIVNKMSFHNLATVFGPTLLRPSEKDSKIPSNPTQPISMSDSWSLEVMSQVQVLLYFLQL 1220          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: il6 (interleukin 6 [Source:Xenbase;Acc:XB-GENE-480186])

HSP 1 Score: 204.912 bits (520), Expect = 1.402e-52
Identity = 137/433 (31.64%), Postives = 223/433 (51.50%), Query Frame = 1
Query: 2671 YVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTS-TEIFEWDEIFELDVEDNDWLAFLFYQWDPRNR-HRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDAL------FGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDA-----LQVSLPG--DNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQA---------QTLLYILNIWPDESDHQYHSRDSKSKEPQKIHSNSISNAQKITHITPSTRYSKPSPSTVRTSPNQTDTAATPR 3897
            Y+SG++ +H      L   +   +D++C +++DSV +AR+ + T  T   + D  F +++E+   L  + + WDP  R +R+C +G V L  L   FR   T + +LA+ LEP+G     L+Y+K+N + ++++  ++   +      FGV    +V        E +     VP+++ +C  E+EKRG  VV +YRL G+  +K  +RE  E+D  +  L     PDI+ IT VL+D+LRELP PL T  LY  +L A     L+++  G  ++   ++  +++LDCLP V + T+  LLDHLK V+S  EVNKMT + LA   GPVL     E +   ++  +D ++ A         + L Y+L +WP         +++ +KEP     NS      +T   P  R  KP P T+    +       PR
Sbjct:  812 YISGLMSLHFYGAEDLKPPKIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIELENAQHLKLVVFSWDPTPRKNRVCCHGTVVLPAL---FR--VTKTHQLAVKLEPRG-----LIYVKLN-LMEQWENSLDRPGVDREPIVFGVEARKVV--------EKENAGLMVPLLMDKCITEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKSVGLCESQYPDINVITGVLKDYLRELPSPLITKHLYEAVLKAMAEKPLKMASSGCENDSRDSENTVSLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQRQETSSHNNRVFIDSEELASALDFKKHIEVLHYLLQLWP--------VKNASAKEPAP---NST-----LTEQQPCLRRKKPRPQTLNLGSSDMSGVLRPR 1209          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: il6 (interleukin 6 [Source:Xenbase;Acc:XB-GENE-480186])

HSP 1 Score: 204.912 bits (520), Expect = 1.764e-52
Identity = 137/433 (31.64%), Postives = 223/433 (51.50%), Query Frame = 1
Query: 2671 YVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTS-TEIFEWDEIFELDVEDNDWLAFLFYQWDPRNR-HRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDAL------FGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDA-----LQVSLPG--DNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQA---------QTLLYILNIWPDESDHQYHSRDSKSKEPQKIHSNSISNAQKITHITPSTRYSKPSPSTVRTSPNQTDTAATPR 3897
            Y+SG++ +H      L   +   +D++C +++DSV +AR+ + T  T   + D  F +++E+   L  + + WDP  R +R+C +G V L  L   FR   T + +LA+ LEP+G     L+Y+K+N + ++++  ++   +      FGV    +V        E +     VP+++ +C  E+EKRG  VV +YRL G+  +K  +RE  E+D  +  L     PDI+ IT VL+D+LRELP PL T  LY  +L A     L+++  G  ++   ++  +++LDCLP V + T+  LLDHLK V+S  EVNKMT + LA   GPVL     E +   ++  +D ++ A         + L Y+L +WP         +++ +KEP     NS      +T   P  R  KP P T+    +       PR
Sbjct: 1039 YISGLMSLHFYGAEDLKPPKIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIELENAQHLKLVVFSWDPTPRKNRVCCHGTVVLPAL---FR--VTKTHQLAVKLEPRG-----LIYVKLN-LMEQWENSLDRPGVDREPIVFGVEARKVV--------EKENAGLMVPLLMDKCITEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKSVGLCESQYPDINVITGVLKDYLRELPSPLITKHLYEAVLKAMAEKPLKMASSGCENDSRDSENTVSLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQRQETSSHNNRVFIDSEELASALDFKKHIEVLHYLLQLWP--------VKNASAKEPAP---NST-----LTEQQPCLRRKKPRPQTLNLGSSDMSGVLRPR 1436          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:100170543])

HSP 1 Score: 132.109 bits (331), Expect = 2.770e-30
Identity = 115/377 (30.50%), Postives = 176/377 (46.68%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDP-RNR----------HRLCFYGNVALRQ---LIERFRHSYTNSEKLALYLEPKGVLFIELLYLKI-NEVFQRFKMPVNTD-ALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQD-----VIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAX----------XXXXXXXXXXXQAQTLLYILNI 3705
            G L + V +  G   S     +L+C LE+DS    V +A++ +  +T    W+E FE+++E +  L  L Y+    RNR           R+   G V L     L + +  S  +   +++ +E K       L +K  +  F   ++P      +FGV + V+  R+            +VP IVR+C EE+E+RGL+ V IYR+SG       ++   + +     V+ +D+      D++AI   L+ + RELP PLFT+ LY    + + +S   D  A    MLN+L  LP  N  T L LLDHLKRV+     NKM+   LA   GP L  PS +++K            D   L+   Q Q LLY L +
Sbjct:  798 GFLNVIVHSATGFQQSS----NLFCTLEVDSFGYFVNKAKTRVYRNTTEPNWNEEFEIELEGSQTLRILCYEKSCNRNRPMKEDGGDSSERMVAKGQVQLESQLALGKDWHRSVVSMNGVSILIEVK-------LSMKFTSREFSLKRLPSRKQTGVFGVKIAVVTKRE----------RSKVPYIVRQCVEEIERRGLEEVGIYRVSGVATDIQALKNAFDANNKDVSVMMSDM------DVNAIAGTLKLYFRELPAPLFTDELYPNFAEGIALS---DPVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENESQNKMSLHNLATVFGPTLLRPSEKDSKIPVNPTQPISMADSWSLEVMSQVQVLLYFLQL 1144          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:100170543])

HSP 1 Score: 129.413 bits (324), Expect = 1.892e-29
Identity = 113/373 (30.29%), Postives = 171/373 (45.84%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDP-RNR----------HRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTD-ALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQD-----VIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAX----------XXXXXXXXXXXQAQTLLYILNI 3705
            G L + V +  G   S     +L+C LE+DS    V +A++ +  +T    W+E FE+++E +  L  L Y+    RNR           R+   G V L  L + +  S  +   + + L  K            +  F   ++P      +FGV + V+  R+            +VP IVR+C EE+E+RGL+ V IYR+SG       ++   + +     V+ +D+      D++AI   L+ + RELP PLFT+ LY    + + +S   D  A    MLN+L  LP  N  T L LLDHLKRV+     NKM+   LA   GP L  PS +++K            D   L+   Q Q LLY L +
Sbjct:  775 GFLNVIVHSATGFQQSS----NLFCTLEVDSFGYFVNKAKTRVYRNTTEPNWNEEFEIELEGSQTLRILCYEKSCNRNRPMKEDGGDSSERMVAKGQVQL-ALGKDWHRSVVSMNGIEVKLSMKFT----------SREFSLKRLPSRKQTGVFGVKIAVVTKRE----------RSKVPYIVRQCVEEIERRGLEEVGIYRVSGVATDIQALKNAFDANNKDVSVMMSDM------DVNAIAGTLKLYFRELPAPLFTDELYPNFAEGIALS---DPVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENESQNKMSLHNLATVFGPTLLRPSEKDSKIPVNPTQPISMADSWSLEVMSQVQVLLYFLQL 1113          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: bcr (BCR, RhoGEF and GTPase activating protein [Source:NCBI gene;Acc:100170543])

HSP 1 Score: 129.028 bits (323), Expect = 3.042e-29
Identity = 111/369 (30.08%), Postives = 175/369 (47.43%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDP-RNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLE-PKGVLFIELLYLKINEVFQRFKMPVN------TDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQD-----VIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAX----------XXXXXXXXXXXQAQTLLYILNI 3705
            G L + V +  G   S     +L+C LE+DS    V +A++ +  +T    W+E FE+++E +  L  L Y+    RNR      G+ + R +    +       +LAL  +  + V+ +  + +K++  F   +  +          +FGV + V+  R+            +VP IVR+C EE+E+RGL+ V IYR+SG       ++   + +     V+ +D+      D++AI   L+ + RELP PLFT+ LY    + + +S   D  A    MLN+L  LP  N  T L LLDHLKRV+     NKM+   LA   GP L  PS +++K            D   L+   Q Q LLY L +
Sbjct:  788 GFLNVIVHSATGFQQSS----NLFCTLEVDSFGYFVNKAKTRVYRNTTEPNWNEEFEIELEGSQTLRILCYEKSCNRNRPMKEDGGDSSERMVA---KGQVQLESQLALGKDWHRSVVSMNGIEVKLSMKFTSREFSLKRLPSRKQTGVFGVKIAVVTKRE----------RSKVPYIVRQCVEEIERRGLEEVGIYRVSGVATDIQALKNAFDANNKDVSVMMSDM------DVNAIAGTLKLYFRELPAPLFTDELYPNFAEGIALS---DPVAKESCMLNLLLSLPEPNLLTFLFLLDHLKRVAENESQNKMSLHNLATVFGPTLLRPSEKDSKIPVNPTQPISMADSWSLEVMSQVQVLLYFLQL 1130          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Syde2 (synapse defective 1, Rho GTPase, homolog 2 (C. elegans) [Source:MGI Symbol;Acc:MGI:3036264])

HSP 1 Score: 216.853 bits (551), Expect = 7.450e-57
Identity = 164/559 (29.34%), Postives = 271/559 (48.48%), Query Frame = 1
Query: 2371 FDNATRTDLSYFRAPNNVLEYSSPGYAFSSNAQNDFRSTASAPSFRSLRQPSRPKDQQMDHGEQSV------SRLDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTS-TEIFEWDEIFELDVEDNDWLAFLFYQWDPR-NRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDA-LFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDA-----LQVSLPG--DNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQA---------QTLLYILNIWPDESDHQYHSRDSKSKEPQKIHSNSISNAQKITHITPSTRYSKPSPSTV-RTSPNQTDTAATPRKSDAPINSGMNSAENVRSQNNVKN 3969
             D    +  SY + P    +YS  G          + S   +P  R+ R      + ++  G ++V      + LD   FR       P               + Y+SG++ +H     GL   +   +D++C +++DSV +AR+ + T  T   + D  F +++E+   L  + + W+P   R+R+C +G V L  L   FR   T + +LA+ LEP+G++++++  ++  E      +  N +A +FGV ++ +V        E +     VP+++++C  E+EKRG  VV +YRL G+  +K  +RE  E+D     L  +  PDI+ IT VL+D+LRELP PL T  LY  +LDA     L++S  G  +  + ++L +++LDCLP V + T+  LLDHLK V+S  EVNKMT + LA   GPVL     E +   ++   D ++ A         + L Y+L +WP +       RDS   E     S+S++  ++          S P  S V RT   + D+  + R +    + G + + N R   NVKN
Sbjct:  447 LDTTVSSRHSYRKKPLGSSKYSCKG---------GYLSDGDSPELRT-RSSKHGSEHKLGKGRETVPSSCSKNELDIGAFRHYSFADQP-------------KCSQYISGLMSVHFYGAEGLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRRNRVCCHGTVVLPAL---FR--VTKTHQLAVKLEPRGLIYVKVTLMEQWE-NSLHGLDKNREAVMFGVDIQKVV--------EKENVGLMVPLLIQKCIVEIEKRGCQVVGLYRLCGSAAVKKELREAFEKDSKTVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSSGCENEPSDSRLTVDLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLNQRQEASTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWPVQRLTVKEPRDSLCLE----QSSSLNYLRRKKERPCVLNLSGPDSSGVLRTRQARLDSPLSNRYAGDWSSCGESYSLNTR--GNVKN 962          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Syde2 (synapse defective 1, Rho GTPase, homolog 2 (C. elegans) [Source:MGI Symbol;Acc:MGI:3036264])

HSP 1 Score: 216.853 bits (551), Expect = 7.561e-57
Identity = 164/559 (29.34%), Postives = 271/559 (48.48%), Query Frame = 1
Query: 2371 FDNATRTDLSYFRAPNNVLEYSSPGYAFSSNAQNDFRSTASAPSFRSLRQPSRPKDQQMDHGEQSV------SRLDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTS-TEIFEWDEIFELDVEDNDWLAFLFYQWDPR-NRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDA-LFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDA-----LQVSLPG--DNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQA---------QTLLYILNIWPDESDHQYHSRDSKSKEPQKIHSNSISNAQKITHITPSTRYSKPSPSTV-RTSPNQTDTAATPRKSDAPINSGMNSAENVRSQNNVKN 3969
             D    +  SY + P    +YS  G          + S   +P  R+ R      + ++  G ++V      + LD   FR       P               + Y+SG++ +H     GL   +   +D++C +++DSV +AR+ + T  T   + D  F +++E+   L  + + W+P   R+R+C +G V L  L   FR   T + +LA+ LEP+G++++++  ++  E      +  N +A +FGV ++ +V        E +     VP+++++C  E+EKRG  VV +YRL G+  +K  +RE  E+D     L  +  PDI+ IT VL+D+LRELP PL T  LY  +LDA     L++S  G  +  + ++L +++LDCLP V + T+  LLDHLK V+S  EVNKMT + LA   GPVL     E +   ++   D ++ A         + L Y+L +WP +       RDS   E     S+S++  ++          S P  S V RT   + D+  + R +    + G + + N R   NVKN
Sbjct:  448 LDTTVSSRHSYRKKPLGSSKYSCKG---------GYLSDGDSPELRT-RSSKHGSEHKLGKGRETVPSSCSKNELDIGAFRHYSFADQP-------------KCSQYISGLMSVHFYGAEGLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRRNRVCCHGTVVLPAL---FR--VTKTHQLAVKLEPRGLIYVKVTLMEQWE-NSLHGLDKNREAVMFGVDIQKVV--------EKENVGLMVPLLIQKCIVEIEKRGCQVVGLYRLCGSAAVKKELREAFEKDSKTVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSSGCENEPSDSRLTVDLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLNQRQEASTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWPVQRLTVKEPRDSLCLE----QSSSLNYLRRKKERPCVLNLSGPDSSGVLRTRQARLDSPLSNRYAGDWSSCGESYSLNTR--GNVKN 963          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Syde2 (synapse defective 1, Rho GTPase, homolog 2 (C. elegans) [Source:MGI Symbol;Acc:MGI:3036264])

HSP 1 Score: 216.083 bits (549), Expect = 3.315e-56
Identity = 146/484 (30.17%), Postives = 241/484 (49.79%), Query Frame = 1
Query: 2371 FDNATRTDLSYFRAPNNVLEYSSPGYAFSSNAQNDFRSTASAPSFRSLRQPSRPKDQQMDHGEQSV------SRLDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTS-TEIFEWDEIFELDVEDNDWLAFLFYQWDPR-NRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDA-LFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDA-----LQVSLPG--DNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQA---------QTLLYILNIWPDESDHQYHSRDS 3747
             D    +  SY + P    +YS  G          + S   +P  R+ R      + ++  G ++V      + LD   FR       P               + Y+SG++ +H     GL   +   +D++C +++DSV +AR+ + T  T   + D  F +++E+   L  + + W+P   R+R+C +G V L  L   FR   T + +LA+ LEP+G++++++  ++  E      +  N +A +FGV ++ +V        E +     VP+++++C  E+EKRG  VV +YRL G+  +K  +RE  E+D     L  +  PDI+ IT VL+D+LRELP PL T  LY  +LDA     L++S  G  +  + ++L +++LDCLP V + T+  LLDHLK V+S  EVNKMT + LA   GPVL     E +   ++   D ++ A         + L Y+L +WP +       RDS
Sbjct:  715 LDTTVSSRHSYRKKPLGSSKYSCKG---------GYLSDGDSPELRT-RSSKHGSEHKLGKGRETVPSSCSKNELDIGAFRHYSFADQP-------------KCSQYISGLMSVHFYGAEGLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRRNRVCCHGTVVLPAL---FR--VTKTHQLAVKLEPRGLIYVKVTLMEQWE-NSLHGLDKNREAVMFGVDIQKVV--------EKENVGLMVPLLIQKCIVEIEKRGCQVVGLYRLCGSAAVKKELREAFEKDSKTVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSSGCENEPSDSRLTVDLLDCLPDVEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLNQRQEASTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWPVQRLTVKEPRDS 1161          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Syde1 (synapse defective 1, Rho GTPase, homolog 1 (C. elegans) [Source:MGI Symbol;Acc:MGI:1918959])

HSP 1 Score: 196.052 bits (497), Expect = 2.201e-51
Identity = 132/356 (37.08%), Postives = 192/356 (53.93%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVV-RDLYCVLEIDSVRRARSM-IRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPR-NRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDA-LFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLF-------FPSPEEAXXXXXXXXXXXXQAQTLLYILNIWPD 3714
            G L +H+    GL  S     RDL C+L++D V RAR+  +R+  +    D  F L++E    L  L   WDP   RHR C  G V L  +   FR     +++LA+ LEP+G+L+ +L   +  E       P   +  +FG+PL++LV R+     ++ GQ   VP+I+R+C  ++E RGL VV +YRL G+  +K  +R+  EQD  A  LS D  PDI+ IT +L+D+LRELP PL T  LY+++L+A+    P     G +    +L CLP V + T+  LLDHL+ VSS    N+MT + LA   GPVL         P    +     S +D K+  + L Y+L  WPD
Sbjct:  266 GRLSLHLYGLGGLRPSPGATPRDLCCLLQVDGVARARTGPLRSGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTI---FRG--CQAQQLAVRLEPQGLLYAKLTLSEQQEA------PATAEPRVFGLPLQLLVERE-----QSPGQ---VPLIIRKCVGQIECRGLRVVGLYRLCGSAAVKKELRDAFEQDSAAVCLSEDVYPDINVITGILKDYLRELPTPLITQPLYQVVLEAMAQGHPSRASLGPEGTRGLLRCLPDVERATLTLLLDHLRLVSSFHTHNRMTPQNLAVCFGPVLLPARQTPSRPRLRSSGPGVTSAVDFKRHIEVLHYLLQSWPD 602          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Bcr (BCR activator of RhoGEF and GTPase [Source:MGI Symbol;Acc:MGI:88141])

HSP 1 Score: 136.732 bits (343), Expect = 8.648e-32
Identity = 110/363 (30.30%), Postives = 172/363 (47.38%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFR-----HSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTD-ALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVP-DIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEA----------XXXXXXXXXXXXQAQTLLYILNI 3705
            G L + V +  G   S     +LYC LE+DS    V +A++ +   T    W+E FE+++E +  L  L Y+    N+ ++      +  +L+ + +      +  + +     ++  G+  ++L     +  F   +MP      +FGV + V+  R+            +VP IVR+C EE+E+RG++ V IYR+SG       ++     DV   D+S      D++AI   L+ + RELPEPLFT+  Y    + + +S   D  A    MLN+L  LP  N  T L LLDHLKRV+ +  VNKM+   LA   GP L  PS +E+             D   L+   Q Q LLY L +
Sbjct:  910 GFLHVIVHSATGFKQSS----NLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRILCYE-KCYNKMKMTKEDGESADKLMGKGQVQLDPQTLQDRDWQRTVIDMNGIE-VKLSVKFTSREFSLKRMPSRKQTGVFGVKIAVVTKRE----------RSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAF--DVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALS---DPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQL 1251          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|Q9V9S7|SYDE_DROME (Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2)

HSP 1 Score: 296.59 bits (758), Expect = 4.116e-80
Identity = 159/390 (40.77%), Postives = 233/390 (59.74%), Query Frame = 1
Query: 2575 LDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGL---------NSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMP---VNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIW 3708
            ++P EF K + ++  P++  GG           +SGML IH++AG GL          ++Q   RDLYCV+E D V +AR+++R+    F+WDE FELD+  N  L  L Y WDP++RH+LC+ G ++L  ++ +     +   +LAL +EP+G ++I + +     +++R  +P        LFG  LE +V    NR+ +       VPI++RRC EEVE+RGLD++ +YRL G+   K  +RE  E++  A +L+ + VPDI+ IT VL+D+LRELPEPLFT  L++M +DAL V LP D    AKLML+ILDCLP  N+ T++ LLDHL  V S SE NKM+ +ALA  +GP L   S   A     + +D  +    L Y+L IW
Sbjct:  780 INPAEFAKYKLDK--PIVDIGG-----------ISGMLWIHLLAGRGLRTAPEGAAGTATQGQTRDLYCVIECDRVHKARTVVRSGDLQFDWDESFELDLVGNKQLDVLVYSWDPQHRHKLCYRGAISLSSILRQ-----SPLHQLALKVEPRGTIYIRMRHTDPLALYKRRGLPSLRAGYPTLFGADLETVV----NRESKNAPGSAPVPIVLRRCVEEVERRGLDIIGLYRLCGSATKKRLLREAFERNSRAVELTPEHVPDINVITGVLKDYLRELPEPLFTRCLFQMTVDALAVCLPDDPEGNAKLMLSILDCLPRANRATLVFLLDHLSLVVSNSERNKMSAQALATVMGPPLMLHS---ASAQPGADIDHAQPIAVLKYLLQIW 1144          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|Q61CA4|SYD1_CAEBR (Rho GTPase-activating protein syd-1 OS=Caenorhabditis briggsae OX=6238 GN=syd-1 PE=3 SV=2)

HSP 1 Score: 222.246 bits (565), Expect = 4.748e-58
Identity = 131/395 (33.16%), Postives = 216/395 (54.68%), Query Frame = 1
Query: 2620 PVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLN---SSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKL-ALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFF--------PSPEEAXXXXXXXXXXXXQAQTLLYILNIWPDESDHQYHSRDSKSKEPQK 3768
            P+ A+G     ++ +   ++G+L +H++ G GL      + +  ++YCVLE+D   RAR+ + T  + F+W E F +DV +     F  Y W P+ RH+LC  G++   +L+E F     N +++ AL LEP+G L + + +  +  VF+R   P   + +FGVPL  LV R+              PI++ R  +E+EKRG+D+  +Y L G+V+ K  +R  LE + +  DL+A+ +PD + I  +++DFLRELPEPL +  ++ M+L+A  V+LP D  A   L+L I+DCL +  ++ +L +LDHL  +   S  N +T   L+    P+LFF         +   +K      LD  + + +L  IL+IWP   + +  S DS +   QK
Sbjct:  570 PLRAAGPGINVDRLSVSSLTGILYVHILEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSL---KLLEAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRRTVNP-RLNGVFGVPLGRLVQRERRD----------TPIVLTRLIQEIEKRGVDLSGLYVLCGSVEKKKMLRAQLESNPLGTDLNAENIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAATVALPNDVQANRTLVLKIIDCLQLSAKNCLLLVLDHLSTILCSSPHNGLTPTRLSLIFAPLLFFCLDAISPYTTSPTSKMAAVRSLDMNQASSSLQMILSIWPSRVNSESGS-DSPATSGQK 949          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|Q86NH1|SYD1_CAEEL (Rho GTPase-activating protein syd-1 OS=Caenorhabditis elegans OX=6239 GN=syd-1 PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 5.923e-56
Identity = 131/395 (33.16%), Postives = 215/395 (54.43%), Query Frame = 1
Query: 2620 PVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLN---SSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKL-ALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFP----SP----EEAXXXXXXXXXXXXQAQTLLYILNIWPDESDHQYHSRDSKSKEPQK 3768
            P+ A+G     ++ +   ++G+L +H+V G GL      + +  ++YCVLE+D   RAR+ + T  + F+W E F +DV +     F  Y W P+ RH+LC  G++   +L+E F     N +++ AL LEP+G L + + +  +  VF+R   P   + +FG+ L  LV R+              PI++ R  +E+EKRG+D   +Y L G+V+ K  +R  LE + +  +L+A+++PD + I  +++DFLRELPEPL +  ++ M+L+A  V+LP D      L+L I+DCL +  ++ +L +LDHL  V   S  N +T   L+    P+LFF     SP      +K      LD  + + +L  IL+IWP   + +  S DS +   QK
Sbjct:  596 PLRAAGPGINVDRLSVSSLTGILYVHIVEGRGLKIPEKQKGLTEEMYCVLEVDEQHRARTGVSTIEQKFKWRETFHIDVVNATVSNFFVYSWHPQFRHKLCHKGSL---KLLEAFVVDQLNDDRVFALNLEPRGQLIVRIGFHDLQAVFRRTVNP-RLNGVFGISLSRLVQRERRD----------TPIVLTRLIQEIEKRGVDYSGLYVLCGSVEKKKMLRAELESNPLGTELAAESIPDTNVIACLIKDFLRELPEPLISPQIHGMLLEAASVALPNDVQTNRHLVLKIIDCLQLSAKNCLLLVLDHLSTVLCSSPHNGLTPTRLSLIFAPLLFFCLDTFSPYTISPTSKMAAVRTLDINQASSSLQMILSIWPSRVNSESGS-DSPATTCQK 975          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|Q5VT97|SYDE2_HUMAN (Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 5.150e-54
Identity = 124/370 (33.51%), Postives = 203/370 (54.86%), Query Frame = 1
Query: 2671 YVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTS-TEIFEWDEIFELDVEDNDWLAFLFYQWDPRNR-HRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDAL-FGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSL-----------PGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQA---------QTLLYILNIWP 3711
            Y+SG++ +H      L   +   +D++C +++DSV +AR+ + T  T   + D  F +++E+   L  + + W+P  R +R+C +G V L  L   FR   T + +LA+ LEP+G++++++  ++  E      + +N + + FGV ++ +V        E +     VP+++++C  E+EKRG  VV +YRL G+  +K  +RE  E+D  A  L  +  PDI+ IT VL+D+LRELP PL T  LY  +LDA+  S            PGD    +K  +++LDCLP + + T+  LLDHLK V+S  EVNKMT + LA   GPVL     E +   ++   D ++ A         + L Y+L +WP
Sbjct:  677 YISGLMSVHFYGAEDLKPPRIDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRKNRVCCHGTVVLPTL---FR--VTKTHQLAVKLEPRGLIYVKVTLMEQWE-NSLHGLDINQEPIIFGVDIQKVV--------EKENIGLMVPLLIQKCIMEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKAVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKSPLKMSSNGCENDPGD----SKYTVDLLDCLPEIEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVLLSQRQEPSTHNNRVFTDSEELASALDFKKHIEVLHYLLQLWP 1028          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|D3ZZN9|SYDE1_RAT (Rho GTPase-activating protein SYDE1 OS=Rattus norvegicus OX=10116 GN=Syde1 PE=1 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 6.997e-50
Identity = 128/356 (35.96%), Postives = 189/356 (53.09%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVV-RDLYCVLEIDSVRRARSM-IRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPR-NRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDA-LFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQA-------QTLLYILNIWPD 3714
            G L +H+    GL  +     RDL C+L++D V RAR+  +R+  +    D  F L++E    L  L   WDP   RHR C  G V L  +   FR     +++LA+ LEP+G+L+ +L   +  E       P   +  +FG+PL++LV R+     ++ GQ   VP+I+R+C  ++E RGL VV +YRL G+  +K  +R+  EQD  A  LS D  PDI+ IT +L+D+LRELP PL T  LY+++L+A+    P     G +    +L CLP V + T+  LLDHL+ VSS    N+MT + LA   GPVL       ++   +        A       + L Y+L  WPD
Sbjct:  266 GRLSLHLYGLGGLRPTPGATPRDLCCLLQVDGVARARTGPLRSGPDFLRLDHTFHLELEAARLLRALVLAWDPGVRRHRPCAQGTVLLPTI---FRG--CQAQQLAVRLEPQGLLYAKLTLSEQQEA------PATVEPRVFGLPLQLLVERE-----QSPGQ---VPLIIRKCVGQIECRGLRVVGLYRLCGSAAVKKELRDAFEQDSAAVCLSEDVYPDINVITGILKDYLRELPTPLITQPLYQVVLEAMAQGHPSRASLGPEGTRGLLSCLPDVERATLTLLLDHLRLVSSFHTHNRMTPQNLAVCFGPVLLPARQTPSRTRLRGSGPGVSSAVDFKRHIEVLHYLLQSWPD 602          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267G9H2 (Rho-GAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014851g2 PE=4 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 2.670e-117
Identity = 198/381 (51.97%), Postives = 260/381 (68.24%), Query Frame = 1
Query: 2566 VSRLDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIW 3708
              RL  +EFR   +++    L  G HP         + G+L +HVVAG GL++    +RDLYC+LE+DSVR ARS+IRTSTE F WDE F+L       L FL YQWDP N+HRLCF+G+V L  L   FRH    SE++AL +EPKG L+ EL    I+EV  R + P    ++FGVP+++LV R      E  GQ+  VP++V++C +EVE+RGLD+  IYRL G+ K KI +RE  E+     DLSAD VPDIHA+T +L+DF+RELPEPLFTNALYRM+LDAL V +PGD   GAKLML+ILDCLP VNQ+T++ +LDHLKRV+ RS+ NKMT + LA  LGP+L +PSP+ A+ ++ S L   + +  L YIL+IW
Sbjct:  104 AGRLSLHEFRPCPSDRSARSLGPG-HP-------AGIDGVLRVHVVAGTGLHAPVVALRDLYCLLELDSVRMARSLIRTSTECFHWDEQFDLFAAGARGLGFLLYQWDPSNKHRLCFHGSVNLVSLAASFRHRCIRSERIALGMEPKGCLYFELTCYSISEVMCRTQSPRMHSSIFGVPIDILVRR------EKSGQQ--VPLLVQKCIDEVERRGLDIPGIYRLCGSNKSKISLREAFERRPGKVDLSADKVPDIHAVTGLLKDFVRELPEPLFTNALYRMLLDALAVEIPGDPRGGAKLMLSILDCLPPVNQETLVAILDHLKRVALRSDANKMTLDQLATCLGPLLLYPSPDSARIMEASFLQLGRMSHVLQYILDIW 468          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267DD13 (Rho-GAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033009g1 PE=4 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 2.842e-117
Identity = 198/381 (51.97%), Postives = 260/381 (68.24%), Query Frame = 1
Query: 2566 VSRLDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIW 3708
              RL  +EFR   +++    L  G HP         + G+L +HVVAG GL++    +RDLYC+LE+DSVR ARS+IRTSTE F WDE F+L       L FL YQWDP N+HRLCF+G+V L  L   FRH    SE++AL +EPKG L+ EL    I+EV  R + P    ++FGVP+++LV R      E  GQ+  VP++V++C +EVE+RGLD+  IYRL G+ K KI +RE  E+     DLSAD VPDIHA+T +L+DF+RELPEPLFTNALYRM+LDAL V +PGD   GAKLML+ILDCLP VNQ+T++ +LDHLKRV+ RS+ NKMT + LA  LGP+L +PSP+ A+ ++ S L   + +  L YIL+IW
Sbjct:  106 AGRLSLHEFRPCPSDRSARSLGPG-HP-------AGIDGVLRVHVVAGTGLHAPVVALRDLYCLLELDSVRMARSLIRTSTECFHWDEQFDLFAAGARGLGFLLYQWDPSNKHRLCFHGSVNLVSLAASFRHRCIRSERIALGMEPKGCLYFELTCYSISEVMCRTQSPRMHSSIFGVPIDILVRR------EKSGQQ--VPLLVQKCIDEVERRGLDIPGIYRLCGSNKSKISLREAFERRPGKVDLSADKVPDIHAVTGLLKDFVRELPEPLFTNALYRMLLDALAVEIPGDPRGGAKLMLSILDCLPPVNQETLVAILDHLKRVALRSDANKMTLDQLATCLGPLLLYPSPDSARIMEASFLQLGRMSHVLQYILDIW 470          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267DXS3 (Rho-GAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014851g1 PE=4 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 1.968e-116
Identity = 198/381 (51.97%), Postives = 260/381 (68.24%), Query Frame = 1
Query: 2566 VSRLDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIW 3708
              RL  +EFR   +++    L  G HP         + G+L +HVVAG GL++    +RDLYC+LE+DSVR ARS+IRTSTE F WDE F+L       L FL YQWDP N+HRLCF+G+V L  L   FRH    SE++AL +EPKG L+ EL    I+EV  R + P    ++FGVP+++LV R      E  GQ+  VP++V++C +EVE+RGLD+  IYRL G+ K KI +RE  E+     DLSAD VPDIHA+T +L+DF+RELPEPLFTNALYRM+LDAL V +PGD   GAKLML+ILDCLP VNQ+T++ +LDHLKRV+ RS+ NKMT + LA  LGP+L +PSP+ A+ ++ S L   + +  L YIL+IW
Sbjct:  214 AGRLSLHEFRPCPSDRSARSLGPG-HPAG-------IDGVLRVHVVAGTGLHAPVVALRDLYCLLELDSVRMARSLIRTSTECFHWDEQFDLFAAGARGLGFLLYQWDPSNKHRLCFHGSVNLVSLAASFRHRCIRSERIALGMEPKGCLYFELTCYSISEVMCRTQSPRMHSSIFGVPIDILVRR------EKSGQQ--VPLLVQKCIDEVERRGLDIPGIYRLCGSNKSKISLREAFERRPGKVDLSADKVPDIHAVTGLLKDFVRELPEPLFTNALYRMLLDALAVEIPGDPRGGAKLMLSILDCLPPVNQETLVAILDHLKRVALRSDANKMTLDQLATCLGPLLLYPSPDSARIMEASFLQLGRMSHVLQYILDIW 578          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267GUS3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013375g2 PE=4 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 2.242e-113
Identity = 191/345 (55.36%), Postives = 253/345 (73.33%), Query Frame = 1
Query: 2674 VSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIW 3708
            V G+L +HV+AG+GL+SSQ+++RDLYC+LE+DS R ARSMIRTST+ FEWDE F++       L FL YQWDPR++HRLCFYGNV L  L+  FR  Y  SEK+AL LEPKG L+ E+ + +++EVF R   P     +FGVPL++L  R+          +  +P++VR+C +EVE+RGL+V  IYRL G+ + K  +R+ L++    AD+SA+ VPDIHA+T VL+DFL ELPEPLFTNALYRM+LDALQV LPGD   GAKLML+ILDCLP  NQ+T+L LLDHLKRV+++++VNKMT   LA  LGP+L FPSP+ A+++D  +L   + +  L YIL IW
Sbjct:  601 VDGVLRVHVIAGVGLHSSQSLLRDLYCLLELDSTRVARSMIRTSTDCFEWDEQFDIFCSGARGLGFLLYQWDPRSKHRLCFYGNVNLVSLLSSFRQRYIKSEKIALSLEPKGQLYFEVTFAEVHEVFCR--EPAQRSGVFGVPLDLLARRE----------KSSIPMLVRKCIDEVERRGLEVAGIYRLCGSSRNKQPVRDALDRSAAEADVSAEKVPDIHAVTGVLKDFLCELPEPLFTNALYRMMLDALQVRLPGDPKGGAKLMLSILDCLPPANQETLLLLLDHLKRVAAKADVNKMTTGQLATCLGPLLLFPSPDAARQMDPEILRLGRMSDVLKYILEIW 933          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267F832 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013375g1 PE=4 SV=1)

HSP 1 Score: 390.963 bits (1003), Expect = 1.766e-112
Identity = 191/345 (55.36%), Postives = 252/345 (73.04%), Query Frame = 1
Query: 2674 VSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIW 3708
            V G+L +HV+AG+GL+SSQ+++RDLYC+LE+DS R ARSMIRTST+ FEWDE F++       L FL YQWDPR++HRLCFYGNV L  L+  FR  Y  SEK+AL LEPKG L+ E+ + ++ +VF R   P     +FGVPL++L  R+          +  +P++VR+C +EVE+RGL+V  IYRL G+ + K  +RE L++    AD+SA+ VPDIHA+T VL+DFL ELPEPLFTNALYRM+LDALQV LPGD   GAKLML+ILDCLP  NQ+T+L LLDHLKRV+++++VNKMT   LA  LGP+L FPSP+ A+++D  +L   + +  L YIL IW
Sbjct:  601 VDGVLRVHVIAGVGLHSSQSLLRDLYCLLELDSTRVARSMIRTSTDCFEWDEQFDIFCSGARGLGFLLYQWDPRSKHRLCFYGNVNLVSLLSSFRQRYIKSEKIALSLEPKGQLYFEVTFAEVPDVFCR--EPAQRIGVFGVPLDLLARRE----------KSSIPMLVRKCIDEVERRGLEVAGIYRLCGSSRNKQPVREALDRSAAEADVSAEKVPDIHAVTGVLKDFLCELPEPLFTNALYRMMLDALQVRLPGDPKGGAKLMLSILDCLPPANQETLLLLLDHLKRVAAKADVNKMTTGQLATCLGPLLLFPSPDAARQMDPEILRLDRMSDVLKYILEIW 933          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: SYDE2 (synapse defective Rho GTPase homolog 2 [Source:NCBI gene;Acc:103025539])

HSP 1 Score: 203.371 bits (516), Expect = 3.169e-52
Identity = 129/375 (34.40%), Postives = 201/375 (53.60%), Query Frame = 1
Query: 2662 ATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTS-TEIFEWDEIFELDVEDNDWLAFLFYQWD--PRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLK--INEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDA-----LQVSLPG--DNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLF-------------FPSPEEAXXXXXXXXXXXXQAQTLLYILNIWP 3711
             T Y+SG++ +H     GL   +   R +YC +++DSV +AR+ + T  T   + D  F +++E+   L    + W+  PR R+R+C +G V L  L   FR + T + +LA+ LEP+G+++++L  ++   N +            +FGV    +V R+        G    VP+I+ +C  E+E+RG  VV +YRL G+  +K  +RE  E+D  A +LS    PDI+ IT VL+D+LRELP PL +  LY  ++D+     L +   G  ++ A ++  +++L+ LP V + T+  LLDHLKRV+S  EVNKMT + LA   GPVL              F   EE      S L  KK  + L Y+L +WP
Sbjct: 1027 CTAYISGLMSLHFYGAEGLKPPRADSRHVYCAIQVDSVNKARTALLTCRTAFLDMDHTFNIELENAQHLKLALFSWEAVPR-RNRVCCHGTVVLPPL---FR-TATRTHQLAVRLEPRGIIYVKLGLMEQWKNSLRGPDSEREGEANVFGVEAARVVERE--------GAGLMVPLIIEKCITEIERRGCQVVGLYRLCGSAAVKKELREAFERDSHAIELSESNYPDINVITGVLKDYLRELPFPLISKPLYEAVIDSMAKRPLLIGSGGCENDPAESEHTVSLLETLPEVEKMTLRKLLDHLKRVASHHEVNKMTCQNLAVCFGPVLLSQRQDASCHSNRVFVDSEE----LASALHFKKHIEVLHYLLQLWP 1384          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:HGNC Symbol;Acc:HGNC:25824])

HSP 1 Score: 144.436 bits (363), Expect = 2.738e-36
Identity = 88/257 (34.24%), Postives = 137/257 (53.31%), Query Frame = 1
Query: 2977 EKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDN---YAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQA---------QTLLYILNIWP 3711
            ++L + LEP+G+L+++L  L+  E        +   A+FGV L  LV        E +  + +VP+I+++C  E+E RGL VV +YRL G+  +K  +R+  E+D     L+ +  PDI+ IT +L+D+LRELP  L T  LY ++L+A+ V   G N      ++  + +L CLP   + T+  LLDHL  V+S S+ N MT + LA   GPVL  P+ E  +            A         + L Y+L +WP
Sbjct:   47 QQLCVKLEPRGLLYVKLTLLEQWEAPSPRLSELPPPAVFGVELRRLV--------EKEQHQLKVPLIIQKCVAEIETRGLKVVGLYRLCGSAAVKKELRDAFEKDSAVVTLNEELYPDINVITGILKDYLRELPSALITRTLYEVVLEAMCVRPAGRNDNDTQRSQSTVALLHCLPEPERATLSFLLDHLSLVASFSDCNLMTCQNLAVCFGPVLLTPTQESWRAGLPGSSSEGFGASAVDFKRHIEALHYLLQLWP 295          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: bcr (BCR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103040765])

HSP 1 Score: 134.42 bits (337), Expect = 3.993e-31
Identity = 107/366 (29.23%), Postives = 174/366 (47.54%), Query Frame = 1
Query: 2686 LVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQW----------DPRNRHRLCFYGNVALR-QLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDA-LFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEA----------XXXXXXXXXXXXQAQTLLYILNI 3705
            ++IH  +G+     Q++  +LYC LE+DS    V +A++ +   T   +W+E FE+++E +  L  L Y+           D  +  R+   G + L  Q+++         +     + P   + ++L     +  F   +MP    A +FGV +  +  R          +  +VP IVR+C EE+E+RG++ V IYR+SG       ++   + +     +    + D++AI   L+ + RELPEPLFT+ LY      + +S   D+ A    MLN+L  LP  N  T L LLDHLKRV+ +  VNKM+   LA   GP L  P+ +++             D   L+   Q Q LLY L +
Sbjct: 1000 VIIHSASGL----KQSL--NLYCTLEVDSFGFFVNKAKTRVYRYTTEPKWNEEFEIELEGSQMLRLLCYEKSYNKSKTNKEDADSTDRIIGKGQIPLDPQMLQ--------GKDWQRTVIPMNGIEVKLSMKFTSREFSLKRMPSCKQAGVFGVKISTVTKR----------ERSKVPYIVRQCLEEIERRGMEEVGIYRVSGVATDIQALKTAFDTNNKDVSVMMSEM-DVNAIAGTLKLYFRELPEPLFTDELYPNFAGGIALS---DSVAKESCMLNLLLSLPEPNLVTFLFLLDHLKRVAEKECVNKMSLHNLATVFGPTLLRPAEKDSKIPTNPTQPITMGDSWSLEVMSQVQVLLYFLQL 1337          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: bcr (BCR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103040765])

HSP 1 Score: 134.035 bits (336), Expect = 5.696e-31
Identity = 107/366 (29.23%), Postives = 174/366 (47.54%), Query Frame = 1
Query: 2686 LVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQW----------DPRNRHRLCFYGNVALR-QLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDA-LFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEA----------XXXXXXXXXXXXQAQTLLYILNI 3705
            ++IH  +G+     Q++  +LYC LE+DS    V +A++ +   T   +W+E FE+++E +  L  L Y+           D  +  R+   G + L  Q+++         +     + P   + ++L     +  F   +MP    A +FGV +  +  R          +  +VP IVR+C EE+E+RG++ V IYR+SG       ++   + +     +    + D++AI   L+ + RELPEPLFT+ LY      + +S   D+ A    MLN+L  LP  N  T L LLDHLKRV+ +  VNKM+   LA   GP L  P+ +++             D   L+   Q Q LLY L +
Sbjct:  905 VIIHSASGL----KQSL--NLYCTLEVDSFGFFVNKAKTRVYRYTTEPKWNEEFEIELEGSQMLRLLCYEKSYNKSKTNKEDADSTDRIIGKGQIPLDPQMLQ--------GKDWQRTVIPMNGIEVKLSMKFTSREFSLKRMPSCKQAGVFGVKISTVTKR----------ERSKVPYIVRQCLEEIERRGMEEVGIYRVSGVATDIQALKTAFDTNNKDVSVMMSEM-DVNAIAGTLKLYFRELPEPLFTDELYPNFAGGIALS---DSVAKESCMLNLLLSLPEPNLVTFLFLLDHLKRVAEKECVNKMSLHNLATVFGPTLLRPAEKDSKIPTNPTQPITMGDSWSLEVMSQVQVLLYFLQL 1242          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:103046632])

HSP 1 Score: 132.88 bits (333), Expect = 1.191e-30
Identity = 108/370 (29.19%), Postives = 174/370 (47.03%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLF--IELLYLKINEVFQRFKMPVNT-------------DALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQD-----VIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXX------XXXQAQTLLYIL 3699
            G L + V +  G   S     +LYC LE+DS    V +A++ +   T   +W+E FE+++E +  L  L Y+    ++ +L    N  + +++ + +          + L+P+ V      +  +++N +   F M   +               +FGV + V+  R          +  +VP IVR+C EEVEKRG+D V IYR+SG       ++   + +     V+ +D+      DI+AI   L+ + RELPEPL T+ LY   ++ + +S P    A    M+++L  LP  N  T L LL+HLKRV+ +  +NKM+   LA   GP L  PS  E  K   ++           Q Q LLY L
Sbjct:  815 GFLHVIVHSATGFKESA----NLYCTLEVDSFGYFVSKAKTRVFRDTAEPQWNEEFEIELEGSQCLRILCYE-KCYDKSKLNKDDNEIVDKIMGKGQ----------VQLDPQTVQSKNWHVDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKR----------ERSKVPYIVRQCIEEVEKRGIDEVGIYRISGVATDIQALKAAFDTNTKDILVMLSDM------DINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPA---AKENCMMHLLRSLPDPNLITFLTLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSESETSKPHITMASDIWSHDVMAQVQVLLYYL 1150          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 91.6633 bits (226), Expect = 3.861e-20
Identity = 60/190 (31.58%), Postives = 92/190 (48.42%), Query Frame = 1
Query: 3070 PVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHL--KRVSSRSEVNKMTNEALAASLGPVLFFPSPEE 3633
            P     +FG  L  LV               R+P++V  C  E+E RGL    +YR+SG   L   +R   +++   AD+SA    D++ IT  L+ + RELP PL T   Y   ++A +VS P +     +     L  LP  + DT+  L+ HL  +RVS + + N M++E L+   GP L  P  ++
Sbjct:  103 PRRLPKVFGCDLTALVK----------AHRGRLPMVVEMCIGEIEARGLKSEGLYRVSGVSDLVEEVRTAFDKEGEKADISAKAYEDVNVITGALKLYFRELPTPLVTYQAYPHFVEAAKVSDPAERLEQLR---RALQTLPPAHYDTLHCLMAHLHRRRVSQQEKHNLMSSENLSIVFGPTLMRPHEQD 279          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004676.1 (pep scaffold:Pmarinus_7.0:GL476377:189826:224778:-1 gene:ENSPMAG00000004196.1 transcript:ENSPMAT00000004676.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 3.411e-19
Identity = 58/185 (31.35%), Postives = 93/185 (50.27%), Query Frame = 1
Query: 3082 DALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEA 3636
            + +FG PL +L  R          +   VP  V+   E V+KRGL +  IYR+SG +    ++R +++ +     L      DIH IT  L+ F RELPEPLF    +   + A+++    D+      +   +  LP  N+DT+  L +HLK+V +  + N+MT +++A   GP L  P  E +
Sbjct:  417 EQVFGCPLAMLCER----------ENTTVPKFVQLSIETVDKRGLCIDGIYRVSGNLATIQKLRFLVDHEE-KVSLDESHWEDIHVITGALKMFFRELPEPLFPFNQFDPFISAIKLQ---DSREKLTKIKEQVQKLPKPNKDTMRALFEHLKKVIACGDANRMTTQSVAIVFGPTLLRPENESS 587          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004494.1 (pep scaffold:Pmarinus_7.0:GL476606:246273:272967:-1 gene:ENSPMAG00000004080.1 transcript:ENSPMAT00000004494.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 1.143e-18
Identity = 57/184 (30.98%), Postives = 92/184 (50.00%), Query Frame = 1
Query: 3082 DALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLK-RVSSRSEVNKMTNEALAASLGPVLFFPSPE 3630
            + +FG PL+ L  R+ +           VP   R   + VE+ GL V  IYR+SG +    ++R +++ +    DL      D+H IT  L+ F RELPEPLF    +   ++A+++    D     + M  ++  LP  N++T+  L +HL  RV +  + N+M+ + LA   GP L  P  E
Sbjct:  409 EQVFGCPLQTLCEREGSA----------VPNFARLSVQCVERTGLQVDGIYRVSGNLATIQKLRFIVDHEE-KLDLEEPQWDDVHVITGALKMFFRELPEPLFPFKFFPHFINAIKIK---DYAEKIRCMGKLIAILPPTNRETMKLLFNHLATRVVAHGKTNRMSVQNLAIVFGPTLLRPEQE 578          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: ARHGAP15 (Rho GTPase activating protein 15 [Source:HGNC Symbol;Acc:HGNC:21030])

HSP 1 Score: 90.8929 bits (224), Expect = 1.277e-18
Identity = 54/180 (30.00%), Postives = 90/180 (50.00%), Query Frame = 1
Query: 3082 DALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFP 3621
            + +FG PL  L  R          +   VP+ VR C   +E + L++  +YR+SG      ++R M++ D    DL      DI+ IT  L+ F RELPEPL     +   + A+++    + +   K M ++++ LP+ N +T+  L+ HLK V +  E N+M+ + +A    P L  P
Sbjct:  603 EQVFGCPLACLCER----------ENSMVPLFVRMCMIALEWQRLEIDGVYRVSGNQATIQKLRIMVDHDE-HVDLDDSQWEDINVITGALKLFFRELPEPLVPYIFFEQFIAAIKIF---EYHNRVKCMKDLINILPLPNHNTMKFLIRHLKTVVAHGEKNRMSMQNMAIVFAPTLLRP 768          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 82.4185 bits (202), Expect = 1.305e-17
Identity = 52/155 (33.55%), Postives = 86/155 (55.48%), Query Frame = 1
Query: 3169 PIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEE 3633
            P++V  C +E+E RGL    +YR+SG  +    ++   ++D   AD+SA++  DI+ IT  L+ + R+LP PL T   Y   ++A ++    +   G    L +   LP  + +++ +L+ HLKRV+  S+ N M+ E LA   GP L  P PE+
Sbjct:   46 PMVVDMCIKEIEMRGLRSEGLYRVSGFSEHIEDVKMAFDRDGEKADISANSYDDINIITGALKLYFRDLPIPLITYDAYPKFIEASKLMDADERLEGIHEALRL---LPPAHYESLRYLMAHLKRVTLYSKENLMSAENLAIVFGPTLMRP-PEQ 196          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: RGD1 (GTPase-activating protein (RhoGAP) for Rho3p and Rho4p; possibly involved in control of actin cytoskeleton organization [Source:SGD;Acc:S000000464])

HSP 1 Score: 72.4034 bits (176), Expect = 3.569e-13
Identity = 55/186 (29.57%), Postives = 88/186 (47.31%), Query Frame = 1
Query: 3091 FGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVP----DIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEA 3636
            FGVPLE L+          + ++  VP IVR+C   ++K GLD   IYR S  V    +++E +++D     +   + P    DI+ + ++L+ F   LP+ +   AL   I   LQ+  P         M  ++  LP     T+  L+ HLKRV +    N+M   AL    GP +   +P++A
Sbjct:  470 FGVPLESLI----------EFEQDMVPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPANISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQIEDPT---TRKNFMHGLIYNLPDAQYWTLRALVFHLKRVLAHEAQNRMNLRALCIIWGPTIAPANPDDA 642          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: BEM2 (Rho GTPase activating protein (RhoGAP); involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence; potential GAP for Rho4p [Source:SGD;Acc:S000000957])

HSP 1 Score: 68.5514 bits (166), Expect = 7.089e-12
Identity = 49/178 (27.53%), Postives = 86/178 (48.31%), Query Frame = 1
Query: 3082 DALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAAD---LSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGA-----KLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALA 3591
            + +FGVPLE +  R          +   +P IV +  EE+E RGLD V +YR+ G++     ++   +++    +   L  D   +++AI    + +LRELP+ LF++A   M+ D   +++    +A       ++M  +L  LP     T+  ++ HL +V      NKM    LA
Sbjct: 1962 NKIFGVPLEDVCER----------ENTLIPTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDEEGATDNSFTLEDDRWFEVNAIAGCFKMYLRELPDSLFSHA---MVNDFTDLAIKYKAHAMVNEEYKRMMNELLQKLPTCYYQTLKRIVFHLNKVHQHVVNNKMDASNLA 2126          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: LRG1 (GTPase-activating protein (GAP); contains Rho1p-specific GAP activity, interacting with activated forms of Rho1p; functions along with Sac7p as a negative regulator of the Pkc1p-mediated cell wall integrity signaling pathway; negative regulator of cell wall 1,3-beta-glucan biosynthesis; required for efficient cell fusion; contains a RhoGAP domain and three Lin-11-Isl1-Mec-3 (LIM) domains [Source:SGD;Acc:S000002399])

HSP 1 Score: 61.6178 bits (148), Expect = 8.559e-10
Identity = 50/196 (25.51%), Postives = 94/196 (47.96%), Query Frame = 1
Query: 3064 KMPVNTDALFGVPLEVLVSR-DLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHA-----ITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEV-----NKMTNEALAASLGPVLFF 3618
            K P+ T  +FG PL+VL  +  ++        + R+PII+      + +  + V  I+R +G ++   R+RE+        D +    PD        ++A+L+ F+RELP+P+ +  LY + + A ++ L  +     +++L I   LP  N++ +  LL  L   SS S +     +KM    L+  + P + +
Sbjct:  720 KKPI-TKTVFGAPLDVLCEKWGVDSDLGVGPVKIRIPIIIDELISSLRQMDMSVEGIFRKNGNIR---RLRELTAN----IDSNPTEAPDFSKENAIQLSALLKKFIRELPQPILSTDLYELWIKAAKIDLEDEK---QRVILLIYSLLPTYNRNLLEALLSFLHWTSSFSYIENEMGSKMDIHNLSTVITPNILY 904          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 58.5362 bits (140), Expect = 8.328e-9
Identity = 43/159 (27.04%), Postives = 75/159 (47.17%), Query Frame = 1
Query: 3211 GLDVVSIYRLSGAVKLKIRIREMLEQ------DVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDAL-------QVSLPGDNYAGA-----------KLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLF 3615
            GL++  +YR SG+  L   I     Q      D ++  L+A    DIHA+ +VL+ +LR+LP+P+ + ++Y  ++D +       ++ L  D +  +           K +L I   LP+ +Q+ +  L  H+ +V   SE N M    L+    P L 
Sbjct:  818 GLNMEGLYRKSGSQTLVEEIENEFAQNNSLHSDTLSPKLNALLNQDIHAVASVLKRYLRKLPDPVLSFSIYDALIDLVRNNQLIERLPLNNDKFLDSPQKVTIYEMVLKSLLEIFKILPVEHQEVLKVLAAHIGKVRRCSERNLMNLHNLSLVFAPSLI 976          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: RGA1 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; RGA1 has a paralog, RGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000005653])

HSP 1 Score: 51.9878 bits (123), Expect = 7.909e-7
Identity = 49/177 (27.68%), Postives = 85/177 (48.02%), Query Frame = 1
Query: 3166 VPIIVRRCTE--EVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADT-VP------DIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDN--YAGAKLML----------------NILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLF 3615
            +P+I+  C +  E ++  +    IYR SG+ +L I   E +E+   A  +  +T  P      D++ +T VL+ +LR+LP P+FT  +Y  ++  ++     +N  + G KL L                NIL+ LP  +   +  L +H+++V+  S  N+MT   LA    P L 
Sbjct:  804 IPMILSVCIDFIESDEENMRSEGIYRKSGS-QLVI---EEIEKQFSAWKVQQNTETPNILTEQDLNVVTGVLKRYLRKLPNPIFTFQIYEPLMRLVKSKKMMENLPFVGGKLSLEAKNSDTYMSSKSALKNILEDLPREHYRVLRVLSEHIEKVTRYSHWNRMTLYNLALVFAPGLI 976          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO47441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM51])

HSP 1 Score: 154.066 bits (388), Expect = 6.611e-38
Identity = 112/346 (32.37%), Postives = 175/346 (50.58%), Query Frame = 1
Query: 2677 SGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEI-----------------FELDVEDNDWLAFLFYQWDPRNRHRL-----CFYGNVALRQLIERFRHSYTNSEK--LALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPE 3630
            +G+L +HV  G G + S     DLYC LE+D     V++AR+ I  +T    WD+                  F+L+VE    L    Y    ++R+ L     C  G + LR      R S  + +K  + + L+ +G + + L Y K  +  +R K  VN+  +FGV +E + SR          + C +P+IV  C  E+EKRGL+ V IYRLSGA     R++E  +++  +A L   +  DIHA+  + + +LR+LPEPLFT+ LY   + A  ++   D     + ML +   LP  N+ T  +L  HL++V+ +SEV+KM    L+   GP +  PSP+
Sbjct:  459 NGVLYVHVQNGKGFHRS-----DLYCTLEVDHFGQFVKKARTKIAKTTGDPVWDQGTGGETLDTCPFINMSQDFDLEVEGTKELRIHVYS---KSRYTLQRDEECGLGRIQLR------RESLADLKKRTITIALDKQGAITLSLQYSKTRQGIER-KKSVNSVGVFGVDIETVTSR----------ESCDIPLIVIGCVREIEKRGLEEVGIYRLSGASSDVKRLKEGFDENSQSA-LVLVSEADIHAVAGLFKMYLRDLPEPLFTDELYDKFVKAYAMA---DAEEKRETMLELFQSLPTPNRLTACYLFQHLRKVAEKSEVHKMGLNNLSTVFGPNVLRPSPK 775          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO38242 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDK1])

HSP 1 Score: 112.464 bits (280), Expect = 3.316e-28
Identity = 57/154 (37.01%), Postives = 92/154 (59.74%), Query Frame = 1
Query: 3154 QECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAK-LMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVL 3612
            ++  VP++VR+C  E+EKRGL+ V +YR+SG  + K  +R   +++  A D+S +  PDI+ IT +L+D+LRELPEPL T  +   +  A +  +        K +M  +L  LP  N+ T++ +L+HL+ V  + E NKM    L+  L PV+
Sbjct:   37 EQSSVPLLVRKCVLEIEKRGLESVGLYRISGNARRKKELRGFFDENSEAVDISEENCPDINVITGILKDYLRELPEPLITEKMTEGLRKAAKNEIQDKKVDEQKQVMSELLSGLPDPNRHTLVFILNHLRHVMEKKEFNKMDARNLSVCLAPVM 190          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO49474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG60])

HSP 1 Score: 85.8853 bits (211), Expect = 1.836e-17
Identity = 61/180 (33.89%), Postives = 92/180 (51.11%), Query Frame = 1
Query: 3082 DALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFP 3621
            + +FG P+  L  R+    G T      +PI V +C   +E RGL+   IYR+ G V L  RIR M++Q+   A L      D+HA+   L+ + RE+PEPL     +   ++A++ S         K   +++  LP +N DT+  LL HL +V   SEVN+M  + LA   GP +  P
Sbjct:  199 EQVFGCPITHLCERE----GTT------IPIFVSKCINAIESRGLEFDGIYRVCGNVALVQRIRIMVDQEEPIA-LGESPFDDVHALAGSLKLYFREMPEPLVPFDFFSGFVEAIKQSTRNSKLGALK---SLVGQLPRINFDTLKLLLGHLHKVMGFSEVNRMHAQNLAIVWGPNMMRP 364          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO49053 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHX5])

HSP 1 Score: 83.9593 bits (206), Expect = 2.465e-16
Identity = 53/149 (35.57%), Postives = 81/149 (54.36%), Query Frame = 1
Query: 3166 VPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVL 3612
            VP IV +C  E+EKRGL+ V +YR+ GA +    I+E+ ++ +     +     DIH +  VL+DFLR L EPL T  L+   ++A       D+++    M   +  LP  N+DT+  L+ HL++VS  ++  KM    LA   GP L
Sbjct:  382 VPAIVVQCISEIEKRGLNEVGLYRVPGAER---SIKELKDKFLHGKTQNLHETIDIHVVCGVLKDFLRNLAEPLVTYHLWGAFVNAANKDDDQDSFSA---MYQAVSELPQANRDTLACLVVHLQKVSQCTDC-KMPVSNLARVFGPTL 523          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO47995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ0])

HSP 1 Score: 79.337 bits (194), Expect = 3.585e-15
Identity = 56/196 (28.57%), Postives = 99/196 (50.51%), Query Frame = 1
Query: 3040 INEVFQRFKMPVNTDAL---FGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFF 3618
            + +V    K  V + +L   FG PLE      L  Q  +      +  ++  C   + +  L    ++R++G+     +++   +  ++  DL+ +   D+HAIT VL+ +LRELPEPL T ALY    D +Q +   D+ A  +    ++D LP  N+D + +L+  L +++  SEVNKMT   +A  + P + +
Sbjct:  233 LQDVLPLLKTQVESSSLRSVFGCPLE----EHLKVQRRS------IAFVLEECLTYLHEEALQEQGLFRMAGSSGKIRKLKAAFDAGMV--DLT-EFDCDVHAITGVLKQYLRELPEPLMTFALYD---DWIQAASIQDSGARLQAYWGLVDKLPKANKDNLRYLICFLGKLADYSEVNKMTASNIAIVIAPNIIY 412          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: SYDE2 (synapse defective Rho GTPase homolog 2 [Source:NCBI gene;Acc:101168857])

HSP 1 Score: 199.134 bits (505), Expect = 7.189e-51
Identity = 139/468 (29.70%), Postives = 227/468 (48.50%), Query Frame = 1
Query: 2371 FDNATRTDLSYFRAPNNVLEYSSPGYAFSSNAQNDFRSTASAPSFRSLRQPSRPKDQQMDHGEQSV--SRLDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTS-TEIFEWDEIFELDVEDNDWLAFLFYQWDPR-NRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIEL-LYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKL-------MLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQA---------QTLLYILNIWP 3711
             D++  T  SY +  NN    S+    + S+  +      S     +  +  R K+ +   G   +  + LD + FR     + P               T Y+SG++ +H      L   +   RD+YC +++DSV +AR+ + T  T   + D  F +++E+   L  + + W+P   R+R+C +G V L  +   FR   T   +LA+ LEP+G+++++L L         R         +FGV    +V R      E  G    VP+I+ +C  E+EKRG  VV +YRL G+  +K  +RE  E+D  A +L+    PDI+ IT VL+D+LRELP PL    LY  +L+++         AG ++        +++L+ LP V + T+  LL+HLKRV+S  +VNKMT + LA   GPVL     E +   ++  +D ++ A         + L Y+L +WP
Sbjct:  928 LDSSVSTQNSYSKKKNNGSSKSASKGGYLSDGDSPELVAKSGKHGTAEGKGGRTKETEGGLGSSRLNGTELDIDAFRHYSFTEQP-------------KCTQYISGLMSLHFYGAEDLKPPRIDSRDVYCAIQVDSVNKARTALLTCRTTFLDMDHTFNIELENAQHLKLVVFSWEPTPKRNRVCCHGTVVLPSI---FR--VTRFHQLAVKLEPRGLIYVKLSLIEHWQNSLDRGPDADREPQVFGVEAWRVVER------ENTG--LMVPLIISKCINEIEKRGCQVVGLYRLCGSAAVKKELREAFERDSHAVELNESVYPDINVITGVLKDYLRELPFPLINKPLYEAVLESMATKPLKMGAAGCEIEQADSEHTVSLLEHLPEVERMTLRTLLNHLKRVASHQDVNKMTCQNLAVCFGPVLLSQRQEASCHTNRVFIDSEELASALHFKKHIEVLHYLLQLWP 1369          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: SYDE1 (synapse defective Rho GTPase homolog 1 [Source:NCBI gene;Acc:101165963])

HSP 1 Score: 147.132 bits (370), Expect = 3.065e-35
Identity = 106/346 (30.64%), Postives = 180/346 (52.02%), Query Frame = 1
Query: 2674 VSGMLVIHVVAGIGLNSSQTV-VRDLYCVLEIDSVRRARSMIRT-STEIFEWDEIFELDVEDNDWLAFLFYQWDPRN---------------RHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKM-----PVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQV-SLPGDNYAG----AKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPE 3630
            V+G+L +H++    + +S++   +D++  ++ID   RAR+ + T        +  F L++E    L  +     P N               R+R+C  G V++  L +  R     S++L + LEP+G+L+   L L + E +    M     P N   +FG+ L  LV        E +     VP+++++   E+E+RGL VV +YRL G+  +K  +R+  E++  A  LS D  PDI+ +T +L+D+LRELP PL T  LY+++ +A+ + + P    +     ++  + +L CLP   + T+  LLDHL  V+S S  N+MT++ LA   GPVL  P+ E
Sbjct:  430 VTGLLTVHLLGLEDMKTSRSENSKDIFVAIQIDGATRARTALLTLKGSSLTLNHTFHLELERARQLRIVVLT--PANPAAGGHQPATSGGPTRNRVCCLGGVSIPPLFKGSR-----SQQLCVKLEPRGLLY---LKLSLQEKWDTQPMGDTSTPAN---VFGIELHQLV--------EKEESAVPVPLLIQKTVAEIERRGLKVVGLYRLCGSAAVKKELRDWFERNSSAVRLSEDLYPDINVVTGILKDYLRELPSPLITRTLYQVVREAMAIRTAPSPPESPDPQLSRSTVGLLSCLPTPERATLSLLLDHLSLVASFSSFNRMTHQNLAVCFGPVLLTPTQE 754          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:101164832])

HSP 1 Score: 135.576 bits (340), Expect = 1.460e-31
Identity = 113/378 (29.89%), Postives = 170/378 (44.97%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNS--EKLALYLEPKGVLF--IELLYLKINEVFQRFKMPVNT-------------DALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVP----------DIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXX-------XXQAQTLLYIL 3699
            G L + V +  G   S     +LYC LE+DS    V +A++ +   T    W+E FE+++E + +L  L Y+             N   + ++ +  +   +    K  + L+P+ V     ++  +++N +   F M   +               +FGV + V+  R          +  +VP IVR+C EEVEKRG+D V IYR+SG              D+ A  L+ DT            DI+AI   L+ + RELPEPL T+ LY   ++ + +S P    A    M+++L  LP  N  T L LLDHLKRV+ +  VNKM+   LA   GP L  PS  E+ K    +            Q Q LLY L
Sbjct:  739 GFLHVIVHSAKGFKESA----NLYCTLEVDSFGYFVSKAKTRVFRDTAEPSWNEEFEIELEGSQYLRILCYE-------------NCYDKSMLNKDDNEIVDKIMGKGQVQLDPQTVQSKNWQMDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKR----------ERSKVPYIVRQCIEEVEKRGIDEVGIYRISGVA-----------TDIQALKLAFDTNTKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPA---AKENCMMHLLRSLPEPNIMTFLTLLDHLKRVAEKEPVNKMSLHNLATVFGPTLLRPSESESLKGQHIMSATDIWSHDVMGQVQVLLYYL 1075          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:101164832])

HSP 1 Score: 132.88 bits (333), Expect = 5.872e-31
Identity = 113/377 (29.97%), Postives = 173/377 (45.89%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLF--IELLYLKINEVFQRFKMPVNT-------------DALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVP----------DIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXX-------XXQAQTLLYILN 3702
            G L + V +  G   S     +LYC LE+DS    V +A++ +   T    W+E FE+++E + +L  L Y+ +  ++  L    N  + +++ + +          + L+P+ V     ++  +++N +   F M   +               +FGV + V+  R          +  +VP IVR+C EEVEKRG+D V IYR+SG              D+ A  L+ DT            DI+AI   L+ + RELPEPL T+ LY   ++ + +S P    A    M+++L  LP  N  T L LLDHLKRV+ +  VNKM+   LA   GP L  PS  E+ K    +            Q Q LLY L 
Sbjct:  495 GFLHVIVHSAKGFKESA----NLYCTLEVDSFGYFVSKAKTRVFRDTAEPSWNEEFEIELEGSQYLRILCYE-NCYDKSMLNKDDNEIVDKIMGKGQ----------VQLDPQTVQSKNWQMDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKR----------ERSKVPYIVRQCIEEVEKRGIDEVGIYRISGVAT-----------DIQALKLAFDTNTKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPA---AKENCMMHLLRSLPEPNIMTFLTLLDHLKRVAEKEPVNKMSLHNLATVFGPTLLRPSESESLKGQHIMSATDIWSHDVMGQVQVLLYYLQ 832          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: ABR (ABR activator of RhoGEF and GTPase [Source:NCBI gene;Acc:101164832])

HSP 1 Score: 132.88 bits (333), Expect = 7.209e-31
Identity = 113/377 (29.97%), Postives = 173/377 (45.89%), Query Frame = 1
Query: 2680 GMLVIHVVAGIGLNSSQTVVRDLYCVLEIDS----VRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLF--IELLYLKINEVFQRFKMPVNT-------------DALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVP----------DIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXX-------XXQAQTLLYILN 3702
            G L + V +  G   S     +LYC LE+DS    V +A++ +   T    W+E FE+++E + +L  L Y+ +  ++  L    N  + +++ + +          + L+P+ V     ++  +++N +   F M   +               +FGV + V+  R          +  +VP IVR+C EEVEKRG+D V IYR+SG              D+ A  L+ DT            DI+AI   L+ + RELPEPL T+ LY   ++ + +S P    A    M+++L  LP  N  T L LLDHLKRV+ +  VNKM+   LA   GP L  PS  E+ K    +            Q Q LLY L 
Sbjct:  501 GFLHVIVHSAKGFKESA----NLYCTLEVDSFGYFVSKAKTRVFRDTAEPSWNEEFEIELEGSQYLRILCYE-NCYDKSMLNKDDNEIVDKIMGKGQ----------VQLDPQTVQSKNWQMDVIEMNGIKVEFSMKFTSRDLSLKRTPSKKQSGVFGVKISVVTKR----------ERSKVPYIVRQCIEEVEKRGIDEVGIYRISGVAT-----------DIQALKLAFDTNTKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPA---AKENCMMHLLRSLPEPNIMTFLTLLDHLKRVAEKEPVNKMSLHNLATVFGPTLLRPSESESLKGQHIMSATDIWSHDVMGQVQVLLYYLQ 838          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000017186.1 (SMESG000017186.1)

HSP 1 Score: 2588.91 bits (6709), Expect = 0.000e+0
Identity = 1301/1305 (99.69%), Postives = 1302/1305 (99.77%), Query Frame = 1
Query:  235 MDYNSSSIEQKEIIPMTPVVNIKPPSYKIIRIEFPNSEKNLLTILNENDSMNSMVTIYTSQTTVLSDILFENCLFFVTQVSKMPGQSLGIFLRDGDPFTDEPGLFVSRLSDNLSISLQSVNQERELMKVEIKSPDIIPDNNAFVVESQLAHQQNPSENDSSNNTSHSAYDCNIHNNSTSNPCYRSNFSLKKNCSASFSNENSPSDLIGGFCDEISKLQTNIFPFQIGDRICRVRISDSTHSHQDNNDCSIIEKIDNYSRSDGTNNNKRNDAEKKYNLDDVVLFMSISSFLELSILREGRNNQKPSLEQVDEKSSTYDEESN-KFFVDEQIRRVSFQLSDQESQSLSPGPSIDCEQEEIVSKTLSLNSEKTKDQRVRFDEFESSPIWDHLHPSMANSVPTMLNSTISLDRTNFSEKHKSTSKNILLREVPTEDSNDSGLSSENSWLPSIISTTNHSLPLDTTNTVTICNMSAPDSFGTGNPMRTVHFAGSKIHSQTVPTEVYNPSHQVPWPYQRASLTNPRTVTFRTNQKASIXXXXXXXXXXXLKNVYWPQNFYIPRHTGPLYPSQSLSDPRMLNYRWISPPVAQSYPVEVADKGIQCGPDRHGYNSDTELKMKSHQPFPVDMHSLNKSQVKFSVSRTAPHLHRSTVNYSSGEEEGFYQATSPSRYIDPKQSMMCSNQNMMYKQVSSQPSIEDEMRNLNIRPYMPVPMMETDFFDNATRTDLSYFRAPNNVLEYSSPGYAFSSNAQNDFRSTASAPSFRSLRQPSRPKDQQMDHGEQSVSRLDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIWPDESDHQYHSRDSKSKEPQKIHSNSISNAQKITHITPSTRYSKPSPSTVRTSPNQTDTAATPRKSDAPINSGMNSAENVRSQNNVKNRRPILSNSRRSNSLEMTERDQSRGRSATMXXXXXXXXXXXXXXXXXKVVLVDESSMPYL 4146
            MDYNSSSIEQKEIIPMTPVVNIKPPSYKIIRIEFPNSEKNLLTILNENDSMNSMVTIYTSQTTVLSDILFENCLFFVTQVSKMPGQSLGIFLRDGDPFTDEPGLFVSRLSDNLSISLQSVNQERELMKVEIKSPDIIPDNNAFVVESQLAHQQNPSENDSSNNTSHSAYDCNIHNNSTSNPCYRSNFSLKKNCSASFSNENSPSDLIGGFCDEISKLQTNIFPFQIGDRICRVRISDSTHSHQDNNDCSIIEKIDNYSRSDGTNNNKRNDAEKKYNLDDVVLFMSISSFLELSILREGRNNQKPSLEQVDEKSSTYDEESN KFFVDEQIRRVSFQLSDQESQSLSPGPSIDCEQEEIVSKTLSLNSEKTKDQRVRFDEFESSPIWDHLHPSMANSVPTMLNSTISLDRTNFSEKHKSTSKNILLREVPTEDSNDSGLSSENSWLPSIISTTNHSLPLDTTNTVTICNMSAPDSFGTGNPMRTVHFAGSKIHSQTVPTEVYNPSHQVPWPYQRASLTNPRTVTFRTNQKASISSPPSPQSQGPLKNVYWPQNFYIPRHTGPLYPSQSLSDPRMLNYRWISPPVAQSYPVEVADKGIQCGPDRHGYNSDTELKMKSHQPFPVDMHSLNKSQVKFSVSRTAPHLHRSTVNYSSGEEEGFYQATSPSRYIDPKQSMMCSNQNMMYKQVSSQPSIEDEMRNLNIRPYMPVPMMETDFFDNATRTDLSYFRAPNNVLEYSSPGYAF SNAQNDFRSTASAPSFRSLRQPSRPKDQQMDHG+QSVSRLDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAKKLDKSLLDPKKQAQTLLYILNIWPDESDHQYHSRDSKSKEPQKIHSNSISNAQKITHITPSTRYSKPSPSTVRTSPNQTDTAATPRKSDAPINSGMNS ENVRSQNNVKNRRPILSNSRRSNSLEMTERDQSRGRSATMSSGNHSRLTSRSSSRDRKVVLVDESSMPYL
Sbjct:    1 MDYNSSSIEQKEIIPMTPVVNIKPPSYKIIRIEFPNSEKNLLTILNENDSMNSMVTIYTSQTTVLSDILFENCLFFVTQVSKMPGQSLGIFLRDGDPFTDEPGLFVSRLSDNLSISLQSVNQERELMKVEIKSPDIIPDNNAFVVESQLAHQQNPSENDSSNNTSHSAYDCNIHNNSTSNPCYRSNFSLKKNCSASFSNENSPSDLIGGFCDEISKLQTNIFPFQIGDRICRVRISDSTHSHQDNNDCSIIEKIDNYSRSDGTNNNKRNDAEKKYNLDDVVLFMSISSFLELSILREGRNNQKPSLEQVDEKSSTYDEESNNKFFVDEQIRRVSFQLSDQESQSLSPGPSIDCEQEEIVSKTLSLNSEKTKDQRVRFDEFESSPIWDHLHPSMANSVPTMLNSTISLDRTNFSEKHKSTSKNILLREVPTEDSNDSGLSSENSWLPSIISTTNHSLPLDTTNTVTICNMSAPDSFGTGNPMRTVHFAGSKIHSQTVPTEVYNPSHQVPWPYQRASLTNPRTVTFRTNQKASISSPPSPQSQGPLKNVYWPQNFYIPRHTGPLYPSQSLSDPRMLNYRWISPPVAQSYPVEVADKGIQCGPDRHGYNSDTELKMKSHQPFPVDMHSLNKSQVKFSVSRTAPHLHRSTVNYSSGEEEGFYQATSPSRYIDPKQSMMCSNQNMMYKQVSSQPSIEDEMRNLNIRPYMPVPMMETDFFDNATRTDLSYFRAPNNVLEYSSPGYAFPSNAQNDFRSTASAPSFRSLRQPSRPKDQQMDHGQQSVSRLDPNEFRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAKKLDKSLLDPKKQAQTLLYILNIWPDESDHQYHSRDSKSKEPQKIHSNSISNAQKITHITPSTRYSKPSPSTVRTSPNQTDTAATPRKSDAPINSGMNSVENVRSQNNVKNRRPILSNSRRSNSLEMTERDQSRGRSATMSSGNHSRLTSRSSSRDRKVVLVDESSMPYL 1305          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000037897.1 (SMESG000037897.1)

HSP 1 Score: 383.645 bits (984), Expect = 8.815e-116
Identity = 257/702 (36.61%), Postives = 379/702 (53.99%), Query Frame = 1
Query: 1894 IPRHTGPLYPSQSLSDPRMLNYRWISPPVAQSYPVEVADKGIQCGPDRHGYNSDTELKMKSHQPFPVDMHSLNKSQVKFSVSRTAPHLHRSTVNYSSGEEEGFYQATSPSRYIDPKQSMMCSNQNMMYKQVSSQPSIEDEMRNLNIRPYMPVPMMETDFFD--------------NATRTDLSYFRAPNNVLEYSSPGYAFSSNAQNDFRSTASAPSFRSLRQPSRPKDQQMDHGEQSVSRLDPNEFRKIQTEQWPPVLASGGHPQRNK-----SATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQR-FKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIWPDESDHQYHSRDSKSKEPQKIHSNSISNAQKITHITPSTRYSKPSPSTVRTSPNQTDTAATPRKSDAPINSGMNSAE 3939
            I R     YPS  ++D    N R    P++ S   +             G NSDTEL   +     +     + S  K SV+R      RS  +YSSGEE+ F  +  P  Y D  + +     N  + Q  S+ +I + +       Y P  + +  +F               + TR +    R  N+ L  SS    F+   + +F+      S  S+      KD ++    Q  S++D NEFR I TE    +L        N        +G+ SGMLVIH++AG+GLNSS +V++DLYCV+E D++R+ARSMIRTSTE FEWDE+FE+++ +N  L+ L YQWDPR RHRLC++GN+ L  LI  +R   TN+EKLAL LEPKG+L++E+ +L   E F R     +N  ++FG  L+ L+          +     +P IV+ C +E+  RG +VV IYRLSG++KLKI++++M +++    ++S+D VPDIHAIT+VL+DFLRELPEPLFT A Y+MI++A ++     N +G KLMLNILDCLPI NQ+ +L L+DHL ++ ++SE NKM   +L+   GP+LF+PS E + KL KS+LDP  Q++   +I+ IWP                        +S + K TH + S +  K   ++     N+ + A +P  S   +   M + E
Sbjct:   44 IERSYSNRYPSSGMTDH---NSRLNLAPISHSMRDQSQKIVNYKSRSMSGCNSDTELANGATNNATILD---SDSSSKLSVNRWRVGCRRSLSSYSSGEEDNFSSSNFPVHY-DNTKDVFFEYANS-HNQKGSRQNISETVY------YEPSQLSDHSYFSAIKASYNNVNAQIPSKTRPEKKSHRLDNSNLNSSS---VFT---RENFKKLGVKASTFSI------KDWEI---AQFTSKIDVNEFRHITTEHTDGLLGLLSRRSNNSYIPITRGSGF-SGMLVIHLIAGVGLNSSHSVIKDLYCVIETDALRKARSMIRTSTECFEWDEVFEIEILNNTCLSILLYQWDPRFRHRLCYFGNLTLDSLINHWRMYNTNNEKLALQLEPKGMLYLEIQFLNCEETFHRSGNKTINPRSIFGRSLKDLII--------LEKSPILIPNIVKICVDEINFRGREVVGIYRLSGSIKLKIQLKDMFDREGYHINISSDAVPDIHAITSVLKDFLRELPEPLFTEAFYQMIVNAHELH-KTSNTSGEKLMLNILDCLPIGNQNVLLFLIDHLLKIIAKSESNKMDLVSLSNIFGPLLFYPSLEGSSKLSKSILDPSLQSEIFQFIMTIWPSNI--------------------GLSRSSKYTHESLSRKSQKEMAASTYKHRNRENIANSPENSRNAVPGEMTAGE 686          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000039887.1 (SMESG000039887.1)

HSP 1 Score: 321.242 bits (822), Expect = 3.102e-92
Identity = 162/403 (40.20%), Postives = 251/403 (62.28%), Query Frame = 1
Query: 2512 LRQPSRPKDQQMDHGEQSVSRLDPNE---FRKIQTEQWPPVLASGGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVALRQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAXXXXXXXXXXXXQAQTLLYILNIWP 3711
            + +P  P     + G   + R  PNE   FR +Q+E+W   + S   P         ++G+LV++V+AG  L SS ++ RDLYCVLEIDS+R+ARSMIRTSTE+FEWDEIFE+D+ ++ +L+ L YQWDP+  HRLCFYG + L   I+ F+ +   ++K+ L LEPKG+L++E+ +L     F R +     +++FG P+  + S         +  +C+ P ++  C EE+E+RGLD V +YRL GA KLK  +R++LE      D+S+  +PDIH IT+VL+DFLRELPEPL T ALYR ++ +   S   DN  G  +M+ I + LP VN++++++ +DHL R++ ++++NKMT   L+ +   +L  PS E+       +   +++ + L Y+L  WP
Sbjct:  534 ISEPKFPAPPIQNTGSLLMERYIPNESKDFRLLQSERWMKPIRSSDQPPG-------IAGILVVNVIAGCSLQSSHSLFRDLYCVLEIDSIRKARSMIRTSTEVFEWDEIFEIDLWNSHFLSILLYQWDPKTHHRLCFYGGINLLTFIDYFQQNVAGADKVILQLEPKGLLYLEMAFLNWELSFIR-QTNNRDNSVFGRPISQIRS----VVSSNNAFDCK-PFVITLCVEEIERRGLDNVGLYRLCGAAKLKAHLRQLLETYHDFTDMSSSVIPDIHVITSVLKDFLRELPEPLLTTALYRNLVKSSFHSDIYDNPEGPMIMITIFNSLPQVNRESLIYFIDHLIRLAQKNDINKMTISELSTNFASLLLQPSCEQLNNYQNLIGLARQEIEFLQYLLTQWP 923          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000025211.1 (SMESG000025211.1)

HSP 1 Score: 100.523 bits (249), Expect = 5.668e-21
Identity = 91/327 (27.83%), Postives = 153/327 (46.79%), Query Frame = 1
Query: 2674 VSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVR----RARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWD--PRNRHRLCFYGNVALRQLIERFRH-----SYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFP 3621
            VSG+LV ++    GLN         Y  +E+DS      +AR+ + T +   +W+E F++D++ +  +  L Y+      N+  L  Y    L       +H     S  ++E   L LE        L Y   NE+ +R    + T  LFG  L+ +V+R+  ++G    +   VP+I+  C + +E  GLD   IYR+SG+      + + L ++   A +S     D+H IT +++ +LRELPEPL     Y  IL   ++    + ++       ++  LP  N  T++ +L H ++V + S  N+M    L   LGP L  P
Sbjct:  606 VSGVLVTNIFKVDGLNPDFRY----YLSIEVDSFNLNELKARTKVCTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEAS------LKYEAKNELLKRQPSIMKT-GLFGFSLKSVVTRE--KKGNVLVE--NVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYA-ISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYN---EVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 913          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000025211.1 (SMESG000025211.1)

HSP 1 Score: 100.523 bits (249), Expect = 5.938e-21
Identity = 91/327 (27.83%), Postives = 153/327 (46.79%), Query Frame = 1
Query: 2674 VSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVR----RARSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWD--PRNRHRLCFYGNVALRQLIERFRH-----SYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTDALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIYRLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEPLFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDHLKRVSSRSEVNKMTNEALAASLGPVLFFP 3621
            VSG+LV ++    GLN         Y  +E+DS      +AR+ + T +   +W+E F++D++ +  +  L Y+      N+  L  Y    L       +H     S  ++E   L LE        L Y   NE+ +R    + T  LFG  L+ +V+R+  ++G    +   VP+I+  C + +E  GLD   IYR+SG+      + + L ++   A +S     D+H IT +++ +LRELPEPL     Y  IL   ++    + ++       ++  LP  N  T++ +L H ++V + S  N+M    L   LGP L  P
Sbjct:  591 VSGVLVTNIFKVDGLNPDFRY----YLSIEVDSFNLNELKARTKVCTGSSSLQWNESFDIDLDCSQMMNILVYEIKNYGENKESLIGYFEFQLNPKDHLNQHITKTVSMLSNESAKLTLEAS------LKYEAKNELLKRQPSIMKT-GLFGFSLKSVVTRE--KKGNVLVE--NVPMIIVACFKRIEDSGLDEEGIYRISGSKNEINELYKKLNKNPSYA-ISNLYTYDLHTITGIVKMYLRELPEPLLMTNNYERILQIAKLEEEVERFSRYN---EVILSLPEPNHSTVIFVLKHFQKVMAHSTKNQMIAGNLGLILGPTLIMP 898          
The following BLAST results are available for this feature:
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYDE21.072e-5433.51synapse defective Rho GTPase homolog 2 [Source:HGN... [more]
SYDE14.331e-4735.67synapse defective Rho GTPase homolog 1 [Source:HGN... [more]
SYDE14.711e-4735.67synapse defective Rho GTPase homolog 1 [Source:HGN... [more]
SYDE11.419e-3437.21synapse defective Rho GTPase homolog 1 [Source:HGN... [more]
BCR5.164e-3231.99BCR activator of RhoGEF and GTPase [Source:HGNC Sy... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syd-14.266e-5833.16Rho GTPase-activating protein syd-1 [Source:UniPr... [more]
syd-14.656e-5733.16Rho GTPase-activating protein syd-1 [Source:UniPr... [more]
syd-11.509e-5633.51Rho GTPase-activating protein syd-1 [Source:UniPr... [more]
tag-3256.726e-1937.33WW domain-containing protein tag-325 [Source:UniP... [more]
tag-3252.583e-1837.33WW domain-containing protein tag-325 [Source:UniP... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RhoGAP100F3.744e-8140.77gene:FBgn0039883 transcript:FBtr0304595[more]
RhoGAP100F3.756e-8140.77gene:FBgn0039883 transcript:FBtr0309829[more]
RhoGAP100F3.818e-8140.77gene:FBgn0039883 transcript:FBtr0302180[more]
RhoGAP100F4.106e-8140.77gene:FBgn0039883 transcript:FBtr0302181[more]
RhoGAP100F5.239e-8140.77gene:FBgn0039883 transcript:FBtr0343538[more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYDE28.829e-5332.43synapse defective 1, Rho GTPase, homolog 2 (C. ele... [more]
SYDE11.688e-4733.53synapse defective Rho GTPase homolog 1 [Source:NCB... [more]
si:dkey-91m11.55.885e-3230.75si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-9... [more]
si:dkey-91m11.55.906e-3230.75si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-9... [more]
si:dkey-91m11.56.950e-3230.75si:dkey-91m11.5 [Source:ZFIN;Acc:ZDB-GENE-060503-9... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
il61.402e-5231.64interleukin 6 [Source:Xenbase;Acc:XB-GENE-480186][more]
il61.764e-5231.64interleukin 6 [Source:Xenbase;Acc:XB-GENE-480186][more]
bcr2.770e-3030.50BCR, RhoGEF and GTPase activating protein [Source:... [more]
bcr1.892e-2930.29BCR, RhoGEF and GTPase activating protein [Source:... [more]
bcr3.042e-2930.08BCR, RhoGEF and GTPase activating protein [Source:... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syde27.450e-5729.34synapse defective 1, Rho GTPase, homolog 2 (C. ele... [more]
Syde27.561e-5729.34synapse defective 1, Rho GTPase, homolog 2 (C. ele... [more]
Syde23.315e-5630.17synapse defective 1, Rho GTPase, homolog 2 (C. ele... [more]
Syde12.201e-5137.08synapse defective 1, Rho GTPase, homolog 1 (C. ele... [more]
Bcr8.648e-3230.30BCR activator of RhoGEF and GTPase [Source:MGI Sym... [more]
back to top
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9V9S7|SYDE_DROME4.116e-8040.77Rho GTPase-activating protein 100F OS=Drosophila m... [more]
sp|Q61CA4|SYD1_CAEBR4.748e-5833.16Rho GTPase-activating protein syd-1 OS=Caenorhabdi... [more]
sp|Q86NH1|SYD1_CAEEL5.923e-5633.16Rho GTPase-activating protein syd-1 OS=Caenorhabdi... [more]
sp|Q5VT97|SYDE2_HUMAN5.150e-5433.51Rho GTPase-activating protein SYDE2 OS=Homo sapien... [more]
sp|D3ZZN9|SYDE1_RAT6.997e-5035.96Rho GTPase-activating protein SYDE1 OS=Rattus norv... [more]
back to top
BLAST of Rho GTPase-activating protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G9H22.670e-11751.97Rho-GAP domain-containing protein OS=Macrostomum l... [more]
A0A267DD132.842e-11751.97Rho-GAP domain-containing protein OS=Macrostomum l... [more]
A0A267DXS31.968e-11651.97Rho-GAP domain-containing protein OS=Macrostomum l... [more]
A0A267GUS32.242e-11355.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F8321.766e-11255.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYDE23.169e-5234.40synapse defective Rho GTPase homolog 2 [Source:NCB... [more]
SYDE12.738e-3634.24synapse defective Rho GTPase homolog 1 [Source:HGN... [more]
bcr3.993e-3129.23BCR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
bcr5.696e-3129.23BCR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
ABR1.191e-3029.19ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chn23.861e-2031.58chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
ENSPMAT00000004676.13.411e-1931.35pep scaffold:Pmarinus_7.0:GL476377:189826:224778:-... [more]
ENSPMAT00000004494.11.143e-1830.98pep scaffold:Pmarinus_7.0:GL476606:246273:272967:-... [more]
ARHGAP151.277e-1830.00Rho GTPase activating protein 15 [Source:HGNC Symb... [more]
chn21.305e-1733.55chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RGD13.569e-1329.57GTPase-activating protein (RhoGAP) for Rho3p and R... [more]
BEM27.089e-1227.53Rho GTPase activating protein (RhoGAP); involved i... [more]
LRG18.559e-1025.51GTPase-activating protein (GAP); contains Rho1p-sp... [more]
RGA28.328e-927.04GTPase-activating protein for polarity-establishme... [more]
RGA17.909e-727.68GTPase-activating protein for polarity-establishme... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474416.611e-3832.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382423.316e-2837.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494741.836e-1733.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490532.465e-1635.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479953.585e-1528.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYDE27.189e-5129.70synapse defective Rho GTPase homolog 2 [Source:NCB... [more]
SYDE13.065e-3530.64synapse defective Rho GTPase homolog 1 [Source:NCB... [more]
ABR1.460e-3129.89ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
ABR5.872e-3129.97ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
ABR7.209e-3129.97ABR activator of RhoGEF and GTPase [Source:NCBI ge... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017186.10.000e+099.69SMESG000017186.1[more]
SMESG000037897.18.815e-11636.61SMESG000037897.1[more]
SMESG000039887.13.102e-9240.20SMESG000039887.1[more]
SMESG000025211.15.668e-2127.83SMESG000025211.1[more]
SMESG000025211.15.938e-2127.83SMESG000025211.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013182 ID=SMED30013182|Name=Rho GTPase-activating protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4423bp
TCGATTATGGAAAATCTTCAACAACATGGACAACGTTGATCGAATGAAAC
AAATTTTTTTTTGGTTAAATATTAAAACAAAGTACAAAGTTTTGATTATT
TAAAAATAGAGAAAAAAGAATCCACCGATCAAATCGATTGTCAATGTCTA
CGACTTTCACAGAGAATATTAATTGATAAAGATTATATCGAGAATTCATG
GAATCTGTTCAAGAATAATGAATTTTTCACTTTTATGGATTACAATTCGA
GTTCGATTGAACAAAAAGAAATAATTCCCATGACTCCAGTCGTCAACATA
AAGCCGCCATCTTACAAAATTATTAGGATTGAATTCCCGAATTCGGAAAA
GAATCTTTTGACAATTTTAAATGAAAATGATTCAATGAACTCAATGGTAA
CAATATATACTTCACAAACAACAGTTTTATCGGATATTTTGTTTGAAAAT
TGTCTATTTTTTGTCACTCAAGTATCGAAAATGCCCGGCCAGAGTCTCGG
TATATTTCTCAGAGATGGGGATCCATTCACAGACGAGCCGGGTCTGTTTG
TGTCTCGTCTAAGCGATAATCTCTCGATATCTCTCCAATCCGTAAATCAG
GAACGAGAATTAATGAAAGTTGAAATTAAATCCCCAGATATAATCCCAGA
CAACAATGCATTTGTTGTGGAATCCCAACTAGCACATCAACAAAACCCCA
GTGAAAACGACAGCAGCAACAACACCAGCCATTCTGCCTATGACTGCAAC
ATCCACAACAATTCCACAAGCAACCCCTGTTATCGCTCAAATTTCTCTCT
AAAGAAAAACTGTTCTGCTTCCTTTTCAAATGAGAATTCTCCCAGCGATC
TGATTGGTGGATTTTGTGATGAGATTTCAAAATTACAAACAAACATATTT
CCCTTTCAAATCGGAGACAGAATTTGCCGGGTAAGAATCTCTGACTCGAC
GCACAGCCACCAAGACAACAACGACTGTTCTATTATAGAAAAAATCGATA
ATTATTCACGGAGTGATGGAACTAATAATAACAAACGAAACGACGCGGAG
AAGAAGTACAATCTTGATGATGTAGTTTTGTTTATGTCGATTTCGAGTTT
TCTGGAATTAAGCATTCTCAGAGAAGGAAGAAATAATCAAAAACCGAGCT
TAGAACAAGTTGATGAAAAATCGTCTACATATGATGAAGAGAGTAATAAA
TTTTTCGTCGATGAACAAATCCGCCGAGTGAGCTTTCAGTTGTCAGACCA
AGAATCGCAATCTTTGTCTCCTGGACCTTCAATCGACTGTGAACAAGAGG
AAATTGTGTCTAAAACTCTTTCACTGAATTCTGAAAAAACTAAAGACCAA
CGTGTACGTTTCGATGAATTTGAAAGTTCTCCGATTTGGGATCATTTGCA
TCCCTCAATGGCTAACTCTGTGCCAACAATGTTAAATTCGACGATTTCTC
TAGATCGCACAAATTTTTCAGAGAAACATAAATCAACATCGAAAAATATT
CTTTTACGAGAAGTTCCAACTGAAGATTCAAACGATAGTGGTTTATCAAG
TGAAAACTCTTGGCTACCGTCAATAATATCCACTACCAACCATTCTTTAC
CCCTTGATACGACGAATACAGTAACGATTTGCAATATGTCTGCTCCGGAT
TCATTTGGTACCGGCAATCCTATGAGGACTGTTCATTTTGCTGGATCAAA
GATTCATTCCCAAACCGTACCTACTGAGGTTTATAATCCTAGCCATCAAG
TACCTTGGCCCTATCAAAGAGCTTCTTTAACGAATCCAAGAACCGTGACG
TTTAGAACTAATCAAAAAGCTTCTATATCATCTCCACCGTCACCGCAGTC
TCAGGGACCTTTAAAGAATGTTTACTGGCCTCAAAACTTCTACATCCCAA
GACACACTGGGCCACTGTATCCATCACAAAGTCTTTCAGATCCAAGAATG
TTAAATTATCGTTGGATTTCACCTCCAGTTGCACAATCTTACCCAGTAGA
AGTGGCAGATAAAGGTATACAATGTGGTCCCGATAGGCACGGATATAATT
CTGATACAGAATTGAAAATGAAATCACATCAACCTTTTCCAGTTGATATG
CATTCATTAAACAAAAGTCAAGTCAAATTTTCAGTTTCAAGAACTGCTCC
CCATCTTCATAGATCAACAGTTAATTATTCATCCGGTGAAGAAGAAGGCT
TTTATCAAGCCACTTCTCCTTCGAGATACATAGATCCCAAACAGTCAATG
ATGTGTTCAAATCAAAACATGATGTACAAACAAGTTTCAAGCCAACCTTC
TATTGAAGACGAAATGAGAAATCTTAATATCCGACCATATATGCCTGTGC
CAATGATGGAAACCGATTTTTTTGACAATGCTACAAGAACAGATTTATCA
TATTTCCGAGCTCCTAATAATGTATTGGAATATTCATCACCAGGATATGC
ATTCTCTTCAAATGCCCAAAATGATTTCAGATCTACAGCAAGTGCCCCTT
CCTTCCGCTCACTTCGTCAGCCTTCTCGTCCAAAAGACCAACAAATGGAT
CATGGAGAACAGTCAGTATCTCGATTAGATCCTAATGAATTCAGGAAAAT
TCAAACTGAACAATGGCCTCCTGTTTTAGCGTCTGGTGGTCATCCTCAAC
GAAATAAATCTGCTACCGGTTACGTAAGTGGTATGCTGGTCATCCACGTC
GTAGCTGGAATTGGATTAAATTCTTCACAAACTGTTGTTAGAGATCTCTA
TTGTGTCCTTGAAATCGATTCGGTTAGAAGAGCTCGATCTATGATTAGGA
CTAGCACGGAAATCTTTGAATGGGATGAAATCTTTGAATTAGATGTTGAA
GACAACGATTGGTTGGCGTTTCTTTTCTATCAGTGGGATCCAAGAAATCG
GCACAGACTTTGTTTTTATGGAAATGTTGCACTGAGACAATTGATAGAAC
GGTTTAGACATTCTTACACAAATTCAGAGAAACTTGCACTTTATTTGGAA
CCGAAGGGTGTATTATTTATCGAACTACTCTATTTAAAAATTAATGAAGT
CTTTCAAAGATTTAAAATGCCCGTCAATACTGATGCTTTATTTGGAGTAC
CCCTCGAAGTACTTGTGTCAAGAGATTTGAATAGACAAGGTGAAACTGAT
GGTCAAGAATGCAGAGTACCAATAATAGTTCGCAGGTGTACCGAGGAAGT
GGAAAAACGAGGTTTAGATGTTGTTAGCATTTATCGTTTAAGTGGTGCTG
TGAAACTGAAGATTCGAATTAGAGAAATGCTTGAACAGGATGTTATTGCT
GCAGACCTATCAGCAGACACGGTTCCGGATATCCATGCAATTACAGCTGT
GCTAAGAGATTTTTTGAGAGAATTGCCGGAGCCACTTTTTACGAATGCTC
TTTACAGAATGATTCTTGACGCTTTGCAGGTTAGTTTACCAGGAGATAAC
TATGCGGGCGCTAAATTGATGCTGAATATTCTCGACTGCTTGCCTATTGT
GAATCAAGATACCATTCTGCATCTGCTGGATCATTTAAAGAGGGTTTCGA
GTAGAAGTGAAGTAAATAAAATGACCAACGAAGCACTGGCTGCAAGTTTG
GGTCCAGTTTTATTTTTTCCATCTCCGGAAGAAGCAAAAAAGTTAGATAA
AAGCCTTCTCGATCCAAAGAAACAAGCACAAACTCTATTGTACATTTTAA
ATATTTGGCCTGATGAATCAGACCATCAGTATCATTCAAGAGATTCTAAA
TCAAAAGAACCGCAGAAAATTCATTCGAATTCTATATCAAATGCTCAAAA
GATAACCCATATAACTCCTTCAACCAGATACTCAAAACCAAGTCCTTCCA
CAGTTCGAACATCTCCAAACCAAACAGACACCGCCGCCACTCCACGAAAA
TCAGACGCACCAATCAACAGTGGAATGAATTCAGCGGAAAATGTTCGAAG
TCAAAACAACGTAAAAAATCGTAGACCGATTTTAAGTAACAGTCGTCGAA
GCAATTCATTGGAAATGACTGAACGAGACCAATCGAGAGGTCGTTCCGCA
ACGATGTCTTCAGGCAATCATAGTCGGCTGACTTCTAGGTCCAGTAGTAG
AGATAGGAAGGTCGTACTAGTGGACGAGAGTTCGATGCCTTATCTGTGAT
GTGCTGCTCTACGAGAAAGTGACAAAATCAATACGCCACCTTTGTTGGCA
CATTATATATTTTTAAAATTTTGATCGATAGCTATGTTATTATACTGAGA
AAATCGATAGATTATTTTTATCATGAGATAGCTTTACCAGTTTGTATTTT
TATTGATTACAAGTATAGGGGGGCAAAATTAGGTTTTTCAATTGATTATA
TCAAATTTGTAATTTGTGATATTGACTTACCAGAGCTATTATTGAATTTT
ATGATACTCAGATATGTTTGGAC
back to top

protein sequence of SMED30013182-orf-1

>SMED30013182-orf-1 ID=SMED30013182-orf-1|Name=SMED30013182-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1305bp
MDYNSSSIEQKEIIPMTPVVNIKPPSYKIIRIEFPNSEKNLLTILNENDS
MNSMVTIYTSQTTVLSDILFENCLFFVTQVSKMPGQSLGIFLRDGDPFTD
EPGLFVSRLSDNLSISLQSVNQERELMKVEIKSPDIIPDNNAFVVESQLA
HQQNPSENDSSNNTSHSAYDCNIHNNSTSNPCYRSNFSLKKNCSASFSNE
NSPSDLIGGFCDEISKLQTNIFPFQIGDRICRVRISDSTHSHQDNNDCSI
IEKIDNYSRSDGTNNNKRNDAEKKYNLDDVVLFMSISSFLELSILREGRN
NQKPSLEQVDEKSSTYDEESNKFFVDEQIRRVSFQLSDQESQSLSPGPSI
DCEQEEIVSKTLSLNSEKTKDQRVRFDEFESSPIWDHLHPSMANSVPTML
NSTISLDRTNFSEKHKSTSKNILLREVPTEDSNDSGLSSENSWLPSIIST
TNHSLPLDTTNTVTICNMSAPDSFGTGNPMRTVHFAGSKIHSQTVPTEVY
NPSHQVPWPYQRASLTNPRTVTFRTNQKASISSPPSPQSQGPLKNVYWPQ
NFYIPRHTGPLYPSQSLSDPRMLNYRWISPPVAQSYPVEVADKGIQCGPD
RHGYNSDTELKMKSHQPFPVDMHSLNKSQVKFSVSRTAPHLHRSTVNYSS
GEEEGFYQATSPSRYIDPKQSMMCSNQNMMYKQVSSQPSIEDEMRNLNIR
PYMPVPMMETDFFDNATRTDLSYFRAPNNVLEYSSPGYAFSSNAQNDFRS
TASAPSFRSLRQPSRPKDQQMDHGEQSVSRLDPNEFRKIQTEQWPPVLAS
GGHPQRNKSATGYVSGMLVIHVVAGIGLNSSQTVVRDLYCVLEIDSVRRA
RSMIRTSTEIFEWDEIFELDVEDNDWLAFLFYQWDPRNRHRLCFYGNVAL
RQLIERFRHSYTNSEKLALYLEPKGVLFIELLYLKINEVFQRFKMPVNTD
ALFGVPLEVLVSRDLNRQGETDGQECRVPIIVRRCTEEVEKRGLDVVSIY
RLSGAVKLKIRIREMLEQDVIAADLSADTVPDIHAITAVLRDFLRELPEP
LFTNALYRMILDALQVSLPGDNYAGAKLMLNILDCLPIVNQDTILHLLDH
LKRVSSRSEVNKMTNEALAASLGPVLFFPSPEEAKKLDKSLLDPKKQAQT
LLYILNIWPDESDHQYHSRDSKSKEPQKIHSNSISNAQKITHITPSTRYS
KPSPSTVRTSPNQTDTAATPRKSDAPINSGMNSAENVRSQNNVKNRRPIL
SNSRRSNSLEMTERDQSRGRSATMSSGNHSRLTSRSSSRDRKVVLVDESS
MPYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR000198RhoGAP_dom
IPR000008C2_dom
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 977..1160
e-value: 1.4E-44
score: 164.1
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 980..1133
e-value: 1.5E-35
score: 122.3
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 956..1163
score: 36.929
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 814..934
e-value: 1.7E-5
score: 26.7
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 939..1194
e-value: 2.0E-47
score: 163.5
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 953..1158
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1179..1258
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1269..1284
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 752..783
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1166..1305
NoneNo IPR availablePANTHERPTHR46150FAMILY NOT NAMEDcoord: 78..1284
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 815..936