Roc domain-containing protein

Overview
NameRoc domain-containing protein
Smed IDSMED30013176
Length (bp)8961
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Roc domain-containing protein (SMED30013176) t-SNE clustered cells

Violin plots show distribution of expression levels for Roc domain-containing protein (SMED30013176) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Roc domain-containing protein (SMED30013176) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Roc domain-containing protein (SMED30013176) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013176

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013176SMESG000066553.1 SmedASXL_018208SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30013176SMESG000066553.1 SmedASXL_018207SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30013176SMESG000066553.1 dd_Smed_v4_12105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013176SMESG000066553.1 dd_Smed_v4_12105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30013176SMESG000066553.1 dd_Smed_v4_12105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013176SMESG000066553.1 dd_Smed_v4_12105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013176SMESG000066553.1 dd_Smed_v4_12105_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013176SMESG000066553.1 dd_Smed_v4_12105_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: LRRK2 (leucine rich repeat kinase 2 [Source:HGNC Symbol;Acc:HGNC:18618])

HSP 1 Score: 147.132 bits (370), Expect = 4.649e-34
Identity = 123/491 (25.05%), Postives = 234/491 (47.66%), Query Frame = 3
Query: 5202 TNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILS--------SYVGTLPLEVLSCQNCDNLKTPPYEIRRQG--MRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEI---NLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQG-FEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDK-------SEIPTTHFQSR-YPSVVGFFFVSSL-TGKGVKELHDKIIEET-----KGQPYIGELVPNAWLRFEKELISQRSSA----DYLNWEAVKKLANNNAIY--DGEINQAIRFLHDLGSIQYFEFPLLK--DFVIINSQWLVDVMACVVSVK--------NSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFS 6542
            + ++ L  S+     +P EI  L+NL    +D   NL++ S        S +  LPL+ L            ++ +  G   +++I +L + +  +    R KLM+VG  G+GKT+L++ L         +  ++ T GID+  W  +  +    +L  ++WDFAG+  +Y+TH  F+T RA+YL ++++ +G  E   +  WL ++   A S+P+ +VGTH D  D+       S+I       R +P++  + FV++      + +L   II E+     + Q  +G+L+P+ ++  EK ++S+R +       ++ + + +L   N +   + E+  A+ FL++ G + +F+ P L+  D   +  +WL  +MA +++VK          II    +E  K      K+P++      +L E F +   + G+E+  +P  L + +P    P       +      Y+  Y P G ++R   RL + S
Sbjct: 1245 SRVEKLHLSHNKLKEIPPEIGCLENLTS--LDVSYNLELRSFPNEMGKLSKIWDLPLDELHLN---------FDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTK--KSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVE--KFLSKKRKFPKNYMSQYFKLLEKFQIALPI-GEEYLLVPSSLSDHRPVIELPH---CENSEIIIRLYEMPYFPMGFWSRLINRLLEIS 1716          
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: LRRK1 (leucine rich repeat kinase 1 [Source:HGNC Symbol;Acc:HGNC:18608])

HSP 1 Score: 114.39 bits (285), Expect = 3.338e-24
Identity = 119/495 (24.04%), Postives = 218/495 (44.04%), Query Frame = 3
Query: 5115 NRSRFEEFRALFFESTPRFR---------EFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLP-LEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSW------STKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEH-AGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKS----EIPTTHFQ----SRYPSVVGFFFVSSLTGKGVKELHDKIIEETKG---------------------QPYIGELVPNAWLRFEKELIS--QRSSAD----YLNWEAVKKLAN---NNAIYDGE-INQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVKN--SIIENG--KLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNK 6413
            N    +  R  FF +  R R         EFP  +    +L+ L  ++     VP  +  LK+L +  +     L+ L   +G L  L  L  ++   +   P EI+++G + M++YL   +  +E C   K+++VG    GK++L+  L      APQ+     T  I    W       ++    ++++++WD  G       +Q F T +A+Y+++WN+  G E  A L FWL ++   AP+A + +VGTH D ++       I T         R PS         +T K + E+  K +E  +G                     Q   G L+P ++L  ++ +++  QR S D    YL    +++L     +N I D E +  AI FL + G++ +F      L++   ++  WL + +  + ++K   S+ +NG  + E  ++ LV + + +   +   +    F++   V    +  +P LLP+K
Sbjct:  512 NEDGLKTKRIAFFTTRGRQRSGTEAASVLEFPAFL--SESLEVLCLNDNHLDTVPPSVCLLKSLSELYLGNNPGLRELPPELGQLGNLWQLDTEDL-TISNVPAEIQKEGPKAMLSYLRAQLRKAEKCKLMKMIIVGPPRQGKSTLLEILQTGR--APQVVHGEAT--IRTTKWELQRPAGSRAKVESVEFNVWDIGGPASMATVNQCFFTDKALYVVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLALCRSPSGSRATGFPDITFKHLHEISCKSLEGQEGLRQLIFHVTCSMKDVGSTIGCQRLAGRLIPRSYLSLQEAVLAEQQRRSRDDDVQYLTDRQLEQLVEQTPDNDIKDYEDLQSAISFLIETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIRAEDLRMLLVGTGFTQQTEEQYFQFLAKFEIALPVANDSY-LLPHLLPSK 998          
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: MFHAS1 (malignant fibrous histiocytoma amplified sequence 1 [Source:HGNC Symbol;Acc:HGNC:16982])

HSP 1 Score: 98.2117 bits (243), Expect = 1.986e-19
Identity = 122/482 (25.31%), Postives = 203/482 (42.12%), Query Frame = 3
Query: 4500 LGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFG--TMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFE--STTSSDGVLNRSR--FEEFRAL---------FFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCY-RTKLMLVGLGGAGKTSLMRALT-----------NKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFE----HAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEI 5852
            LGS    +  + ++R+    +          L +L+V     T +    +  L +L  L LS+  L  +  ++  L   L++L +  N +  +P+ L   S L +L++++  +++ P  +  L  L+ L +   +L GLP+  S L  L  L LSG  + ++            + FC    +   +L    +  L    S      +LN S   FEEF A           + S  +    P  I     L TL   N     +PD I  L  L++ V+ G   + +L  + G L    L     + L  PPYE+  +G+  + AY   L         R KL+L+G   AGKT L   LT           +K  C P  +   ++ GI++ SW T      L++ ++D AG   Y     FFL+  A+Y+L+ N+   +E       +  +L+ V    P A + IVGTH+D   + E+
Sbjct:   82 LGSALGSLRVLVLRRNRFARLPPAVAELGHHLTELDVSHNRLTALGAEVVSALRELRKLNLSHNQLPALPAQLGALAH-LEELDVSFNRLAHLPDSLSCLSRLRTLDVDHNQLTAFPRQLLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGAELGTLP-----------AGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQG-NQIAVLPDHFGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEERVEGCPGGGDKEKCYPP-SPPPVSKGIEVTSW-TADASRGLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNL-ATYEPRHFPTTVGSFLHRVGARVPHAVVCIVGTHADLCGEREL 547          
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: MFHAS1 (malignant fibrous histiocytoma amplified sequence 1 [Source:HGNC Symbol;Acc:HGNC:16982])

HSP 1 Score: 97.8265 bits (242), Expect = 2.313e-19
Identity = 122/482 (25.31%), Postives = 203/482 (42.12%), Query Frame = 3
Query: 4500 LGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFG--TMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFE--STTSSDGVLNRSR--FEEFRAL---------FFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCY-RTKLMLVGLGGAGKTSLMRALT-----------NKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFE----HAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEI 5852
            LGS    +  + ++R+    +          L +L+V     T +    +  L +L  L LS+  L  +  ++  L   L++L +  N +  +P+ L   S L +L++++  +++ P  +  L  L+ L +   +L GLP+  S L  L  L LSG  + ++            + FC    +   +L    +  L    S      +LN S   FEEF A           + S  +    P  I     L TL   N     +PD I  L  L++ V+ G   + +L  + G L    L     + L  PPYE+  +G+  + AY   L         R KL+L+G   AGKT L   LT           +K  C P  +   ++ GI++ SW T      L++ ++D AG   Y     FFL+  A+Y+L+ N+   +E       +  +L+ V    P A + IVGTH+D   + E+
Sbjct:   82 LGSALGSLRVLVLRRNRFARLPPAVAELGHHLTELDVSHNRLTALGAEVVSALRELRKLNLSHNQLPALPAQLGALAH-LEELDVSFNRLAHLPDSLSCLSRLRTLDVDHNQLTAFPRQLLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGAELGTLP-----------AGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQG-NQIAVLPDHFGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEERVEGCPGGGDKEKCYPP-SPPPVSKGIEVTSW-TADASRGLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNL-ATYEPRHFPTTVGSFLHRVGARVPHAVVCIVGTHADLCGEREL 547          
BLAST of Roc domain-containing protein vs. Ensembl Human
Match: MFHAS1 (malignant fibrous histiocytoma amplified sequence 1 [Source:HGNC Symbol;Acc:HGNC:16982])

HSP 1 Score: 97.8265 bits (242), Expect = 2.313e-19
Identity = 122/482 (25.31%), Postives = 203/482 (42.12%), Query Frame = 3
Query: 4500 LGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFG--TMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFE--STTSSDGVLNRSR--FEEFRAL---------FFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCY-RTKLMLVGLGGAGKTSLMRALT-----------NKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFE----HAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEI 5852
            LGS    +  + ++R+    +          L +L+V     T +    +  L +L  L LS+  L  +  ++  L   L++L +  N +  +P+ L   S L +L++++  +++ P  +  L  L+ L +   +L GLP+  S L  L  L LSG  + ++            + FC    +   +L    +  L    S      +LN S   FEEF A           + S  +    P  I     L TL   N     +PD I  L  L++ V+ G   + +L  + G L    L     + L  PPYE+  +G+  + AY   L         R KL+L+G   AGKT L   LT           +K  C P  +   ++ GI++ SW T      L++ ++D AG   Y     FFL+  A+Y+L+ N+   +E       +  +L+ V    P A + IVGTH+D   + E+
Sbjct:   82 LGSALGSLRVLVLRRNRFARLPPAVAELGHHLTELDVSHNRLTALGAEVVSALRELRKLNLSHNQLPALPAQLGALAH-LEELDVSFNRLAHLPDSLSCLSRLRTLDVDHNQLTAFPRQLLQLVALEELDVSSNRLRGLPEDISALRALKILWLSGAELGTLP-----------AGFCELASLESLMLDNNGLQALPAQFSCLQRLKMLNLSSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLISGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQG-NQIAVLPDHFGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEERVEGCPGGGDKEKCYPP-SPPPVSKGIEVTSW-TADASRGLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNL-ATYEPRHFPTTVGSFLHRVGARVPHAVVCIVGTHADLCGEREL 547          
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Match: lrk-1 (Leucine-rich repeat serine/threonine-protein kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TZM3])

HSP 1 Score: 108.227 bits (269), Expect = 1.029e-22
Identity = 114/468 (24.36%), Postives = 197/468 (42.09%), Query Frame = 3
Query: 5166 RFREFPVEILHCTNLQTLIFS-NQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQ-IAEEAITDGIDINSWS----TKTGEINLQ---YSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEH-AGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKS---------EIPTTHFQSRY----------PSVVGFFFVSSLTGKGVKELHDKIIE-----ETKGQPYIGELVPNAW---LRFEKEL---ISQRSSADYLNWEAVKKLANNNAIY--------DGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPES----IHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNK 6413
            +  + P ++   T L  L  S N     +P +   L  L    + GC+  + L S V           N +N KT            ++AYL  ++  S+T +  +LM++G  G GK+ +  AL  +     Q I  E  T  I    W        G+ NL    +S+ DF GQ  Y++THQ+FL+ R++ L++W +  G E  A LD WL ++   AP++ + +VGT+ D+V  +         +I     ++RY          P +V    ++S +   VK L + I           +  + + +P+++   ++  KEL     +      +  EA ++      I         D E   A  FLHD G +  FE   L+D + ++  WL + +  VV +++  +  G L    I      +       +   LL L   F+L  +   ++   IP LLP++
Sbjct:  893 KLLQAPPDVARLTLLSMLNLSGNTAIKELPPDYGMLSRLWSLSLKGCSLKEPLESMV-----------NVENCKTV----------EIVAYLKTILEESKTYHHLRLMILGSDGVGKSVIWDALCKEAVQKRQPIHSE--TGVIRQAEWKFEAKRSKGDKNLGPVGFSVIDFGGQREYHSTHQYFLSKRSLNLVLWKITDGDEALAQLDTWLVNIHARAPNSTVILVGTNLDQVASNSSKFGPGYIDIMEQKVRTRYMVADADKSGLPRIVDVILINSTSRNDVKALLNTIYRTAWEVRMGKERAMEQQIPSSYIALMKVTKELGVEFRKEGQPAVMTVEAYRERVKKRMISKFGRPFRDDIEFYAACTFLHDCGELVRFEDATLRDLIFVDPLWLAEFLTSVVILRSPNLPAGLLSTDAINPHTRSFKSGALLMLKTQLLDLLHKFELALATQPRQL-LIPSLLPDE 1336          
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Match: rab-30 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9XWZ3])

HSP 1 Score: 56.6102 bits (135), Expect = 4.455e-8
Identity = 41/131 (31.30%), Postives = 64/131 (48.85%), Query Frame = 3
Query: 5469 YRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYN-THQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPI-FIVGTHSDKVDKSEIP 5855
            Y  K++LVG  G GKT L+R  T   F   Q A    T G+D    + K G   ++  +WD AGQ  + + T  ++ +  AI +L+++V        L  WL  +  +A    +  +VG   DK D+ E+P
Sbjct:    6 YLFKVVLVGNAGVGKTCLVRKFTQGIFPPGQSA----TIGVDFMIKTVKVGNDKIKLQIWDTAGQERFRSITQSYYRSAHAI-VLVYDVSCQPSFDCLPEWLGEIESYANRRVLKILVGNKVDKGDEREVP 131          
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Match: rac-2 (Ras-related protein rac-2 [Source:UniProtKB/Swiss-Prot;Acc:Q94124])

HSP 1 Score: 55.0694 bits (131), Expect = 1.215e-7
Identity = 49/176 (27.84%), Postives = 75/176 (42.61%), Query Frame = 3
Query: 5478 KLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIW--NVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSD-KVDKSEI---------PTTHFQ----SRYPSVVGFFFVSSLTGKGVKELHDKIIE 5957
            K ++VG G  GKT L+ + T   F       E I    D  S +       +  SLWD AGQ  Y            ++L+ +  N    FE+     W   V+ H P+ PI +VGT +D + D+  I         P +H Q    ++    V +   S+LT  G+K++ D+ I 
Sbjct:    5 KCVVVGDGAVGKTCLLLSYTTNAF-----PGEYILTVFDTYSTNVMVDGRPINLSLWDTAGQDDYDQFRHLSFPQTDVFLVCFALNNPASFENVRAK-WYPEVSHHCPNTPIILVGTKADLREDRDTIERLRERRLQPVSHTQGYVMAKEIKAVKYLECSALTQIGLKQVFDEAIR 174          
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Match: rab-14 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874])

HSP 1 Score: 53.1434 bits (126), Expect = 6.971e-7
Identity = 35/155 (22.58%), Postives = 76/155 (49.03%), Query Frame = 3
Query: 5478 KLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWL-NSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQS-RYPSVVGFFFVSSLTGKGVKE 5936
            K +++G  G GK+ L+   T K F    +A+   T G++  +   +     ++  +WD AGQ  +    + +  G A  L+++++ +   +  L  WL ++ +   P+  IF++G  +D  D+ ++P    ++    + + F   S+ TG  V++
Sbjct:   13 KYIIIGDMGVGKSCLLHQFTEKKF----MADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLADAKSLTNPNTAIFLIGNKADLEDQRDVPYEEAKAFAEENGLTFLECSAKTGSNVED 163          
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Match: rab-14 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874])

HSP 1 Score: 53.1434 bits (126), Expect = 6.971e-7
Identity = 35/155 (22.58%), Postives = 76/155 (49.03%), Query Frame = 3
Query: 5478 KLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWL-NSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQS-RYPSVVGFFFVSSLTGKGVKE 5936
            K +++G  G GK+ L+   T K F    +A+   T G++  +   +     ++  +WD AGQ  +    + +  G A  L+++++ +   +  L  WL ++ +   P+  IF++G  +D  D+ ++P    ++    + + F   S+ TG  V++
Sbjct:   13 KYIIIGDMGVGKSCLLHQFTEKKF----MADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLADAKSLTNPNTAIFLIGNKADLEDQRDVPYEEAKAFAEENGLTFLECSAKTGSNVED 163          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: Lrrk (gene:FBgn0038816 transcript:FBtr0112788)

HSP 1 Score: 118.242 bits (295), Expect = 1.153e-25
Identity = 114/493 (23.12%), Postives = 206/493 (41.78%), Query Frame = 3
Query: 5205 NLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLP----LEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTN----------------KNFCAPQIAEEAI----------------TDGIDINSW------STKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLD---FWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSR-----------------YPSVVGFFFVSSLTGKGVKELHDKIIEETKGQ--------PYIGELVPNAWLRFEKEL------ISQRSSADYLNWEAVKKLA-------NNNAIYD-GEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVK--NSIIENGKLEHSKIKLVWSKYP---ESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQ 6416
            NL  L  +N     +P  +  L +L    I G  N+  L  ++G L     L    C   + L++   E ++    +++ YL  +   ++   R KLM+VG+ G GK++L+  L                  +N  A ++                     T G+DI +W              + +  WDF GQ  YY THQ+FL+ R++YL++W +  G  H GL     WL ++   AP++P+ IVGTH D V +S  P    Q +                  P V+    +S  T   +  L + II +T  Q        P + + +P +++  E  +      +        L+ E  K+L        N  +  D  E+ QA  + H+ G + +++   L+D+  ++ QWL D++A VV+V+  N     G ++   +++++            +++ L   F++  +   +    IP LLP+++
Sbjct:  833 NLSMLDMTNNCLKEIPASLHELSSLSVLNISGNVNITELPPHLGLLSRLWNLNTRGCLLQEPLRSM-IESKKHKTMDIVGYLKSIYEDAQPYARMKLMVVGVAGIGKSTLLDLLRQGAGSGSSSSSHRSRASENHWAKRMGHARSTSRSHRHSSASSANISTVGVDIGTWICEKRKRAPGSHGPVVFRTWDFGGQKEYYATHQYFLSKRSLYLVLWRISDG--HKGLAELLQWLGNIQARAPNSPVIIVGTHFDAVGESISPQKAEQLQQLIREKFIAIPDAEKIGLPRVIDSIEISCRTLHNIHLLAN-IIYDTAMQLRSPGSKEPMLLQKIPASYIALEDIVNVIACNLRAAGRDPVLDGEQYKRLVTEQMRLHNYKSFRDAAELQQATTWCHENGVLLHYDDATLRDYYFLDPQWLCDMLAHVVTVREINPFAPTGVMKLDDLQMLFRSVQVQGNGNRSYIVSLLNKFEVALTWDSRTL-LIPSLLPSQE 1320          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: Lrrk (gene:FBgn0038816 transcript:FBtr0334640)

HSP 1 Score: 118.242 bits (295), Expect = 1.160e-25
Identity = 114/493 (23.12%), Postives = 206/493 (41.78%), Query Frame = 3
Query: 5205 NLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLP----LEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTN----------------KNFCAPQIAEEAI----------------TDGIDINSW------STKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLD---FWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSR-----------------YPSVVGFFFVSSLTGKGVKELHDKIIEETKGQ--------PYIGELVPNAWLRFEKEL------ISQRSSADYLNWEAVKKLA-------NNNAIYD-GEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVK--NSIIENGKLEHSKIKLVWSKYP---ESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQ 6416
            NL  L  +N     +P  +  L +L    I G  N+  L  ++G L     L    C   + L++   E ++    +++ YL  +   ++   R KLM+VG+ G GK++L+  L                  +N  A ++                     T G+DI +W              + +  WDF GQ  YY THQ+FL+ R++YL++W +  G  H GL     WL ++   AP++P+ IVGTH D V +S  P    Q +                  P V+    +S  T   +  L + II +T  Q        P + + +P +++  E  +      +        L+ E  K+L        N  +  D  E+ QA  + H+ G + +++   L+D+  ++ QWL D++A VV+V+  N     G ++   +++++            +++ L   F++  +   +    IP LLP+++
Sbjct:  810 NLSMLDMTNNCLKEIPASLHELSSLSVLNISGNVNITELPPHLGLLSRLWNLNTRGCLLQEPLRSM-IESKKHKTMDIVGYLKSIYEDAQPYARMKLMVVGVAGIGKSTLLDLLRQGAGSGSSSSSHRSRASENHWAKRMGHARSTSRSHRHSSASSANISTVGVDIGTWICEKRKRAPGSHGPVVFRTWDFGGQKEYYATHQYFLSKRSLYLVLWRISDG--HKGLAELLQWLGNIQARAPNSPVIIVGTHFDAVGESISPQKAEQLQQLIREKFIAIPDAEKIGLPRVIDSIEISCRTLHNIHLLAN-IIYDTAMQLRSPGSKEPMLLQKIPASYIALEDIVNVIACNLRAAGRDPVLDGEQYKRLVTEQMRLHNYKSFRDAAELQQATTWCHENGVLLHYDDATLRDYYFLDPQWLCDMLAHVVTVREINPFAPTGVMKLDDLQMLFRSVQVQGNGNRSYIVSLLNKFEVALTWDSRTL-LIPSLLPSQE 1297          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: Lrrk (gene:FBgn0038816 transcript:FBtr0334641)

HSP 1 Score: 117.857 bits (294), Expect = 1.307e-25
Identity = 114/493 (23.12%), Postives = 206/493 (41.78%), Query Frame = 3
Query: 5205 NLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLP----LEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTN----------------KNFCAPQIAEEAI----------------TDGIDINSW------STKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLD---FWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSR-----------------YPSVVGFFFVSSLTGKGVKELHDKIIEETKGQ--------PYIGELVPNAWLRFEKEL------ISQRSSADYLNWEAVKKLA-------NNNAIYD-GEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVK--NSIIENGKLEHSKIKLVWSKYP---ESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQ 6416
            NL  L  +N     +P  +  L +L    I G  N+  L  ++G L     L    C   + L++   E ++    +++ YL  +   ++   R KLM+VG+ G GK++L+  L                  +N  A ++                     T G+DI +W              + +  WDF GQ  YY THQ+FL+ R++YL++W +  G  H GL     WL ++   AP++P+ IVGTH D V +S  P    Q +                  P V+    +S  T   +  L + II +T  Q        P + + +P +++  E  +      +        L+ E  K+L        N  +  D  E+ QA  + H+ G + +++   L+D+  ++ QWL D++A VV+V+  N     G ++   +++++            +++ L   F++  +   +    IP LLP+++
Sbjct:  901 NLSMLDMTNNCLKEIPASLHELSSLSVLNISGNVNITELPPHLGLLSRLWNLNTRGCLLQEPLRSM-IESKKHKTMDIVGYLKSIYEDAQPYARMKLMVVGVAGIGKSTLLDLLRQGAGSGSSSSSHRSRASENHWAKRMGHARSTSRSHRHSSASSANISTVGVDIGTWICEKRKRAPGSHGPVVFRTWDFGGQKEYYATHQYFLSKRSLYLVLWRISDG--HKGLAELLQWLGNIQARAPNSPVIIVGTHFDAVGESISPQKAEQLQQLIREKFIAIPDAEKIGLPRVIDSIEISCRTLHNIHLLAN-IIYDTAMQLRSPGSKEPMLLQKIPASYIALEDIVNVIACNLRAAGRDPVLDGEQYKRLVTEQMRLHNYKSFRDAAELQQATTWCHENGVLLHYDDATLRDYYFLDPQWLCDMLAHVVTVREINPFAPTGVMKLDDLQMLFRSVQVQGNGNRSYIVSLLNKFEVALTWDSRTL-LIPSLLPSQE 1388          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0080627)

HSP 1 Score: 54.6842 bits (130), Expect = 3.583e-7
Identity = 39/156 (25.00%), Postives = 74/156 (47.44%), Query Frame = 3
Query: 5478 KLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWL-NSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFV--SSLTGKGVKE 5936
            K +++G  G GK+ L+   T K F    +A    T G++  +   +  +  ++  +WD AGQ  +    + +  G A  L+++++ +   +  L  WL ++     PS  IF++G  SD     E+ T      +    G  F+  S++TG+ V+E
Sbjct:   37 KYIIIGDMGVGKSCLLHQFTEKKF----MANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREV-TYEEAKEFADENGLMFLEASAMTGQNVEE 187          
BLAST of Roc domain-containing protein vs. Ensembl Fly
Match: Rab14 (gene:FBgn0015791 transcript:FBtr0343678)

HSP 1 Score: 53.9138 bits (128), Expect = 4.806e-7
Identity = 40/158 (25.32%), Postives = 74/158 (46.84%), Query Frame = 3
Query: 5478 KLMLVGLGGAGKTSLMRALTNKNFCA--PQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWL-NSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFV--SSLTGKGVKE 5936
            K +++G  G GK+ L+   T K F A  P       T G++  +   +  +  ++  +WD AGQ  +    + +  G A  L+++++ +   +  L  WL ++     PS  IF++G  SD     E+ T      +    G  F+  S++TG+ V+E
Sbjct:   13 KYIIIGDMGVGKSCLLHQFTEKKFMANCPH------TIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREV-TYEEAKEFADENGLMFLEASAMTGQNVEE 163          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: lrrk1 (leucine-rich repeat kinase 1 [Source:ZFIN;Acc:ZDB-GENE-101019-2])

HSP 1 Score: 118.627 bits (296), Expect = 8.735e-26
Identity = 155/692 (22.40%), Postives = 287/692 (41.47%), Query Frame = 3
Query: 4512 CRCIANIAIKRSEMD-------NVKETALVTCTKLRKLEVDFGTMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNL--KFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPV-----EILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLP-LEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWS-------TKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEH-AGLDFWLNSVTCHAPSAPIFIVGTHSDKVD---KSEIPTTHFQ-----SRYPSVVGFFFVSSLTGKGVKELHDKIIEETKG---------------------QPYIGELVPNAWLRFEKELISQRSSAD------YLNWEAVKKLANNNAIYD----GEINQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVKN--SIIENG--KLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEF 6383
            C  + ++ +  +E++       ++KE   ++  +  KL   F      +WI  L KL  L +S   L ++   I+H   +L  +++  N +   P+       L   + +N  I  LPD I       L+ + I    L  LP    +L  L +LKL G  IS++       +  +W   C +T             +L  +     G   ++R    +  FF +  R    PV      +L   +L+ L  +N     VP  + +L+NL +  +     +Q L   +G L  L  L  ++  N+   P ++R+ G   ++AYL   + G+E C   KLM+VG    GK++L+  L      +P I  +     +  +SW         KT   ++ +++WD  G       +Q F T +A+Y++IWN+  G E  A L  WL ++   AP++ + +VGTH D +D   ++E   T         R PS         +T K + E+  K +E   G                        +G L+P ++L  ++ + ++R   D      YL    ++++   +   D     ++  AI FL + GS+ +F      L     +++ WL + +  +++++   S+  NG  K E  ++ LV + +     +   +    F++   V    +
Sbjct:  349 CSRLQHVNVSENELECLPLGLLHLKELQRISAAR-NKLSCLFNIPDGTNWI-GLRKLQGLDVSENSLTDLPSSILHCLKTLNSINISRNKLSRFPDPWAC--PLKICKASNNQIEVLPDTISIFWRTHLREVDISENILKELPAYIFELEALVSLKLCGNQISTL------PAPNKWKCSCLRT------------LDLSRNQLGKTGEATKTR----KLAFFTTWHRRDPDPVCPVQFPVLLRDSLEVLYLNNNQLESVPPSVCALRNLSELYLASNPGIQELPIELGQLSNLWQLDIEDL-NISNIPADVRKDGPAAVLAYLRAELRGAEPCRLLKLMVVGPPRQGKSALLEGLQTGK-PSPFINTDC---SVHTSSWELERPVGVLKTAVDSVSFNVWDIGGPASMSTVNQCFFTDKALYMVIWNLALGEEAVANLQSWLLNIEARAPNSAVIVVGTHLDLIDTKFRTERVATLRAYILALCRTPSGARCSGYPDITWKHLHEVSCKTLEGLDGLKRLLFQVSCSMKDISNPASCHKLVGRLIPKSYLILQEAIKAERVRRDEADEVQYLTDSELEQIIEQSPASDIKDYEDLQTAISFLMETGSVLHFSDTSHGLCKLYFLDAVWLSECLERIINLRGSRSVARNGVIKAEDLRMLLVGTGFTPQTEEQYFQFLAKFEIALPVASSSY 1009          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: ascl1b (si:ch211-210p4.6 [Source:NCBI gene;Acc:560440])

HSP 1 Score: 105.531 bits (262), Expect = 5.976e-22
Identity = 70/239 (29.29%), Postives = 118/239 (49.37%), Query Frame = 3
Query: 5157 STPRFREFPVEILHCTNLQTLIFSNQGF-SIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWN-----VRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKV-DKSEI 5852
            ST R  + P +I  C +L  L  SN     + P  +  L  LK+  I+     ++         L V    N + L+ PP E+   G++++  Y   L + +   Y  K M +G   AGK++L R+L  K  C  Q+AE   T GI+I+ ++ + G  ++++  WDFAGQ  YY TH  F+T +A  +L  N     + +      + FW+ ++    P + + +VGTH D+  D++E+
Sbjct:  110 STNRLEKLPSDISRCQDLTYLNLSNNCLKDLYP--LVGLSRLKELYIERNQLAELPDRLFQNSSLNVFKA-NGNPLRKPPGEVCAGGLKDIQNYFAMLEANAPDVYTVKTMFLGNSMAGKSTLCRSL--KEGCPVQVAEADRTVGIEISEFTVRDGSDSIRFLFWDFAGQEEYYITHHVFITPQAFVILAINLSSYKMDEATFKENVVFWITNLQLQIPDSVVLLVGTHVDQCQDENEV 343          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: ascl1b (si:ch211-210p4.6 [Source:NCBI gene;Acc:560440])

HSP 1 Score: 105.531 bits (262), Expect = 6.068e-22
Identity = 70/239 (29.29%), Postives = 118/239 (49.37%), Query Frame = 3
Query: 5157 STPRFREFPVEILHCTNLQTLIFSNQGF-SIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVR-----QGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKV-DKSEI 5852
            ST R  + P +I  C +L  L  SN     + P  +  L  LK+  I+     ++         L V    N + L+ PP E+   G++++  Y   L + +   Y  K M +G   AGK++L R+L  K  C  Q+AE   T GI+I+ ++ + G  ++++  WDFAGQ  YY TH  F+T +A  +L  N+      +      + FW+ ++    P + + +VGTH D+  D++E+
Sbjct:  110 STNRLEKLPSDISRCQDLTYLNLSNNCLKDLYP--LVGLSRLKELYIERNQLAELPDRLFQNSSLNVFKA-NGNPLRKPPGEVCAGGLKDIQNYFAMLEANAPDVYTVKTMFLGNSMAGKSTLCRSL--KEGCPVQVAEADRTVGIEISEFTVRDGSDSIRFLFWDFAGQEEYYITHHVFITPQAFVILAINLSSYKMDEATFKENVVFWITNLQLQIPDSVVLLVGTHVDQCQDENEV 343          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: lrrk2 (leucine-rich repeat kinase 2 [Source:ZFIN;Acc:ZDB-GENE-071218-6])

HSP 1 Score: 104.375 bits (259), Expect = 2.354e-21
Identity = 88/363 (24.24%), Postives = 167/363 (46.01%), Query Frame = 3
Query: 5586 GIDINSWSTKTGEI-NLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGF-EHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTT--HFQSRYPSVVGFFFV-----------SSLTGKGVKELHDKIIE-ETKGQPYIGELVPNAWLRFEKELISQRSS--ADY--LNWEAVKKLANNNAIY--DGEINQAIRFLHDLGSIQYFEFPL-LKDFVIINSQWLVDVMACVVSVKNS---IIENGKLEHSKIKLVWSK---YPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKN 6587
            G+ I  W  ++ +  N+  ++W+F+G       H  F++ RA+YL+++++ +G  E   +  WL ++   A   P+ +VGTH+D  ++  +       Q    S  GF  +           S   G+  K ++ ++I  + +GQP +G+LVP+ ++  EK L+ +RS   AD+  L    + ++     +   +GE+  AI FL + G + +F+  L LKD   I+ QW   +++  +S+K+S       G ++ S ++    K   +P+       +L E F +       +   IP  L + +P    P       +      Y+  Y P G + R   RL + S +F+++     L  N
Sbjct: 1359 GVSIRDWPVRSKDKRNMMLNVWEFSGGEECSGIHPHFMSSRAVYLVLYDLSKGASEIHAIKPWLFNIKAVAGQCPVIVVGTHADLCEERHLQECLLKLQKELQSQPGFPAIRENHVLSACEESESLGRLRKAIYRELIGFKIQGQPVMGQLVPDCYVELEKRLLQERSCAPADFPVLRHSRLMEILQETQLQLEEGELPHAIHFLSEAGVLLHFDPVLQLKDLYFIDLQWFCRIISQTLSLKSSGPWDSTKGVVQRSTVEKFVEKSRCFPKDHMIQYFKLLEKFQIALPFDHDQL-LIPSSLSDHRPVIELPH---CENSEVIIRLYEMPYFPMGYWPRQISRLLEVS-AFLLYGREKALKPN 1716          
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Match: BX511222.1 (malignant fibrous histiocytoma amplified sequence 1 [Source:NCBI gene;Acc:797005])

HSP 1 Score: 99.3673 bits (246), Expect = 5.891e-20
Identity = 134/511 (26.22%), Postives = 209/511 (40.90%), Query Frame = 3
Query: 4470 LSTKVMQVSDLGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFGTMINI-SWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHING-----QVLQEEEIFNL-----------------FESTTSSDGVLNR-----SRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQN------CDN----------------LKTPPYEIRRQGMRNMIAYLLRLVSGSETCY-RTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAI-TDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNV-----RQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSD 5831
            LSTK  Q   L    + I  + +  + +  + E    T TKLR L +       + S +  L +L  L +S+  L+    +I  LK  LK+L    N I+ +P                         IG L+ L+ L I   +L   P+SFSQL  L TL +    +    ++   LS  E  D C+   + G      +LQ  +I  L                  ES    +  L R      + ++ + L   S   F +FP  I+  T L+ L  S    + +P+E+  L NL    +D  +   +  S V    LE L  Q        DN                L  PPYE+  +G+  + AY   L         R KL+L+G G AGKT+L + + +K        + AI   GID+ +W     E +L + ++D +G+  Y     FFL+  A+Y+L+ N+     +  + H G   +L+ ++   P A + IVGTHSD
Sbjct:   32 LSTKNSQKITLPEDIKEIEVLNLGNNSLQELPEGLGSTLTKLRILILRRNKFATVPSAVFQLSQLVELDISHNCLNHFSEDIDLLK-GLKKLCFSHNRIQYLP-----------------------SQIGTLQSLEELDISFNELHDFPRSFSQLRKLRTLDVDHNKLQRFPSEILALSDLEELD-CSGNKLEGLPGNIMMLQSIKILWLSSTHLLSLPETFCELQNLESLMLDNNFLTRLPQSFGKMQKLKMLNLSSN-SFEDFPQVIIKLTKLEELYLSRNKLTFLPEEVGQLCNLANLWLDNNSITFLPDSIVELGKLEELVLQGNQIAILPDNFGKLAKVNIWKVKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAIKPRLKLVLMGQGNAGKTTLRQCIVSKQ----SDTKMAIGCRGIDVTNW-VADAERSLTFIVYDLSGKQNYDLIKPFFLSPGALYVLVVNLKLYTSKSFYSHVG--SFLHLLSAKVPHAVVCIVGTHSD 509          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: hes2 (hes family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-486138])

HSP 1 Score: 147.517 bits (371), Expect = 2.457e-34
Identity = 184/770 (23.90%), Postives = 330/770 (42.86%), Query Frame = 3
Query: 4653 PKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLS--------------------IERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFS-NQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKT-GEINLQYSL--WDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGF-EHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVD-----------KSEIPTTHFQSRYPSVVGFFFV-SSLTGKGVKELHDKIIEET-----KGQPYIGELVPNAWLRFEKELISQRSSADY----LNWEAVKKLANNNAIY--DGEINQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVK--------NSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFI------------IWQNGSLLNKNDDKALL---TKLN-------DTTLRVCARGFWPENILFIVHEMFETLISEAFSGV 6722
            P L  L LS   L      I ++  +L++L ++GN I E+   LC+  L       N++     D + +   L+  S                    +   K++ +P    QL++L ++ LS   I+ +       S+       N  HI+        + NL +   S       SR E+       S  + +E P EI    N+ +   S N      PDE+  L  +    +DG   L I   ++G        C+  D ++       +Q ++  + Y            R K+++VG  G+GKT+L++ L  K       AE+A T GID+  W     G+I  + +L  WDFAGQ  +Y +H  F+T +A+YL+++++ +G  E   +  WL ++   A S+P+ +VGTH D  D           K E+   H     PS+  + FV +S     + +L   II E      + QP +G+L+P+++L  EK+++++R +       ++ E + ++   + ++  + E+  A+ FL++ G + +FE P   L+D   ++ QWL  ++A +++V+          II    +E    K    K+P++      +L E F +   + G++   IP  L + +P    P       +      Y+  Y P G ++R   RL + S   +             W+ G  LN + +   L   TKL+         T+  C +G     +L  V +  ++L+ E F G+
Sbjct: 1035 PNLKQLNLSYNQLMSFPENIGNITQNLEELIMEGNNISEIHIPLCLPELHTINLNKNSIHFLATDFLKDCVKLETFSATTNLLSIAPNLPQKISAVKLSHNKVTNIPTEILQLSHLRSIDLSNNQIAHLPGPLEWTSLNLREIILNHNHIS--------VLNLSKDACS------WSRLEKLHL----SYNKIKEIPPEIGFLENITSFDISYNPDLRTFPDEMGKLTKIWDLPLDGLC-LDIDLKHIG--------CKAKDLIR-----FLQQRLKKAVPY-----------NRMKVLIVGNTGSGKTTLVQQLM-KCRRLEHGAEKA-TVGIDVKDWPILIRGKIKKEITLNVWDFAGQEEFYCSHPHFMTPQALYLVVYDLSKGVSEVDAIKPWLFNIKARASSSPVILVGTHLDVSDEKCQKACISKIKQELCNQH---GLPSIREYHFVNASEESDLLAKLRKTIIRECLNFKIREQPVLGQLIPDSYLELEKKILNERKNVPLEFPVISHERMLEIVEESQLHLDENELTHAVHFLNESGVLLHFEDPALQLRDLYFVDPQWLCKIIAQILTVRADGCQKYPKGIIHCNDVERFLEK--KKKFPKNYMSQYFKLLEKFQIALPL-GEDQLLIPSSLSDHRPVIELPH---CENSEVIIRLYEMSYFPMGFWSRLINRLLEVSTYMLSGRERAQRPNRMYWRQGIYLNWSPEAYCLVESTKLDRNPNSFLKVTVPSCRKGCI---LLGQVVDHIDSLMEEWFPGL 1747          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: hes2 (hes family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-486138])

HSP 1 Score: 147.517 bits (371), Expect = 2.750e-34
Identity = 184/770 (23.90%), Postives = 330/770 (42.86%), Query Frame = 3
Query: 4653 PKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLS--------------------IERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFS-NQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKT-GEINLQYSL--WDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGF-EHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVD-----------KSEIPTTHFQSRYPSVVGFFFV-SSLTGKGVKELHDKIIEET-----KGQPYIGELVPNAWLRFEKELISQRSSA----DYLNWEAVKKLANNNAIY--DGEINQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVK--------NSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFI------------IWQNGSLLNKNDDKALL---TKLN-------DTTLRVCARGFWPENILFIVHEMFETLISEAFSGV 6722
            P L  L LS   L      I ++  +L++L ++GN I E+   LC+  L       N++     D + +   L+  S                    +   K++ +P    QL++L ++ LS   I+ +       S+       N  HI+        + NL +   S       SR E+       S  + +E P EI    N+ +   S N      PDE+  L  +    +DG   L I   ++G        C+  D ++       +Q ++  + Y            R K+++VG  G+GKT+L++ L  K       AE+A T GID+  W     G+I  + +L  WDFAGQ  +Y +H  F+T +A+YL+++++ +G  E   +  WL ++   A S+P+ +VGTH D  D           K E+   H     PS+  + FV +S     + +L   II E      + QP +G+L+P+++L  EK+++++R +       ++ E + ++   + ++  + E+  A+ FL++ G + +FE P   L+D   ++ QWL  ++A +++V+          II    +E    K    K+P++      +L E F +   + G++   IP  L + +P    P       +      Y+  Y P G ++R   RL + S   +             W+ G  LN + +   L   TKL+         T+  C +G     +L  V +  ++L+ E F G+
Sbjct: 1075 PNLKQLNLSYNQLMSFPENIGNITQNLEELIMEGNNISEIHIPLCLPELHTINLNKNSIHFLATDFLKDCVKLETFSATTNLLSIAPNLPQKISAVKLSHNKVTNIPTEILQLSHLRSIDLSNNQIAHLPGPLEWTSLNLREIILNHNHIS--------VLNLSKDACS------WSRLEKLHL----SYNKIKEIPPEIGFLENITSFDISYNPDLRTFPDEMGKLTKIWDLPLDGLC-LDIDLKHIG--------CKAKDLIR-----FLQQRLKKAVPY-----------NRMKVLIVGNTGSGKTTLVQQLM-KCRRLEHGAEKA-TVGIDVKDWPILIRGKIKKEITLNVWDFAGQEEFYCSHPHFMTPQALYLVVYDLSKGVSEVDAIKPWLFNIKARASSSPVILVGTHLDVSDEKCQKACISKIKQELCNQH---GLPSIREYHFVNASEESDLLAKLRKTIIRECLNFKIREQPVLGQLIPDSYLELEKKILNERKNVPLEFPVISHERMLEIVEESQLHLDENELTHAVHFLNESGVLLHFEDPALQLRDLYFVDPQWLCKIIAQILTVRADGCQKYPKGIIHCNDVERFLEK--KKKFPKNYMSQYFKLLEKFQIALPL-GEDQLLIPSSLSDHRPVIELPH---CENSEVIIRLYEMSYFPMGFWSRLINRLLEVSTYMLSGRERAQRPNRMYWRQGIYLNWSPEAYCLVESTKLDRNPNSFLKVTVPSCRKGCI---LLGQVVDHIDSLMEEWFPGL 1787          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: hes2 (hes family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-486138])

HSP 1 Score: 147.517 bits (371), Expect = 2.883e-34
Identity = 182/771 (23.61%), Postives = 328/771 (42.54%), Query Frame = 3
Query: 4653 PKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLS--------------------IERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFS-NQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAP-QIAEEAITDGIDINSWSTKT-GEINLQYSL--WDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGF-EHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVD-----------KSEIPTTHFQSRYPSVVGFFFV-SSLTGKGVKELHDKIIEET-----KGQPYIGELVPNAWLRFEKELISQRSSA----DYLNWEAVKKLANNNAIY--DGEINQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVK--------NSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFI------------IWQNGSLLNKNDDKALL---TKLN-------DTTLRVCARGFWPENILFIVHEMFETLISEAFSGV 6722
            P L  L LS   L      I ++  +L++L ++GN I E+   LC+  L       N++     D + +   L+  S                    +   K++ +P    QL++L ++ LS   I+ +       S+       N  HI+        + NL +   S       SR E+       S  + +E P EI    N+ +   S N      PDE+  L  +    +DG   L I   ++G        C+  D ++       +Q ++  + Y            R K+++VG  G+GKT+L++ L     C   +   E  T GID+  W     G+I  + +L  WDFAGQ  +Y +H  F+T +A+YL+++++ +G  E   +  WL ++   A S+P+ +VGTH D  D           K E+   H     PS+  + FV +S     + +L   II E      + QP +G+L+P+++L  EK+++++R +       ++ E + ++   + ++  + E+  A+ FL++ G + +FE P   L+D   ++ QWL  ++A +++V+          II    +E    K    K+P++      +L E F +   + G++   IP  L + +P    P       +      Y+  Y P G ++R   RL + S   +             W+ G  LN + +   L   TKL+         T+  C +G     +L  V +  ++L+ E F G+
Sbjct: 1075 PNLKQLNLSYNQLMSFPENIGNITQNLEELIMEGNNISEIHIPLCLPELHTINLNKNSIHFLATDFLKDCVKLETFSATTNLLSIAPNLPQKISAVKLSHNKVTNIPTEILQLSHLRSIDLSNNQIAHLPGPLEWTSLNLREIILNHNHIS--------VLNLSKDACS------WSRLEKLHL----SYNKIKEIPPEIGFLENITSFDISYNPDLRTFPDEMGKLTKIWDLPLDGLC-LDIDLKHIG--------CKAKDLIR-----FLQQRLKKAVPY-----------NRMKVLIVGNTGSGKTTLVQQLMK---CRRLEHGAEKATVGIDVKDWPILIRGKIKKEITLNVWDFAGQEEFYCSHPHFMTPQALYLVVYDLSKGVSEVDAIKPWLFNIKARASSSPVILVGTHLDVSDEKCQKACISKIKQELCNQH---GLPSIREYHFVNASEESDLLAKLRKTIIRECLNFKIREQPVLGQLIPDSYLELEKKILNERKNVPLEFPVISHERMLEIVEESQLHLDENELTHAVHFLNESGVLLHFEDPALQLRDLYFVDPQWLCKIIAQILTVRADGCQKYPKGIIHCNDVERFLEK--KKKFPKNYMSQYFKLLEKFQIALPL-GEDQLLIPSSLSDHRPVIELPH---CENSEVIIRLYEMSYFPMGFWSRLINRLLEVSTYMLSGRERAQRPNRMYWRQGIYLNWSPEAYCLVESTKLDRNPNSFLKVTVPSCRKGCI---LLGQVVDHIDSLMEEWFPGL 1787          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: hes2 (hes family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-486138])

HSP 1 Score: 143.28 bits (360), Expect = 5.126e-33
Identity = 184/760 (24.21%), Postives = 330/760 (43.42%), Query Frame = 3
Query: 4653 PKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNK--THINGQV----LQEEEIF---NLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFS-NQGFSIVPDEIQSLKNLKKFVIDG-CANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKT-GEINLQYSL--WDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGF-EHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVD-----------KSEIPTTHFQSRYPSVVGFFFV-SSLTGKGVKELHDKIIEET-----KGQPYIGELVPNAWLRFEKELISQRSSADY----LNWEAVKKLANNNAIY--DGEINQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVK--------NSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFI------------IWQNGSLLNKNDDKALL---TKLN-------DTTLRVCARGFWPENILFIVHEMFETLISEAFSGV 6722
            P L  L LS   L      I ++  +L++L ++GN I E+   LC+  L       N++     D + +   L+  S     LS  P +  Q   +S +KLS   +++I     +L ++   D  N    H+ G +    L   EI    N       S    + SR E+       S  + +E P EI    N+ +   S N      PDE+  L  +    +DG C ++           L+ + C+  D ++       +Q ++  + Y            R K+++VG  G+GKT+L++ L        +   E  T GID+  W     G+I  + +L  WDFAGQ  +Y +H  F+T +A+YL+++++ +G  E   +  WL ++   A S+P+ +VGTH D  D           K E+   H     PS+  + FV +S     + +L   II E      + QP +G+L+P+++L  EK+++++R +       ++ E + ++   + ++  + E+  A+ FL++ G + +FE P   L+D   ++ QWL  ++A +++V+          II    +E    K    K+P++      +L E F +   + G++   IP  L + +P    P       +      Y+  Y P G ++R   RL + S   +             W+ G  LN + +   L   TKL+         T+  C +G     +L  V +  ++L+ E F G+
Sbjct:  729 PNLKQLNLSYNQLMSFPENIGNITQNLEELIMEGNNISEIHIPLCLPELHTINLNKNSIHFLATDFLKDCVKLETFSATTNLLSIAP-NLPQ--KISAVKLSHNKVTNI--PTEILHLRSI-DLSNNQIAHLPGPLEWTSLNLREIILNHNHISVLNLSKDACSWSRLEKLHL----SYNKIKEIPPEIGFLENITSFDISYNPDLRTFPDEMGKLTKIWDLPLDGLCLDID----------LKHIGCKAKDLIR-----FLQQRLKKAVPY-----------NRMKVLIVGNTGSGKTTLVQQLMKCR--RLEHGAEKATVGIDVKDWPILIRGKIKKEITLNVWDFAGQEEFYCSHPHFMTPQALYLVVYDLSKGVSEVDAIKPWLFNIKARASSSPVILVGTHLDVSDEKCQKACISKIKQELCNQH---GLPSIREYHFVNASEESDLLAKLRKTIIRECLNFKIREQPVLGQLIPDSYLELEKKILNERKNVPLEFPVISHERMLEIVEESQLHLDENELTHAVHFLNESGVLLHFEDPALQLRDLYFVDPQWLCKIIAQILTVRADGCQKYPKGIIHCNDVERFLEK--KKKFPKNYMSQYFKLLEKFQIALPL-GEDQLLIPSSLSDHRPVIELPH---CENSEVIIRLYEMSYFPMGFWSRLINRLLEVSTYMLSGRERAQRPNRMYWRQGIYLNWSPEAYCLVESTKLDRNPNSFLKVTVPSCRKGCI---LLGQVVDHIDSLMEEWFPGL 1438          
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Match: hes2 (hes family bHLH transcription factor 2 [Source:Xenbase;Acc:XB-GENE-486138])

HSP 1 Score: 143.28 bits (360), Expect = 5.504e-33
Identity = 186/760 (24.47%), Postives = 330/760 (43.42%), Query Frame = 3
Query: 4653 PKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNK--THINGQV----LQEEEIF---NLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFS-NQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAP-QIAEEAITDGIDINSWSTKT-GEINLQYSL--WDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGF-EHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVD-----------KSEIPTTHFQSRYPSVVGFFFV-SSLTGKGVKELHDKIIEET-----KGQPYIGELVPNAWLRFEKELISQRSSA----DYLNWEAVKKLANNNAIY--DGEINQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVK--------NSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFI------------IWQNGSLLNKNDDKALL---TKLN-------DTTLRVCARGFWPENILFIVHEMFETLISEAFSGV 6722
            P L  L LS   L      I ++  +L++L ++GN I E+   LC+  L       N++     D + +   L+  S     LS  P +  Q   +S +KLS   +++I     +L ++   D  N    H+ G +    L   EI    N       S    + SR E+       S  + +E P EI    N+ +   S N      PDE+  L  +    +DG   L I   ++G        C+  D ++       +Q ++  + Y            R K+++VG  G+GKT+L++ L     C   +   E  T GID+  W     G+I  + +L  WDFAGQ  +Y +H  F+T +A+YL+++++ +G  E   +  WL ++   A S+P+ +VGTH D  D           K E+   H     PS+  + FV +S     + +L   II E      + QP +G+L+P+++L  EK+++++R +       ++ E + ++   + ++  + E+  A+ FL++ G + +FE P   L+D   ++ QWL  ++A +++V+          II    +E    K    K+P++      +L E F +   + G++   IP  L + +P    P       +      Y+  Y P G ++R   RL + S   +             W+ G  LN + +   L   TKL+         T+  C +G     +L  V +  ++L+ E F G+
Sbjct: 1041 PNLKQLNLSYNQLMSFPENIGNITQNLEELIMEGNNISEIHIPLCLPELHTINLNKNSIHFLATDFLKDCVKLETFSATTNLLSIAP-NLPQ--KISAVKLSHNKVTNI--PTEILHLRSI-DLSNNQIAHLPGPLEWTSLNLREIILNHNHISVLNLSKDACSWSRLEKLHL----SYNKIKEIPPEIGFLENITSFDISYNPDLRTFPDEMGKLTKIWDLPLDGLC-LDIDLKHIG--------CKAKDLIR-----FLQQRLKKAVPY-----------NRMKVLIVGNTGSGKTTLVQQLMK---CRRLEHGAEKATVGIDVKDWPILIRGKIKKEITLNVWDFAGQEEFYCSHPHFMTPQALYLVVYDLSKGVSEVDAIKPWLFNIKARASSSPVILVGTHLDVSDEKCQKACISKIKQELCNQH---GLPSIREYHFVNASEESDLLAKLRKTIIRECLNFKIREQPVLGQLIPDSYLELEKKILNERKNVPLEFPVISHERMLEIVEESQLHLDENELTHAVHFLNESGVLLHFEDPALQLRDLYFVDPQWLCKIIAQILTVRADGCQKYPKGIIHCNDVERFLEK--KKKFPKNYMSQYFKLLEKFQIALPL-GEDQLLIPSSLSDHRPVIELPH---CENSEVIIRLYEMSYFPMGFWSRLINRLLEVSTYMLSGRERAQRPNRMYWRQGIYLNWSPEAYCLVESTKLDRNPNSFLKVTVPSCRKGCI---LLGQVVDHIDSLMEEWFPGL 1750          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Lrrk2 (leucine-rich repeat kinase 2 [Source:MGI Symbol;Acc:MGI:1913975])

HSP 1 Score: 165.236 bits (417), Expect = 9.537e-40
Identity = 180/711 (25.32%), Postives = 328/711 (46.13%), Query Frame = 3
Query: 4635 SWIIYLPKLSSLTLSNCGLHEIGPEII---HLK-DSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLP----------KSFSQLAN-----------LSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVL---QEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHC-TNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILS--------SYVGTLPLEVLSCQNCDNLKTPPYEIRRQG--MRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTK---TGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQG-FEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDK-------SEIPTTHFQSR-YPSVVGFFFVSSL-TGKGVKELHDKIIEET-----KGQPYIGELVPNAWLRFEKELISQRSSA----DYLNWEAVKKLANNNAIY--DGEINQAIRFLHDLGSIQYFEFPLLK--DFVIINSQWLVDVMACVVSVKNSIIENGKLEHSK-------IKLVWSK---YPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFS 6542
            S+++ +P++++L  S    ++IGP ++    +K  SLKQL+L  N +  +PE L          L      S   +  +LK LK L++ +  +  LP          +SFS   N           +++LKLS  S + I    ++ S+       + +H N + L      +  NL E   S + +               ST  F E P    H  + ++ L  S+     +P EI  L+NL    +D   NL++ S        S +  LPL+ L            ++ +  G   +++I +L + +  +    R KLM+VG  G+GKT+L++ L       P++  +  T GID+  WS +       +L  ++WDFAG+  +Y+TH  F+T RA+YL ++++ +G  E   +  WL ++   A S+P+ +VGTH D  D+       S+I       R +P++  + FV++      + +L   II E+     + QP +G+L+P+ ++  EK ++S+R +       +N + + +L N + +   + E+  A+ FL++ G + +F+ P L+  D   +  +WL  VMA +++VK     +G L+H K       ++   SK   +P++      +L E F +   + G+E+  +P  L + +P    P       +      Y+  Y P G ++R   RL + S
Sbjct: 1052 SFVLKMPRITNLDASR---NDIGPTVVLDPAMKCPSLKQLNLSYNQLSSIPENLAQVVEKLEQLLLEGNKISGICSPLSLKELKILNLSKNHIPSLPGDFLEACSKVESFSARMNFLAAMPALPSSITSLKLSQNSFTCI--PEAIFSLPHLRSL-DMSHNNIECLPGPAHWKSLNLRELIFSKNQI---------------STLDFSENP----HVWSRVEKLHLSHNKLKEIPPEIGCLENLTS--LDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLN---------FDFKHVGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKMK--KPELGMQGATVGIDVRDWSIQIRGKRRKDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACISKITKELLNKRGFPTIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVNEHQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVK----VDGCLKHPKGIISRRDVEKFLSKKKRFPKNYMMQYFKLLEKFQIALPI-GEEYLLVPSSLSDHRPVIELPH---CENSEIIIRLYEMPYFPMGFWSRLINRLLEIS 1716          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Lrrk1 (leucine-rich repeat kinase 1 [Source:MGI Symbol;Acc:MGI:2142227])

HSP 1 Score: 117.472 bits (293), Expect = 2.289e-25
Identity = 150/647 (23.18%), Postives = 273/647 (42.19%), Query Frame = 3
Query: 4644 IYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNL--KFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSI--FNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLP-LEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSW------STKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEH-AGLDFWLNSVTCHAPSAPIFIVGTHSDKVDK----SEIPTTHFQ----SRYPSVVGFFFVSSLTGKGVKELHDKIIEETKG---------------------QPYIGELVPNAWLRFEKELISQ---RSSADYLNWEAVKKLAN------NNAIYDGE-INQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVKN--SIIENGKLEHSKIK--LVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNK 6413
            I L KL  L L++  L E+  + +H   SL  L++  N ++  P+       L   + +   + SLPD +       L+        L  +P    QL  L  L+L G  + S+    K +   +K      N+   N   L+ + I +LF +          +   EF A   ES                L+ L  ++     VP  +  LKNL +  +     L+ L   +G L  L  L  ++  N+   P E+R++G +  +++L   +  +E C   K++LVG    GK++L+  L      APQ+A    T  I    W       +K    ++++++WD  G       +Q F T +A+Y+++WN+  G E  A L FWL ++   AP+A + +VGTH D ++       I T         R PS         +T K + E+  K +E  +G                     Q   G L+P +++  ++ ++++   RS  D + +   ++L         N I D E +  AI FL + G++ +F      L++   ++  WL + +  + ++K   S+ +NG ++   ++  LV + + +   +   +    F++   V    +  +P LLP+K
Sbjct:  377 IGLRKLQELDLADNRLTELPVQFMHSFKSLTSLNVSRNNLKSFPDPWSC--PLKCCKASKNALESLPDKMAVFWKSHLRDADFSENSLKEVPLGLFQLDALMFLRLQGNQLLSLPPQEKWTCTQLKTLDLSRNQLGKNEDGLKTKRI-SLFTTRGRQRSGTETASMLEFPAFLSES----------------LEVLCLNDNHLDAVPPSVCLLKNLSELYLGNNPGLRELPPELGQLGNLWQLDIEDL-NISNVPAEVRKEGPKATLSFLRAQLRKAEKCKLMKMILVGPPRQGKSTLLEILQTGK--APQLAHSEAT--IRTTKWELQRPAGSKAKVESVEFNVWDIGGPASMATVNQCFFTDKALYVVVWNLALGEEAVANLQFWLLNIEAKAPNAVVLVVGTHLDLIEAKFRVERIATLRAYVLALCRSPSGSRATGFPDITFKHLHEISCKNLEGQEGLRQLIFHVTCNMKDVGSTIGCQKLAGRLIPRSYISLQEAVLAEQQRRSLGDQVQYLTDRQLDQLVEQTPGNDIKDYEDLQSAISFLIETGTLLHFPDTSHGLRNLYFLDPIWLSECLQRIFNIKGSRSVAKNGVIQAEDLRMLLVGTGFTQQTEEQYFQFLAKFEIALPVANDSY-LLPHLLPSK 998          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:MGI Symbol;Acc:MGI:1098644])

HSP 1 Score: 91.2781 bits (225), Expect = 1.349e-17
Identity = 92/352 (26.14%), Postives = 150/352 (42.61%), Query Frame = 3
Query: 4842 PDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCY-RTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEA----------ITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFE----HAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEI 5852
            P++I  L+ LK L +   +L  LP+ F +LA+L +L L    + ++ ++ S L   +  +  +               NLFE   ++  +L  +  EE     + S  +    P  I     L TL   N     +PD I  L  L++ V+ G   + +L    G L    L     + L  PPYE+  +G+  + AY   L         R KL+L+G   AGKT L   LT       Q   +            + GI++ SW+       L++ ++D AG   Y     FFL+  A+Y+L+ N+   +E       +  +L+ V    P A + IVGTH+D   + E+
Sbjct:   22 PEDISALRALKILWLSGAELGTLPRGFCELASLESLMLDNNGLQALPDEFSRLQRLKMLNLSS---------------NLFEEFPAA--LLPLAGLEEL----YLSRNQLTSVPSLIAGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQG-NQIAVLPDNFGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEDKVEGGQGGGDKEKSYLPFPPLGSKGIEVTSWTADASR-GLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNLAT-YEPRCFPTTVGSFLHRVGARVPHAVVCIVGTHADLCGEREL 349          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:MGI Symbol;Acc:MGI:1098644])

HSP 1 Score: 88.9669 bits (219), Expect = 9.401e-17
Identity = 112/449 (24.94%), Postives = 181/449 (40.31%), Query Frame = 3
Query: 4659 LSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLS-----------------------GLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFE--STTSSDGVLNRSR--FEEFRAL---------FFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCY-RTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEA----------ITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFE----HAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEI 5852
            L+ L +S+  L  +G E++     L++L+L  N +  +P  L   + L  L+++   ++ LPD+   L  L+ L ++  +L+                       GLP+  S L  L  L LSG  + ++              FC    +   +L    +  L +  S      +LN S   FEEF A           + S  +    P  I     L TL   N     +PD I  L  L++ V+ G   + +L    G L    L     + L  PPYE+  +G+  + AY   L         R KL+L+G   AGKT L   LT       Q   +            + GI++ SW+       L++ ++D AG   Y     FFL+  A+Y+L+ N+   +E       +  +L+ V    P A + IVGTH+D   + E+
Sbjct:  109 LTELDVSHNRLTILGAEVVSALRELRKLNLSHNQLPALPAQLGALAHLEELDVSFNRLAHLPDSFSCLNHLRTLDVDHNQLTAFPQQLLQLAALEELDVSSNRLRGLPEDISALRALKILWLSGAELGTLPR-----------GFCELASLESLMLDNNGLQALPDEFSRLQRLKMLNLSSNLFEEFPAALLPLAGLEELYLSRNQLTSVPSLIAGLGRLLTLWLDNNRIRYLPDSIVELTGLEELVLQG-NQIAVLPDNFGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVQPRLKLLLMGHKAAGKTLLRHCLTEDKVEGGQGGGDKEKSYLPFPPLGSKGIEVTSWTADASR-GLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNLAT-YEPRCFPTTVGSFLHRVGARVPHAVVCIVGTHADLCGEREL 543          
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Match: Rab40c (Rab40C, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:2183454])

HSP 1 Score: 58.9214 bits (141), Expect = 3.049e-8
Identity = 40/157 (25.48%), Postives = 71/157 (45.22%), Query Frame = 3
Query: 5469 YRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQS-RYPSVVGFFFVSSLTGKGVKE 5936
            Y  K +LVG    GK  ++ +L +    +P     A ++GID  + +       ++  LWD +GQ  +    + +  G    LL++++   +   G+D W+  +  HAP  P  +VG       K ++PT   ++    + + FF VS L    V E
Sbjct:   13 YLLKFLLVGDSDVGKGEILESLQDGAAESPY----AYSNGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIE 165          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q55E58|PATS1_DICDI (Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum OX=44689 GN=pats1 PE=3 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 2.359e-72
Identity = 240/813 (29.52%), Postives = 391/813 (48.09%), Query Frame = 3
Query: 4572 ALVTCTKLRKLEVDFGTMINI---SWIIYLPKLSSLT---LSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDN-IG---NLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSR--FEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSW-----------STKTGEI-----NLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQS---------RYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFE---KELISQRSSADYLNWEAVKKLANNNAIYD-GEINQAIRFLHDLGSIQYF-EFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVW--SKYPESIHKWLLRLTEIFDLTFSVPGQEFNF------IPCLLPNKQPEFSWPEFVDFNQ-TREANMFYQFEYLPPGLFNRAQVRLSQFS--DSFIIWQNGSLLNKNDDKALLTKLNDT--TLRVCARGFWPENILFI-VHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQC 6842
            +L +  KL KL  +  ++ N+   + ++   KL+SLT   LS+  L ++  E      SLK+L L  N    +PE+L M   L  L+L+   +SS  ++ +G    L  L  L++ +T++  LPK F  L +L  L L        FN    L            H   Q+   EE+   F S T     L R        + L  E   + +  P EI   + L  L         +P  I  L  L    ++  + L  L   +G L   V    +   LKTPP EI   G+++++ YL  L+ G E CY+ KLM+VG    GKT+L++ L  K   A        TDGI I+ W           +++ G +     ++  S+WDFAGQ +YY THQFFL+ R++Y++ WN     E + ++FWL S+T  A  API IVGTH D V+++   T   Q          RY ++     VS  +GKG+  L +K+    + Q  +GE +P +++  E   KE   +R     + W    ++     I D  E+ +A  FLH LGS+ YF + P LK FVI++ QW+  +++ +++ K+S  ++G L H  +K +W   +YP  +H  L+ L E F++++++     +F      IP LL N +P      +  FNQ  R+    YQFE++P G F+R  VR+  F+  ++   W+NG +L ++D++ +  ++N+   +L    RG      L   V E  ++L+ ++F    Y + + C  CI    P+ + F   + + A    T +++C
Sbjct: 1433 SLSSLVKLEKLSFEENSITNLPIETVVLLAEKLTSLTELNLSSNQLIDLPIEFSMFSKSLKKLHLKNNRFSAIPEVLGMLENLIELDLSELDLSSSTNSGVGIPTKLSKLCILNLNQTRIVELPKEFGDLKSLEKLYLD-------FNSLVTLP-----------HSFRQLTNLEELSLSFNSMTE----LPREVCFLINLKKLMIEGN-QIQFLPNEISQLSKLMILNVCKNKLDSLPASIGQLSQLVSLNLNNNSQLVSLRPTMGLLSNLVELKLDGTRLKTPPPEIVSLGLKSILLYLKDLIKGQEQCYKMKLMIVGQENVGKTTLLKTLKEKKKKATPSGPNISTDGIAIDQWVFSCLFEELDETSQNGRLIKKKQDITLSIWDFAGQEIYYTTHQFFLSERSVYIVAWNCALAEEESRVEFWLQSITTRAKDAPIIIVGTHLDDVNRT---TAKMQKKRMKEKYLIRYQNIKAIKLVSCTSGKGITSLREKLEALVQSQSNMGESLPRSYMLLENLVKEETKKR-IIPTIPWTEFIQMGTICTITDEAELLRATMFLHQLGSLVYFPKEPGLKQFVILDPQWITTMLSSIITTKHSYAKDGILNHKSLKQIWRPPQYPTHLHPHLISLLEKFEISYNLSPDSTSFETGTSLIPSLLLNDRPAIFPSLWGSFNQLVRQFGRIYQFEFVPNGFFSRLMVRILNFARVEAKCYWKNGMIL-QHDEETIFLEMNNAKKSLSFTVRGGANSTTLSRDVIETIQSLLDDSFQLPTYVF-VPCFHCIFLSLPQCYYFPLDVCENAAVKGTGYLKC 2216          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8MVR1|GBPC_DICDI (Cyclic GMP-binding protein C OS=Dictyostelium discoideum OX=44689 GN=gbpC PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 4.238e-46
Identity = 160/632 (25.32%), Postives = 283/632 (44.78%), Query Frame = 3
Query: 5187 EILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDG-----------CANLQILSSYVGTLPLEVLSCQNCDNLKT----------PPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKN-------FCAPQIAEEAITDGIDINSWSTKTGEIN-------LQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDK-------SEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELI--SQRSSADYLNWEAVKKLANNNAIYDG-EINQAIRFLHDLGSIQYF---EFPLLKDFVIINSQWLVDVMACVVSVKNSIIE-NGKLEHSKIKLVWSK--YPESIHKWLLRLTEIFDLTFSVPGQEF---------------NFIPCLLP-NKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKL------NDTT----LRVCARGFW-PENILFIVHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHR 6848
            +I     LQ L+  N     +P  I  L NLK+  +D             + L++LS     L L   S  +  +LKT          PP  +  +G+++++++L  L +G+  C R+KL+++G  G GKTS+++ +  K                     GI+I+ +               +  S WD A Q +Y+ + Q F + R++Y++++N+    + + +++WL+ +   +P++PI +VGTH D  +         E   + FQ R+ ++     VS  TG  V +L   I +  K QPY+ E VP+++   E+ LI   ++     + W+    LAN   + D  +I +A  FLH++GSI YF       +   VI++ QW+++ M+ +++ K  I   NG +  S ++LVW    YPE +H  LL + + F++  S+   +                N +P LL  N      W +F+D + T   N  Y   +LP   F +  + L  F+      +   +L   D+   L +L       D T    L V  RG   P ++L IV +  E+L S+ +  +  +  ISC +C    +  P +F     + A       + C++
Sbjct:  213 DIGKLQQLQVLVLENNRLINLPQSIGDLVNLKRLEVDNNHLVSLCSLERLSKLEVLSVNNNKLTLLPTSIASLSSLKTLNIKSNPIITPPSTVVSKGLKDIVSFLRELETGARPCLRSKLVVLGDPGVGKTSVVQCMKGKKKKTNVTSSSINIGGSSGSEVGIEIDQYDFDVVFDEDDKKRRVITLSTWDIANQDVYFASSQLFDSERSVYIVVFNLNND-DFSAIEYWLHCIMSTSPNSPIVLVGTHIDAFENLNVVNAVLESVASRFQKRFTNIQAIISVSCTTGYDVDKLRQLIEDIIKTQPYLKEKVPSSFFTLEEALIEVKKKRIPPVMMWQEYINLANICNLKDSVQIQRATEFLHNIGSIVYFNDLNSSTVGKMVILDQQWIINCMSSLITSKLLINNCNGIVRQSDLELVWKAPTYPEHLHPALLSIMQAFEICRSLSPSDLVRPEEVNEKEVMGDRNLVPNLLSDNTNIVAQWDDFIDPD-TILLNRQYHLPFLPEKFFGKLIIHLMNFTKVESCQKRAVILRNQDNHEALIELKTIKDNKDGTFKKILTVDVRGLVSPVSLLRIVTDTIESLFSQWYK-LDIKRYISCYECAILYDRNPTLFTIEECELAVIDGKTVLTCNQ 841          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6XHB2|ROCO4_DICDI (Probable serine/threonine-protein kinase roco4 OS=Dictyostelium discoideum OX=44689 GN=roco4 PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 9.471e-46
Identity = 150/533 (28.14%), Postives = 263/533 (49.34%), Query Frame = 3
Query: 5157 STPRFREFPVEILH-CTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDG--CANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLV--SGSETCYRTKLMLVGLGGAGKTSLMRAL--TNKNFCAPQIAEEAI-TDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSA--PIFIVGTHSD-----KVDKSEIPTTHFQSRYPSVV--GFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSAD----------------------------YLNWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVW-SKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLP-NKQPEFS------W---PEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFI--IWQNGSLLN 6581
            S      FP+ I   CT+L  L  S+   + +P +IQ LK+L+  ++ G    ++ +   Y+G L +  L     +N    P  + + G +N++ +   ++    SET  + KLM VG  G GKTSL +AL  + K     Q+  + + T+G+ I +   K     +++  WDF GQ ++Y THQFFLT  A+YL+++ +        +++W+  V  ++  A   IF+VGTHSD     ++ ++E        +Y  V      FV   TGKG+KEL  ++I E +    I + +P  ++  E  L ++ ++                              Y++++        + +   EI  A  FLH+LG I +F+ P LK+ V+++ QWL DVM+ +++  ++ I+ G L HS++  VW  KY +S+   LL+L E F++++ +P    + IP LLP + + E S      W   P+ ++  + +     Y F+++P G F R  +R+   S   +   W+NG LL+
Sbjct:  263 SRSNLSRFPMSITQMCTHLVELDLSDNKITELPKDIQLLKSLRILILRGNLLEDIPLEICYLGDLKILELQENPLNNF---PLSVVQSGTKNLLLFCKNILERKKSETWNKVKLMFVGQEGVGKTSLCQALKGSKKKKAELQVTGDTVSTEGVKIQNIKNK----KVEFHAWDFGGQQVFYPTHQFFLTTHALYLVVFKLTDPNFAERVNYWVRQVKSNSSGAVPAIFLVGTHSDVCTPEQLQEAESILKANFVKYSRVKENTINFVCCATGKGIKELKKRLIHEAEKSHLIKKDIPGNYMVLEARLTNRGANPGRMAVSGSPIGGGSSAQLSSNAINSQKERYIDYDDYMNECKLSHLQPEEIKGATDFLHNLGIILHFDTPTLKNLVVLDPQWLADVMSSLITFSHNWIKRGILNHSELVAVWGGKYDQSLWPLLLKLLEKFEVSYELPNIAKSLIPSLLPEDAEGEISTIKDREWVTLPQAIESGRCQVFGCDYNFDFMPLGFFARLLLRILLISGVEVRTYWRNGVLLD 788          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q1ZXD6|ROCO5_DICDI (Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum OX=44689 GN=roco5 PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 4.889e-40
Identity = 166/653 (25.42%), Postives = 288/653 (44.10%), Query Frame = 3
Query: 4731 LKQLSLDGNPIREVP-EILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEE---------EIFNLFESTTSSDGVLNRSRFEEFRALFFESTP----------------------------------RFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVI-------DGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNK-------------------------------NFCAPQ------IAEEAITDGIDINSWSTKTGEIN--LQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWN--VRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDK----VDKSEIPTTHFQSRY----PSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQR--SSADYLNWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWS--KYPESIHKWLLRLTEIFDLTFSVP 6371
            LK+L LD N I  +P  IL     L  L+L+N  +SSLP  I  +K LK L++    LS LP     L  L+ L +S       FN    +++   S       +N +VL  +         EIF   +S  S   +     F   +   +E+                                    R ++ P +I   ++LQTL  SN     +P ++  L  LK   I       DG +N +I      ++P +VLS  +               +  ++ YL    +  + C R KLMLVG    GKTS+ + L  +                               +F APQ       +    TDGI+++ W   + + +  + +S+WDFAGQ +YY+THQFF++ R++++++++  V    E + + +WL  +     ++P+ +VGTH D     VD ++I T    S+Y    P+V  F  VS  +GK + +L + I++  K +  +G+L   ++ + E  ++S+R  ++   +      ++A +  I    I  A  FL +LG I YF+ P   L  F+ I+  WL  +MA +++ K + +++G L+ S +  +W    +P+ +H  LL + + F++   +P
Sbjct:  987 LKELYLDHNCISSIPVSILKELKNLQILDLSNNQLSSLPSEISEMKELKLLNVSHNNLSSLPIELGTLCKLNHLDIS-------FNFIETINVNSLSQL-----VNLKVLMMQRNYFNRLPIEIFTRLKSLESF-SIAGSPCFHPIKQRIYEAIAIKATKLDLSDCGLSALPIEIGSISSLIELDLTNNRIKDLPPQIGKLSSLQTLNLSNNAIESLPWQLSQLTTLKVLNITGNPISFDGASNAKI------SIP-DVLSGDD---------------LIGILKYLKLASTKEKPCMRMKLMLVGQENVGKTSIAKCLKKEIIPVGKKLRQTIGLGTKKSKTPTLTEANGSIDFNAPQSINPLNTSLNISTDGINMDDWRPPSEDQSPPVTFSIWDFAGQEVYYSTHQFFISSRSVFIVVFDMSVYNPDETSRVPYWLQCIEAFGGNSPVILVGTHLDDLPNGVDVNQI-TQDIHSKYFTKFPNVKFFLPVSCKSGKNINKLQNHIVKLGKAEKKLGDLFSRSYFQLENLILSEREMNTPPIITLSEFTEMAISCGIPQTSITAAADFLKELGVIVYFDDPKSGLDQFIFIDPPWLTRLMATIITSKPNFVQSGVLDQSNLHQIWKPPDFPQHLHHVLLAILQKFEIVHPLP 1603          
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5S006|LRRK2_MOUSE (Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus OX=10090 GN=Lrrk2 PE=1 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 6.671e-39
Identity = 180/711 (25.32%), Postives = 328/711 (46.13%), Query Frame = 3
Query: 4635 SWIIYLPKLSSLTLSNCGLHEIGPEII---HLK-DSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLP----------KSFSQLAN-----------LSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVL---QEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHC-TNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILS--------SYVGTLPLEVLSCQNCDNLKTPPYEIRRQG--MRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTK---TGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQG-FEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDK-------SEIPTTHFQSR-YPSVVGFFFVSSL-TGKGVKELHDKIIEET-----KGQPYIGELVPNAWLRFEKELISQRSSA----DYLNWEAVKKLANNNAIY--DGEINQAIRFLHDLGSIQYFEFPLLK--DFVIINSQWLVDVMACVVSVKNSIIENGKLEHSK-------IKLVWSK---YPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFS 6542
            S+++ +P++++L  S    ++IGP ++    +K  SLKQL+L  N +  +PE L          L      S   +  +LK LK L++ +  +  LP          +SFS   N           +++LKLS  S + I    ++ S+       + +H N + L      +  NL E   S + +               ST  F E P    H  + ++ L  S+     +P EI  L+NL    +D   NL++ S        S +  LPL+ L            ++ +  G   +++I +L + +  +    R KLM+VG  G+GKT+L++ L       P++  +  T GID+  WS +       +L  ++WDFAG+  +Y+TH  F+T RA+YL ++++ +G  E   +  WL ++   A S+P+ +VGTH D  D+       S+I       R +P++  + FV++      + +L   II E+     + QP +G+L+P+ ++  EK ++S+R +       +N + + +L N + +   + E+  A+ FL++ G + +F+ P L+  D   +  +WL  VMA +++VK     +G L+H K       ++   SK   +P++      +L E F +   + G+E+  +P  L + +P    P       +      Y+  Y P G ++R   RL + S
Sbjct: 1052 SFVLKMPRITNLDASR---NDIGPTVVLDPAMKCPSLKQLNLSYNQLSSIPENLAQVVEKLEQLLLEGNKISGICSPLSLKELKILNLSKNHIPSLPGDFLEACSKVESFSARMNFLAAMPALPSSITSLKLSQNSFTCI--PEAIFSLPHLRSL-DMSHNNIECLPGPAHWKSLNLRELIFSKNQI---------------STLDFSENP----HVWSRVEKLHLSHNKLKEIPPEIGCLENLTS--LDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLN---------FDFKHVGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKMK--KPELGMQGATVGIDVRDWSIQIRGKRRKDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACISKITKELLNKRGFPTIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVNEHQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVK----VDGCLKHPKGIISRRDVEKFLSKKKRFPKNYMMQYFKLLEKFQIALPI-GEEYLLVPSSLSDHRPVIELPH---CENSEIIIRLYEMPYFPMGFWSRLINRLLEIS 1716          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: R7TDS1 (Roc domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_187033 PE=4 SV=1)

HSP 1 Score: 979.548 bits (2531), Expect = 0.000e+0
Identity = 583/1585 (36.78%), Postives = 877/1585 (55.33%), Query Frame = 3
Query: 3954 HRLCPGNLWR-NYLRDMHPMNETPYQMT-EGEARYFFQGDFILDVFTIIKNFTTSFSAVYQHIDQCFPEIDPDIDKGFLRDAIISISKAYRDIILFDIVAKIQVYSNNIMFVDKNGDNILSTXXXXXXXXXXPQLAPI--SSELNGEYFTLS---WTEEEMENIQEMFQKKYSVCESHKLSTKVMQVSDL--------GSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFGTMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSG-PSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFE-STTSSDGVLNRSRFEEFRALFFESTPRFRE---------FPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYL-NWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLHKNQYNVWCEPLIEGTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARI--DKNYTDGALGLETAGDKYINFERVNVYDQKFSELLHDLRTQLDEPDSKTTVVPKPRVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIG-LSVYSDITSGLRNSEIMVACLSTE------YAQSDACKKEFMFARQNLNLPIVIAEVGCSQEWIKTEIGLLSIEYPKIQFQTSNPSAFEDIFQLVSNKIPSVAPN------GETESNLVKMNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFXXXXXXXXXXXXXXXXLMSTNP----------LFNGHLLSSNTPNM---SLCFKILCESESGWHTVDDGIPINLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWS---YMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNLPYISVIE 8534
            H LC GN W  N L D H M   PYQ++ E      +  + ++  +  + N T              P   P +    L +++        D IL  +   + V     + V K         K+K +    P LA +  S+E +G Y  ++      +++ N+Q         C  H    K     D+         ++ + + ++ I  +  DN+ E  L     L+ L +   ++ ++  I    ++S L LSN  L EI  E+  LKDSL+ + L G+PIR +PE L  F  L  L+L+ +LIS LP+N G+L  L+ L +    L+ LP SF +L NL  L L G P  ++   K      KE   F  +  +  Q +  + +  LF+ +    DG+L +     FR + FE  PRF+           P  I     L++L  + QG   +P +I+ L +L    +  C NL  L + +G  PL VL    CD L TPP EIR QG R +++Y+ RL  GS  CYRTKLM VGLGGAGKTSLMRAL + ++ APQ+  E ITDGIDI +WS K  +++L +S+WDFAGQT+YYNTHQFFL+ RA+Y+L+WN R GFEH+GLDFWL+S++CH P AP+FI+GTH+D++  +++P    + RYP++ GF+  S++TGKG+ ++ D ++  T  QPYIGE+VP AWL  EK ++S+R +   L  W  ++ +A  N+I   EI QA+ FLH+LG++Q+F   LL+D V+IN QW+VDVMAC+VSV N++I++G+L+H  +  +W  Y + +H WLLRLTEIFDLTF +  +  N +PCLLP+ +PE+ WP   +     E+ + Y F+YLP GLFNRAQVRL QFSDS  IW++GS+L KN   AL+ +LN T + V A G WPENIL +VHE+FE+LISE+FSGVKYE+ + C  C+     +P +F+  IL+RA + K +F+QCH  FH+++++++Q + PP S  DY+LQ + ++  + + +E   +   I+    D  +D   ++  KR+V DL       W    +      +    L  S+ V+  IS +F  +  C  +F+     L+K  +L  +   K +    +G++     Y+NF+R N+Y +K +EL   ++ +L    SK     +  VFISYCW NS  A  +G      ++A+G GDPR +   +   GLS WLD+E  G L ++ DI  G++ S++++AC+S E      YA S  C+ EF FA   L  PI++A VG   +W  TE+G+LS+ YPKI FQ +N  A +D+ Q +  K+            G+TE       K A +E +EL QRK  R L S +  E+   YP L   D+  +  +         S +P          L  G  L+  T ++     C K+LCE E GWH+VDDGIP++L   +L RL    SPY+ R+  +LK S  + + +  +E  +++ K + +       SWS    MK ++  LR +++ +D  +  G L+ C L +GK +WLC EH  LP I+V+E
Sbjct: 1277 HFLCKGNQWNTNKLGDSHFMPLKPYQLSSEDLPNVDYHSEMLITTYFALDNQTC-----------ILPSPSPCVTFPKLAESV------KEDEILEGLWRMMHVLRCTFVLVQKASSADQKRLKKKDRDALVPFLAELTTSAEESGHYKEIAKNCVKAKKLVNLQR--------CVLHTNIAKPGPFKDMLRKQLQGDETFTKNVKHVEIAHTLTDNL-EIILRKFPSLKSLSLTHCSIKSLCPIKLSVQISQLNLSNNLLSEIPSELFVLKDSLENMDLSGSPIRLIPEFLMKFPRLTRLDLSRSLISELPENFGDLSNLEVLIMAACPLTALPDSFCKLKNLRILALDGVPWCTTKTLKDDETLSKENCKFFQEYPVY-QRMGIKALDALFDKADVLRDGILQKEELIAFRKMLFEKIPRFQATSENDPNGGIPAPIFRLKKLKSLSLNFQGIRCIPHQIEKLTDLTMLSVRHCPNLLTLGNGLGKCPLNVLDIDACDALHTPPKEIREQGNRIILSYIKRLSLGSSACYRTKLMYVGLGGAGKTSLMRALMSADYKAPQVQGEGITDGIDITNWSVKKEDVSLVFSVWDFAGQTIYYNTHQFFLSSRAVYMLVWNTRLGFEHSGLDFWLSSISCHCPKAPVFIIGTHADQITNADLPEAALRKRYPNIKGFYSTSAVTGKGINDVFDHLLLVTLEQPYIGEMVPEAWLNLEKTILSERGNRKSLIKWSDIESMAQTNSILGSEIIQAVNFLHELGTLQHFNNDLLRDRVVINPQWIVDVMACIVSVHNTLIKDGRLKHEDVGTIWKDYSQELHNWLLRLTEIFDLTFPLSDKAENIVPCLLPDTEPEYPWPNAQE--GCSESKIVYHFDYLPAGLFNRAQVRLYQFSDSSAIWKSGSILMKNGHHALVKQLNATDVLVKANGPWPENILLLVHEVFESLISESFSGVKYEFMMPCMSCMKSTSRDPAMFSSKILRRALEMKALFLQCHAFFHVLSISDVQNTMPPQSSADYNLQLENAMRDLDSLQEDIMYDCSIIYCMKDALDDPERIH-PKRIVDDLQTEGIRCWYAENLHEMNIQEVSASLADSKIVLVCISDDFVLDGHCQRMFQFVNSGLKKEFLLLMVGHGKEWAQSDIGMQLVYKVYVNFQRQNLYQEKLTELQGQIQGKLKR--SKGGQQGQWDVFISYCWTNSAEAVAAGTKA--KESALGHGDPRKLAKALADHGLSYWLDIECAGKLGLFEDIAEGMKRSKVIIACVSDEVSIAFNYATSPNCQMEFRFAHVALRKPIILAIVGTGFKWQSTEVGMLSLAYPKINFQMANQYAHQDLLQNIKEKLDQDVDKSTSVHLGDTE------QKSAYEELYELAQRKFLRQLVSYV--EDLDPYPHLIVADLNYDPNQALSNE----SNDPDEMDEESEEILEEGSKLTFVTDDLKPGQFCLKVLCEHEGGWHSVDDGIPVSLGGQDLVRLWEASSPYMLRMLSILKHSSADLV-VTRTEAGEKLIKLLQQ-----RNSWSSHKKMKDVYMMLRMYLLQKDAKMICGNLKKCYLPSGKHLWLCEEHQKLPRITVLE 2809          

HSP 2 Score: 72.0182 bits (175), Expect = 3.493e-8
Identity = 35/90 (38.89%), Postives = 56/90 (62.22%), Query Frame = 3
Query:  225 HFDFSGIDRLSDEVFFVLKEELKVTQKQNVEIIDLT--GCCHITDRGIEILSESFINLKELILDGCSQITQLSLYFLMENCSKLTKLSAK 488
            H +FSGID+L+DEVF +L++  K        I+ L+  GC  ITD GI    ++F NL+E++LDGC  +T+ S   ++ +C  ++ LS +
Sbjct:   44 HINFSGIDQLTDEVFILLRDAFKEKPDAAKGIVKLSCVGCSFITDEGILEAVQTFPNLEEVVLDGCKMLTEFSARHVLAHCDAISHLSMR 133          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A1S3JWY2 (uncharacterized protein LOC106176900 OS=Lingula unguis OX=7574 GN=LOC106176900 PE=4 SV=1)

HSP 1 Score: 936.021 bits (2418), Expect = 0.000e+0
Identity = 534/1391 (38.39%), Postives = 800/1391 (57.51%), Query Frame = 3
Query: 4548 EMDNVKETALVTCTKLRKLEVDFGT-MINISWIIYLPKLSS--------------------LTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSG-------PSISSIFNKRSV--LSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFRE-------FPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEIN-LQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANNNAIYDG-EINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQ-----NDSSLLNTSKRLVKDLHKNQYNVWCEPLIEGTPEDKYIDM-LTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDKN--YTDGALGLETAGDKYINFERVNVYDQKFSELLHDLRTQLDEPDSKTTVVPKPRVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGL-SVYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEWIKTEIGLLSIEYPKIQFQTSNPSAFEDIFQLVSNKIPSVAPNGETESNLVKMNKIAS------QEDFELIQRKIFRLLSSGIGSEESRLYPRLFFXX--XXXXXXXXXXXXXXLMSTNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPINLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSK--SWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNLPYISVIESEES 8546
            ++DN  + AL      R L++DF +  + ++ + +L   SS                    L ++    H +    + LKDSL+ L L  NP+ + P  L  F+ L+ L L NTLI  +PD+IGNL  L  L +  T +S LP SF++L NL  L + G       P   + F +  V   SIK+  D            Q   +   +++  ++ GVL      +FR   F   PRF+        FP  + HCT L++L F       +PD I+ L +L++  +D    L+ LS  VG LPL+ L  ++C  L TPP EI  +G    IAY+ RL  GS    +TKLM VGLGGAGKTSLMR+L + +F + QI  EAITDGIDIN W+ K G+   + YS+WDFAGQTLYYNTHQFFL+ RAIY+L+WN R G+EHAGLDFWL+S+ CHAP AP+FIVGTH+DK+ K++IP+   + ++PS+ GF+ VSSLTG+G+  L D+II  T  Q YIG+  P  W++FE  ++ QR +   L W+ V+ LA    I++  E+ QA+ FLHDLG++ +FE   L D V+IN QW+VDVMAC+VSV NS+I++G+L+HS I ++W  YPE +H+WLL+LTE+F+LTF +  +E + +PCLLP KQP+  WPE +D ++ RE  + YQF+YLP GLFNR QVRLS+FSD+  IW+ GS+L KN   ALL++ ++  + V A+G  PEN L +VHE+FE+LI E+F GV YEY + C  C+     +P +F+ ++L RA   K +F+QCH  FH +++ E+Q + PPDS + +DL F+ +V  +++ +++  +    L  + D +     + + + +   RLV    K  +  W  P    TP+ + +   +  S+  +  IS  F  +  C  LF+    +L+K  IL  +D N  +    +G++ A   Y+NF R +++++   EL+  LR +      K  V      FISYCW NS  A   G      + AIG GDPR+IK+++E+ G++CWLDVE +G   ++ DI  GL+N++++VAC+S EYA S  C+ EF FA   L  PI++A VG   +W  TE+G+LS+ Y K  FQ  + ++ + +   V  +I +     E  S++   +K ++      QE +EL QRKI R +S  +       YPRLF ID        +    +D  ++        +L   +  +  C ++LCE E GWH     + I L    L+    L SPYL RI  ++K S   ++  F+    +    +++++LE N+       MKP++  LR  +++ D++   GGL+ C   +GK+VWLC EH  LP +SV+  + S
Sbjct: 1516 QLDNSLQNALTKIPDYRTLDIDFESDSVAVTDLQHLQVSSSGLKIPDEQLPFKCGSLITLTLKMTTSDGHALPESFVQLKDSLRTLKLTDNPLEKFPGFLTQFTSLSVLVLANTLIQEVPDDIGNLLNLTKLDLTHTLVSNLPPSFAKLKNLRQLHIKGIKLPFKDPLHCTAFLEHDVQAYSIKDKFD------------QLSRLVKQYDA--NNKGVLTGQTLADFRKEAFSVFPRFKPGPGCEGGFPEVLFHCTKLRSLSFCRTAIQFLPDGIERLSHLEELNLDHNPYLESLSPKVGKLPLQKLMLESCPRLSTPPPEIIHRGAAQTIAYMKRLQMGSMKYNKTKLMFVGLGGAGKTSLMRSLMSNDFKSSQIEGEAITDGIDINMWTVKHGDQEPITYSVWDFAGQTLYYNTHQFFLSKRAIYVLVWNTRLGYEHAGLDFWLHSIACHAPKAPVFIVGTHADKIAKADIPSESIEKKFPSIAGFYTVSSLTGQGIDSLLDEIINVTMKQSYIGKQFPIPWIKFETAIMKQRGTKSVLLWQEVQNLAEMQGIHEAEEVTQAVGFLHDLGTLHHFENEFLSDKVVINPQWIVDVMACIVSVHNSVIKDGRLQHSDIGVIWKDYPEDLHQWLLKLTEVFNLTFPLSEEETSIVPCLLPQKQPQIDWPEKMDKDE-RELKIIYQFDYLPAGLFNRVQVRLSEFSDTSAIWKTGSILQKNGHLALLSQQDNNQVLVKAQGVRPENFLLLVHEIFESLIEESFQGVSYEYLLPCMDCLRSDAKDPTLFSSNVLHRAIDKKALFLQCHNFFHTLSIAEVQANMPPDSDDTFDLNFQDTVRDLNSLQDKLGYDACFLFCKQDLEKTDGCDAAPICDIEARLV----KAGFKCWL-PKATQTPDAELVATEIQTSKVALIFISCQFVKDSECQRLFQYVNDSLKKPFILLMVDPNRDWLKSDIGMQVAEKVYLNFSRPSLFEESMKELVSKLRLKT---KKKKGVSVASDCFISYCWTNSASALKMGQVFRPKEGAIGNGDPREIKEFLEKNGINCWLDVERVGENGLFEDIAEGLKNTKVVVACVSDEYALSANCQMEFRFAHVALRKPIILAVVGTGFQWAATEVGMLSLGYHKFNFQAPSETSHDQLLSAVREQIQATKAE-EAVSHVPTSSKTSANPSSAFQELYELAQRKILRQISGYVDDA----YPRLFLIDLCDNQSEGQNRPESDTEVAGTDESPKEVLKPTSDKVQYCLRLLCEYEGGWHCEGKPVAIPLVGEYLDMFFPLTSPYLARIMTVIKHS-SIDLNCFHGVQGE----HLLDMLEKNAGVVDVESMKPVYIYLRQFLINSDLDKTAGGLRRCQQASGKIVWLCPEHQELPRVSVLHYDTS 2873          

HSP 2 Score: 225.713 bits (574), Expect = 1.015e-54
Identity = 300/1247 (24.06%), Postives = 515/1247 (41.30%), Query Frame = 3
Query:  117 LNYKELFSDLDFEGSYPIEHFATVIPKVVG--TSRDIIHFDFSGIDRLSDEVFFVLKEELKVTQKQNVEIIDLTGCCHITDRGIEILSESFINLKELILDGCSQITQLSLYFLMENCSKLTKLSAKFTKISYISNIVDNRWG--------HESIMY-NSLFKENQFAENLPINLVVLVMDTSITCDIGHYLVTGKIRNRKTDQPII-FQPNAMNIN-------------ETNVNIIQL--FCPTVYMAPFITDRSLFIIATDLESDTSNAFNIIKGLDFIRGVVYCCPIQIFSF-------TSSPSI-EKLETLNKVLQSIFSDQQVNMKEHLDQEHYSKSVDKYFIDQWRYVQSL-----------SAIDPEHISLQLLGLYLNDSECNMNYYTTICEPSTNAKIEQTIADFYDTFVN-VRDALDRINKADISETKSYTKIPQGLEKLIQCL-IQLFHRTQT-------------------EFQFLNDPMLMTPFRDYKL--LTDDENPENSLNI-IKSFFDSKEDLTNNSRGWKLGTAFGLWIEAKWNICEKLAPLKNKLNEFQSMSKTRNDMKTPLELVSVNMKYMIKYMYQHLPSKPTDGISIVTGFIDKQHS-PIVTITDISKEISELTS-------VEISLVLDQLQTTGKVISLFSIG--LVIIKVEWFINAMNTILTNWNSPLNNDRVWFLTSQAVLSSIDELAQVLDETTDNELFQNLIKILKHYGLILSVH--RSWNTDPLNWEPVDSQDYFNKLLYVSWHQLSLKPDSNIHLVVNKPDLKSNKPSRVLHSVFPDYNTPEFNKDDIXXXXXXXXRIGIPCNLFCQVVSKISLNFRTILLWSQGILVREGAVEVLIFHNIHASRGSSSFDIESRIRGPINGRRPVAVREHKWSVLSEILTIIEAHIIEYPHLHHKIRHYCRGQCYKEFGQENTFSQAEVRKSLNCNYY-------CNKCREYQMSRS--------DWL-------------YILGRQMVLP-NH------------DFDKANNGSCRSCWKRKPFSQYLWKSQQKIFPTFGSKVFYSKANKGIKGNLI---------LSGSTESSIISKLKCMKNYLEKAEFQIIDPTNTFIIFFQKMGSSENELFKWDLEKGEITTELKQDIVANICNTKQGDTLGFHFLTEDLE------NPIMEIEKNHILFGKFNLIHNANIQIRIKVTPEEDESEKLKLIISSLDAGVVGAFHFRPGMILLLK 3443
            L++K L+ +L+ +  YP++ FA ++ K+    T    + FDFSGI++L+D VF V+ EEL  T ++ V+ +   GC H+TD G+  L+++F +L+ +  DGC  +T  SL +L   C+ L  +S   T + YI   + N           ++   Y NS F E Q         +V+            +L TGK      +Q +  F  + ++               E  +N+I+   +  +    PF T+ + F++  D  S       I+  +D IRG V   PI I          T++ SI E++  LN  L +       ++K+HL  EH+SK  ++ F  Q RY +SL            ++D + + +Q+ GL  N           + E       E+ + +F     N   D L  + K+DISE KSY+K P  + +  + L I L  R +T                    F FL D         Y+L  +T+++  E    I  + F +SK  + +N+     G AF +W+ A +    K+    +K +   ++ +        L  +S      +   ++         +     F+D   + P   I  + K +SEL            +  L +L   GKV+ L       V+  ++WF+N ++  L       N  RV  L+S+  L S+ +L  V+ E   +E F + + I+ H G +L +   R    DP           F   L+V      L+P   ++L     D  S K      + FP  N+ ++N DD+    S++F  G   +L  +++S   L    + +WS G+L R+GA+E+LI  N+HA   ++ FDIE+R   P  G++ + V ++ W+ LS  L I++ HI  +P LH KI   C+G+C  E    + FS  E  KSL  +++       C    E ++  +        DW              + L +    P NH             +  AN G CR C  +      LWK Q  + P+F ++    +  +  +G LI         ++     SI        +Y       +  P +  +   +K   S + +    LE GE++T               GD +      E L+       P +E+  N      F+ +  +   ++ + T     ++   + +      VV + HF PG +++ K
Sbjct:   43 LSWKALYENLEVKEYYPLKKFAALLKKLSSSLTQAAQLTFDFSGIEQLTDLVFCVMDEELN-TLRKGVKAVHCNGCIHLTDVGVFFLAKAFQDLEHVSFDGCPHLTDESLKYLQLFCTGLQHVSVSGTSVGYIPTSIGNACKITVDGCPLYDPAQYDNSTFNECQRESQGHERKLVVFRRQDCDYKFTEFLRTGKFERCDNEQELTQFGNDYLSNFSLSNSNSVSENDVEFLLNVIETKGYSMSSDSVPFTTESAAFVLLIDFNSADDLQLKIMNKIDVIRGHVNHAPIMIVILYEDSPGQTTAGSIEEQISRLNLDLDAQLKQTAESLKQHLAAEHWSKVNEEDFEYQERYKRSLYTAESRTVYTMVSVDVKTLKMQVYGLQSN-----------VIEEGQATSKEEELNEFLTNHWNRAMDKLQSLAKSDISELKSYSKPPVAVIECTRALCILLNQRPKTVEDSSDASKWWPTAKKLISSFSFLRD------MHSYELDTVTEEQMAEIEAYINDERFTESKIAVVSNA-----GVAFHVWVHAVYAY-GKIKYATSKESNVSNIIEYGQGAAFLLSRLSALCSNAVGMNFEQ-------SLEFSGPFMDISKAFPNHRICSLDKLVSELKEKPFGANLAAYAQALSRLDRMGKVVFLKDTPEQYVVTDIQWFLN-LSAQLYKIEGFKNLGRVKSLSSEESLLSMADLRNVIGELATDEEFSHWMSIMFHDGGMLKIPYCRLHPEDPP----------FLLALFV-----QLQPKPYLYLDGASKDRLSEK--YFHENYFPHLNSKDYNPDDLRVSLSYRFTNGYSGSLLGRIISDCLLLGDVMYIWSTGVLCRKGAMEILIKRNVHAVMVTNQFDIEARCTCPPGGQKNI-VLDYIWATLSTYLLIVDYHISRHPSLHVKITIPCQGKCASE-ATPHLFSPTEFPKSLQTSHFPVCPNQICGTTCELKLMHNYQPFLPYHDWCESYDPPHSCCWCDHCLSKGGQCPQNHIGSTWRCNCAAIGWKCANCGICRRCVAK------LWKMQSSLSPSFMAQ-HQDEQGQNFQGTLIDFNLLRKKSMASEEHFSIKHPGVLSHDYQTSIYLTVFKPGSMVLQVVEKQ--STDVIASVSLEAGEVST---------------GDKIKLQVTGEQLDEDQQSFQPYLEVLVND--RKTFSGLIPSGCGLKFQATESSSTTDLPVVTLHWPTVPVVTSRHFSPGQLVMFK 1212          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A1S3JRL1 (uncharacterized protein LOC106175255 OS=Lingula unguis OX=7574 GN=LOC106175255 PE=4 SV=1)

HSP 1 Score: 924.85 bits (2389), Expect = 0.000e+0
Identity = 534/1406 (37.98%), Postives = 786/1406 (55.90%), Query Frame = 3
Query: 4497 DLGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFGTM-INISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSG-PSISSIFNKRSVLSIKEWSDFCNKTHINGQV-LQEEEIFNLFES-TTSSDGVLNRSRFEEFRALFFESTPRFRE------FPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRA-LTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLA-NNNAIYD-GEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLHKNQYNVWCEPLIEGTPEDKYIDM----LTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDK--NYTDGALGLETAGDKYINFERVNVYDQKFSELLH--DLRTQLDEPDSKTTVVPKPRVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGL-SVYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEWIKTEIGLLSIEYPKIQFQTSNPSAFEDIFQLVSNKIPSVAP---NGET--------ESNLVKMNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFXXXXXXXXXXXXXXXXLMS-------------------TNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPI-NLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNLPYISVIESEESGSL 8555
            D  SY R I ++ I ++++  + E    +   L + +V    + I    I    KL  + +    L  +  E++ LKD   +L +  NPI  +PE++C    L  L  NN L++SLP+N GNLK L YL+++   L  LP SF  L  L +L L G P      N    LS +++ +F   T+ +  + + +E+  +L+E     S+G+L+     +  A  F   PRFR        P EIL   NL+ L    QG + +PD I  L  L++ V+     L+ +S   G LPL+ L    C +++TPP EI  +G + + AYL RL+SGS  C RTKLMLVGLGG GKTSL++A ++       Q A   +TDGIDI +W+    +  + YS+WDFAGQT+YYNTHQFFL+ RA+YLL+WN+RQG EHAGLDFWLNS+  HAP API +VGTH D+V K EIP    Q +Y  + GF FVSS +G+G+K+L + +++ T  QPYIGE +P  WL  EKE+I  R++   +++ +++ LA   + IYD  E++QA++FLH+LGS+Q+F+   LK  V+IN QW+VDVM+CVVSV +S I++G   H+ I  VW  YP  +H WLLRLTE +DLTF +P +  N +PCLLP +QP F WPE    N  REA M Y+F+YLP GLFNRAQVRL +FSDS +IW+ GS L KND  ALLT+  D+ L V  +G  PEN+LF+VHE+FE LI+E+F GV Y+Y + C  C      +P +F+ S ++RATQ K  F+QC + FH+I +T++    PP+S  DYDLQ  ++V  ++  R+  +  I I     D    S        + +DL +  Y  W     +  P  + +++    L  +   ++ IS N+  ++ C  +FK +  TLRK+I+L  +    N+    +GL  AG+ Y+N ++ + Y  K  EL    D+ T L     K   +  P VFISY W NS RA + G  +   + A G+GDPRD KD++E+ G+ CWLDVE +G   ++ DI  GL+N++++VAC+S +YA+S  C  EF FA+  LNLPI++  VG  Q W K+E+G+LSI YP +    ++      + +LV   +PS      + ET        ++N  + N  + QE +EL QRK  R ++    S     YPRL  ID     E      +                       + P     +   +      C+++LCE E GWH   D IP  N++ + L +L+    PYL RI  ++K S    +   + E  ++  K++ E        W   + ++  L   ++  D +    GL  C L +GKV WLC  H +   I+V+ S  S ++
Sbjct: 1648 DGTSYTRLIRSLRIPQNDIKALPEDFFPSFPSLVEFDVSHNKLSILPKGIGKCKKLCGINVKKNNLQNLPEELLELKDQPLRLEISENPIHSLPEVICHLENLQRLLANNLLLTSLPENFGNLKNLNYLTLKHNCLQVLPSSFKNLKKLKSLSLEGFPWFKHKPN--GFLSQEDFGEFLKGTYADKWLEMHKEDKASLYEFFDEDSNGLLDEKEIAKLNACLFHIFPRFRGTEEESGIPAEILELENLEYLDLQFQGITHIPDAISKLHKLQELVVSFNPCLETISPLAGRLPLKRLVLDECPSIRTPPKEIISKGFQTIYAYLRRLISGSVECKRTKLMLVGLGGVGKTSLVKAIMSGGGVGETQEAIPQVTDGIDICTWTVTREKETVSYSVWDFAGQTVYYNTHQFFLSDRAVYLLLWNIRQGHEHAGLDFWLNSIAVHAPKAPILVVGTHLDQVSKVEIPVEEMQQKYSQIKGFHFVSSHSGQGIKDLQEMLLDVTLEQPYIGEQIPQVWLNLEKEIIKLRTTESVVSYVSLEDLALTKSGIYDKSEVSQAVQFLHELGSLQHFDNNFLKSHVVINPQWIVDVMSCVVSVNDSHIKDGYFNHTDIPKVWEDYPADLHWWLLRLTEEYDLTFQLPDKPVNLVPCLLPERQPPFDWPELDRENGEREAKMIYKFDYLPAGLFNRAQVRLYEFSDSSVIWKRGSRLKKNDHIALLTQFRDSELHVKVQGTTPENVLFLVHEVFEGLITESFQGVVYDYLMPCPDCSKAHARDPHMFSASSIRRATQLKAPFLQCTKYFHVIPLTDLHSMMPPESSTDYDLQLVQTVRGLTDLRKDMSADIFISYCAKDVPKKSEKRVAPVDVCRDLEEAGYRCW----FQEDPSSQSLEVTAIALRDARVFLACISDNYIEDQDCCAMFKYACTTLRKSIVLVVLGDSMNWQTSQIGLLVAGEVYVNMQQKDKYTSKLEELAKKLDMNTLL----KKDEAIDYPPVFISYAWANSARAVELGTPE--KEGAAGFGDPRDYKDFLEKNGIKCWLDVEQVGANGLFEDIAVGLQNAKLVVACISDQYAESTNCNMEFRFAKTALNLPIIVVTVGRGQMWRKSEVGMLSINYPVVSHDDTD-----QLLKLVKENLPSEVQQPVSNETKEKKKEKEQANQQQKN-TSFQELYELAQRKFLRQVAKLADSFNMEAYPRLVVIDHMATEETEEGEKESEKENSKDAEKDEEKEKDEERKLSTPHTFSKIKKEHPHGQKHCYRVLCEHEQGWHIAGDPIPAPNMNDTFLHKLI----PYLARIMAIVKHSKHITLNCISGEEGEQFLKWLEETPRNAVSEW---QDVYRDLLQEVLKADKDSTMAGLARCHLPSGKVAWLCEGHRSQGRITVLSSTGSSAV 3028          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A1S3K095 (uncharacterized protein LOC106177527 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106177527 PE=4 SV=1)

HSP 1 Score: 907.516 bits (2344), Expect = 0.000e+0
Identity = 526/1418 (37.09%), Postives = 784/1418 (55.29%), Query Frame = 3
Query: 4506 SYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFGTMINIS-WIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSG-------PS--------ISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFRE------FPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAE-EAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANN-NAIYD-GEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLHKNQYNVWCEPLIEGTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDK--NYTDGALGLETAGDKYINFERVNVYDQKFSELLH--DLRTQLDEPDSKTTVVPKPRVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLS-VYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEWIKTEIGLLSIEYPKIQFQTSNPSAFEDIFQLVSNKIPS-------VAPNG----ETESNLVKMNKIAS-QEDFELIQRKIFRLLSSGIGSEESRLYPRLFFXXXXXXXXXXXXXXXXLMSTNPLFNGHLLSSNT-----PNMSLCFKILCESESGWHTVDDGIPI-NLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNLPYISVIESEESGSLIKLERKRTHLDENLIGNPEN 8615
            S+   I +++I  + ++ + E    +   L  L+V    ++N+   I     L  L L    L  +  +   LK+   +L + GN   E PEI+C    +  L+ N  L+ SLP + G LK L++LS++   L  LP +F QL  L +L LSG       P         + SI   R+ + +K+  D             E+ ++  F+    S+G+L+ +   +  A  F   PRFR       FP EIL   +L+ L    QG + +PD I +LK L   ++     L+ +S Y G LPL+ L+ ++C +++TPP EI  +G ++ + YL RL+SGS  C RTKLMLVGLGG GKTSL++A+ +      +  E   +TDGIDI +W+      ++ YS+WDFAGQT+YYNTHQFFL+ RA+YLL+WN+RQG EHAGLDFWLNS+  HAP API +VGTH D+V K EIP    Q +Y  + GF FVSS +G+G+  L D++++ T  Q Y+GE +P AWL  E+E++  RS+   + ++ ++ L+     I+D  E++QA++FLHDLGS+Q+F+   LK  V+IN QW+VDVM+CVVSV +S I +G  +H  I +VW  YPE +H WLLRLTE +DLTF +P +  N +PCLLP +QP F WPE    +  REA M Y+F+YLP GLFNRAQVRL +FSDS +IW+ GS+L KN   ALLT+L D+ L V   G  PEN+LF+VHE++E LI E+F GV Y+Y + C  C      +P +F  S ++RATQ K  F+QC + FH+I + ++    PP+S  DYDLQ  ++V  ++  R+     I I    +D    +    + K + +DL  + Y  W          +     L  +   ++ IS N+  +  C  +FK +  TL+KNI+L  +    ++    +GL  AG+ Y+N ++ + Y+ K  EL    D  T L + +S    V  P VFISY W NS RA   G  +V  + A G+GDPR+ KD++E  G+ CWLD+E  G + ++ DI  GL+N++++VAC+S +YA S  C  EF FA+  LNLPIVI  VG    W ++E+G+LSI YP I          E +  LV   +P        +  +G    + +  + +  K +S QE +EL QRK  R ++    S     YPRL       + EE T   + +    P+ +       +     P    CFKILCE E GWH     +   N++ + L +L+    PYL RI  +++ S    +     E  ++  K++ E  +A    W   + ++  L   +M+ D N    GL  C L NGK  WLC EH +   I+V+ S+ +  +  L+  + ++    +  P+N
Sbjct: 1616 SHAPLIRSLSISNAGLEKLPEEFFSSFLSLVDLDVSKNLLVNLPRGIGSCRALCKLNLQKNQLETLPEDFADLKEYPLELDISGNSFPEFPEIVCHLENMIHLQANELLLVSLPVSFGKLKELQHLSMKNNCLHVLPPTFCQLKRLQSLSLSGMCWFKCQPKMFLSLAELVHSIKETRAEIWLKKHKD------------DEKTLYKFFDE--DSNGLLDENEVAKMNASLFHIFPRFRGTEEQSGFPPEILDLESLEFLDLQYQGITHIPDGIGNLKKLDTLILSNNPYLETISPYTGRLPLKRLALEDCPSVRTPPKEIIAKGFQSTLVYLRRLLSGSVECKRTKLMLVGLGGVGKTSLVKAIMSGQGTTEKTTEVPQVTDGIDICTWTVTRDSDSISYSVWDFAGQTVYYNTHQFFLSDRAVYLLLWNIRQGHEHAGLDFWLNSIAVHAPKAPILVVGTHLDEVSKVEIPVEEMQEKYSQIKGFHFVSSHSGQGIPVLQDQLLDVTLAQSYMGEQIPKAWLNLEREILKLRSTQSVVKYDDIQTLSQTRTGIFDESELSQAVQFLHDLGSLQHFDSSFLKSHVVINPQWIVDVMSCVVSVMDSPIVDGNFDHKDIPIVWKSYPEDLHSWLLRLTEEYDLTFQLPDKPVNLVPCLLPERQPHFEWPEVDRESGHREAKMVYKFDYLPAGLFNRAQVRLYEFSDSSVIWKRGSMLRKNGHVALLTQLRDSELHVKVIGTSPENVLFLVHEVYEGLIMESFQGVVYDYLMPCPDCSKAHVRDPHMFAASSIRRATQLKAPFLQCSKYFHVIPLRDLHSMMPPESSSDYDLQLVQTVRGLTDLRKDLTADIFISYCVADLPEKNESRVSPKDICRDLEDSGYRCWFPEDPSSQSLEATAIALRDARIFLACISDNYIEDGECCTMFKYATTTLKKNIVLVVLGNSMDWQTSQIGLLVAGELYVNMQQKDRYNSKLEELARKLDSNTLLKKDES----VDYPPVFISYSWANSARAVQLGTRQV--EGATGYGDPREYKDFLESHGIKCWLDIEQTGANGLFEDIAVGLQNAKLVVACISDQYALSANCNMEFRFAKTALNLPIVIVAVGSGLNWRQSEVGMLSINYPVIAH-----DQMEKLLALVKENLPKDDDQKTLIKKDGNEKKKHKEQVNQQQKTSSFQELYELAQRKFLRQVAKFANSFNMTPYPRLIV-IDHTDEEEETNGEEQVEEVQPVEDDQEKEKESDPQADPQQQYCFKILCEHEQGWHIAGSAVLANNVNDAFLHKLI----PYLVRIMAIVRHSKDITLNCITGEKGEKYFKWLEEAPQAVVSEW---QEVYRELLEEVMAADKNKSMAGLARCHLPNGKTAWLCEEHRSHGRITVLNSDGNAVVSSLDSGKENIMLKELKAPDN 3000          
BLAST of Roc domain-containing protein vs. TrEMBL
Match: A0A1S3JZG0 (uncharacterized protein LOC106177527 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106177527 PE=4 SV=1)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 526/1418 (37.09%), Postives = 784/1418 (55.29%), Query Frame = 3
Query: 4506 SYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFGTMINIS-WIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSG-------PS--------ISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFRE------FPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAE-EAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANN-NAIYD-GEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLHKNQYNVWCEPLIEGTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDK--NYTDGALGLETAGDKYINFERVNVYDQKFSELLH--DLRTQLDEPDSKTTVVPKPRVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLS-VYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEWIKTEIGLLSIEYPKIQFQTSNPSAFEDIFQLVSNKIPS-------VAPNG----ETESNLVKMNKIAS-QEDFELIQRKIFRLLSSGIGSEESRLYPRLFFXXXXXXXXXXXXXXXXLMSTNPLFNGHLLSSNT-----PNMSLCFKILCESESGWHTVDDGIPI-NLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNLPYISVIESEESGSLIKLERKRTHLDENLIGNPEN 8615
            S+   I +++I  + ++ + E    +   L  L+V    ++N+   I     L  L L    L  +  +   LK+   +L + GN   E PEI+C    +  L+ N  L+ SLP + G LK L++LS++   L  LP +F QL  L +L LSG       P         + SI   R+ + +K+  D             E+ ++  F+    S+G+L+ +   +  A  F   PRFR       FP EIL   +L+ L    QG + +PD I +LK L   ++     L+ +S Y G LPL+ L+ ++C +++TPP EI  +G ++ + YL RL+SGS  C RTKLMLVGLGG GKTSL++A+ +      +  E   +TDGIDI +W+      ++ YS+WDFAGQT+YYNTHQFFL+ RA+YLL+WN+RQG EHAGLDFWLNS+  HAP API +VGTH D+V K EIP    Q +Y  + GF FVSS +G+G+  L D++++ T  Q Y+GE +P AWL  E+E++  RS+   + ++ ++ L+     I+D  E++QA++FLHDLGS+Q+F+   LK  V+IN QW+VDVM+CVVSV +S I +G  +H  I +VW  YPE +H WLLRLTE +DLTF +P +  N +PCLLP +QP F WPE    +  REA M Y+F+YLP GLFNRAQVRL +FSDS +IW+ GS+L KN   ALLT+L D+ L V   G  PEN+LF+VHE++E LI E+F GV Y+Y + C  C      +P +F  S ++RATQ K  F+QC + FH+I + ++    PP+S  DYDLQ  ++V  ++  R+     I I    +D    +    + K + +DL  + Y  W          +     L  +   ++ IS N+  +  C  +FK +  TL+KNI+L  +    ++    +GL  AG+ Y+N ++ + Y+ K  EL    D  T L + +S    V  P VFISY W NS RA   G  +V  + A G+GDPR+ KD++E  G+ CWLD+E  G + ++ DI  GL+N++++VAC+S +YA S  C  EF FA+  LNLPIVI  VG    W ++E+G+LSI YP I          E +  LV   +P        +  +G    + +  + +  K +S QE +EL QRK  R ++    S     YPRL       + EE T   + +    P+ +       +     P    CFKILCE E GWH     +   N++ + L +L+    PYL RI  +++ S    +     E  ++  K++ E  +A    W   + ++  L   +M+ D N    GL  C L NGK  WLC EH +   I+V+ S+ +  +  L+  + ++    +  P+N
Sbjct: 1182 SHAPLIRSLSISNAGLEKLPEEFFSSFLSLVDLDVSKNLLVNLPRGIGSCRALCKLNLQKNQLETLPEDFADLKEYPLELDISGNSFPEFPEIVCHLENMIHLQANELLLVSLPVSFGKLKELQHLSMKNNCLHVLPPTFCQLKRLQSLSLSGMCWFKCQPKMFLSLAELVHSIKETRAEIWLKKHKD------------DEKTLYKFFDE--DSNGLLDENEVAKMNASLFHIFPRFRGTEEQSGFPPEILDLESLEFLDLQYQGITHIPDGIGNLKKLDTLILSNNPYLETISPYTGRLPLKRLALEDCPSVRTPPKEIIAKGFQSTLVYLRRLLSGSVECKRTKLMLVGLGGVGKTSLVKAIMSGQGTTEKTTEVPQVTDGIDICTWTVTRDSDSISYSVWDFAGQTVYYNTHQFFLSDRAVYLLLWNIRQGHEHAGLDFWLNSIAVHAPKAPILVVGTHLDEVSKVEIPVEEMQEKYSQIKGFHFVSSHSGQGIPVLQDQLLDVTLAQSYMGEQIPKAWLNLEREILKLRSTQSVVKYDDIQTLSQTRTGIFDESELSQAVQFLHDLGSLQHFDSSFLKSHVVINPQWIVDVMSCVVSVMDSPIVDGNFDHKDIPIVWKSYPEDLHSWLLRLTEEYDLTFQLPDKPVNLVPCLLPERQPHFEWPEVDRESGHREAKMVYKFDYLPAGLFNRAQVRLYEFSDSSVIWKRGSMLRKNGHVALLTQLRDSELHVKVIGTSPENVLFLVHEVYEGLIMESFQGVVYDYLMPCPDCSKAHVRDPHMFAASSIRRATQLKAPFLQCSKYFHVIPLRDLHSMMPPESSSDYDLQLVQTVRGLTDLRKDLTADIFISYCVADLPEKNESRVSPKDICRDLEDSGYRCWFPEDPSSQSLEATAIALRDARIFLACISDNYIEDGECCTMFKYATTTLKKNIVLVVLGNSMDWQTSQIGLLVAGELYVNMQQKDRYNSKLEELARKLDSNTLLKKDES----VDYPPVFISYSWANSARAVQLGTRQV--EGATGYGDPREYKDFLESHGIKCWLDIEQTGANGLFEDIAVGLQNAKLVVACISDQYALSANCNMEFRFAKTALNLPIVIVAVGSGLNWRQSEVGMLSINYPVIAH-----DQMEKLLALVKENLPKDDDQKTLIKKDGNEKKKHKEQVNQQQKTSSFQELYELAQRKFLRQVAKFANSFNMTPYPRLIV-IDHTDEEEETNGEEQVEEVQPVEDDQEKEKESDPQADPQQQYCFKILCEHEQGWHIAGSAVLANNVNDAFLHKLI----PYLVRIMAIVRHSKDITLNCITGEKGEKYFKWLEEAPQAVVSEW---QEVYRELLEEVMAADKNKSMAGLARCHLPNGKTAWLCEEHRSHGRITVLNSDGNAVVSSLDSGKENIMLKELKAPDN 2566          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: lrrk2 (leucine-rich repeat kinase 2 [Source:ZFIN;Acc:ZDB-GENE-071218-6])

HSP 1 Score: 120.553 bits (301), Expect = 2.549e-26
Identity = 156/666 (23.42%), Postives = 287/666 (43.09%), Query Frame = 3
Query: 4644 IYLPKLSSLTLS-NCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQL-ANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTK-TGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGF-EHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVV--GF-------FFVSSLTGKGVKELHDKIIE-----ETKGQPYIGELVPNAWLRFEKELISQRSSA----DYLNWEAVKKLANNNAIY--DGEINQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVKNS-IIEN--GKLEHSKIKLVWSK---YPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANM-FYQFEYLPPGLFNRAQVRLSQFS 6542
            +  P L  L LS NC L     ++    ++L+ L+L+GN I E+   LC+  +       N +     D +     L+  S    KLS    S S L + ++TLKLS  +  S+    +VL         N  ++    ++   I  L   +  +   L    F + +    +     RE PV+      L+ L  SN   + +P +I  L+ L    + G   L+     +G L + +              +      ++++ Y  + +  +   +R KL++VG  G+GKT+L++ L        Q         I +  W+ +   + N+  ++WD  G   Y  +H  F++ RA+YL+++N+ +G  E   +  WL ++   AP +P+ +VGTH D  +   +     + R   ++  GF          +      + +L   I       + +GQP +G+LVP+ ++  E+ ++ +R+        L  + + +L   + +   +GE+  AIRFL + G + +F+ P   L+D   I+ QWL +V++  + + +S + EN  G +  S + L  S+   +P        +L E F +     G E   IP  L + +P    P     ++  E  M  Y+  Y P G ++R   RL + S
Sbjct: 1058 VRCPTLRQLNLSFNC-LTAFPYQLGQAMENLEDLNLEGNQISELSLPLCLAEMKALDVSKNGVAMISDDFLSGCFKLETFSASNNKLS----SMSHLPSKITTLKLSQNNFKSV--PYAVL---------NLPNLRSVDMKSNSISVLPGPSAWASANLKELLFSQNQIAELD----LRE-PVQ--KWARLEKLQLSNNKLTEIPPQIGLLEELTSLDVSGNVGLRSFPDELGKL-VRLWDLPLDGLQLQLDLKHIGNKTKDIVRYFQQRLKKAVPYFRMKLIVVGTAGSGKTTLIQQLMKHK--RSQWKSGIGGTKISVRDWTVRDRDKKNMILNVWDIPGGEEYSESHPHFMSSRAMYLVLYNLSKGVSELDTVKPWLFNIKALAPLSPVILVGTHVDMCEDHVLQECMQKLREDVLIQLGFPAIKECPILCACEESDSISKLRKSIASGASCFKIQGQPVMGQLVPDCYVELERRVLQERTRVPPEFPVLRHQRLLQLIQESQLQLEEGELPHAIRFLSETGVLLHFDDPALQLRDLYFIDPQWLCNVISQTLILSSSGLCENTTGVVLRSVLTLCLSESRCFPREHLMQYFKLLEKFQIALPF-GDEQLLIPSSLLHHKPVIKLPH----SENSEMIMRIYEMPYFPMGYWSRQINRLLEVS 1692          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: lrrk1 (leucine-rich repeat kinase 1 [Source:ZFIN;Acc:ZDB-GENE-101019-2])

HSP 1 Score: 108.997 bits (271), Expect = 7.599e-23
Identity = 146/649 (22.50%), Postives = 273/649 (42.06%), Query Frame = 3
Query: 4599 KLEVDFGTMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNL--KFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFR---EFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLP-LEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTK--TGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEH-AGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKS-----------------EIPTTHFQSRYPSVVGFFF----VSSLTG-KGVKEL-------HDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLN---------WEAVKKLANNNAIYDGE-INQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVKN--SIIENG--KLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEF 6383
            KL   F      +WI  L +L  L +S+  L ++   ++H   +L  L++  N +   P+       L   +     I SLPD I       LK +      L  LP    +L  + +LKL G  IS++       +  +W   C++  +    L   ++    E+T        ++R   F   +    P      +FP EIL   +L+ L  ++     VP  +  LKNL +  +     +Q L S +G L  L  L  +   N+   P ++R+ G   ++A+L   +  +E C   KLM+VG    GK++L+  L      +   ++ ++      ++W  +  TG  ++ +++WD  G       +Q F T +A+Y++IWN+  G E  A L  WL ++   AP++ + +VGTH D +D                     P+    S YP +           SL G  G+K L          I         +G L+P ++L  ++ ++++R   D ++          + + + + ++ I D E +  AI FL + GS+ +F      L     +++ WL + +  ++ +K+  S+  NG  + E  ++ LV + + +   +   +    F++   V    +
Sbjct:  314 KLTALFNIPNGTNWI-GLRRLQELDVSDNHLADLSSPVLHCFKALSSLNISKNRLSRFPDPWAC--PLKICKAACNQIESLPDTISIFWRTHLKEVDFSENALKELPSYIFELEAIVSLKLCGNQISAL------PASNKWK--CSQ--LRTLDLSRNQLGKTVENT--------KTRRLPFLTTWTRRDPEPACPVQFP-EILR-DSLEVLFLNDNQLECVPPSVCFLKNLSELYLSNNPGIQELPSELGQLSNLWQLDIEEL-NISNVPADVRKDGPAAVLAFLRAELRRAEPCKLLKLMVVGPPRQGKSALLEGLQTGKSTSFMSSDRSVR----TSTWELERPTGVDSVCFNVWDIGGPASMSTVNQCFFTDKALYVVIWNLALGEEAVANLQSWLLNIEARAPNSAVVVVGTHLDLIDTKFRTERIATLRAYILALCRTPSGARASGYPDITWKHLHEVSCKSLEGMDGLKRLLYQVSCSMKDITNPASCHKLVGRLIPKSYLMLQETVLAERLRRDSMDEVQYLTDLELDQIIEQSPSSDIKDYEDLQTAISFLIETGSMLHFPDTSHGLCKLYFLDAVWLSECLERIIHLKSSRSVARNGVIRAEDLRMLLVGTGFTQQTEEQYFQFLAKFEIALPVASNSY 934          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:ZFIN;Acc:ZDB-GENE-080917-20])

HSP 1 Score: 96.2857 bits (238), Expect = 3.975e-19
Identity = 126/486 (25.93%), Postives = 205/486 (42.18%), Query Frame = 3
Query: 4536 IKRSEMDNVKETAL--------VTCTKLRKLEVDFGTMINI-SWIIYLPKLSSLTLS-NCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVL-SIKEWSDFCNKTHING-----QVLQEEEIF----NLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDG----------------------CANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCY-RTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVR----QGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEI 5852
            IK  E+ N+   AL         T T+LR L +       + S +  L +L  L LS NC  H    E I L   LK+L +  N I+ +P  +     L  L+++   +   P +   L+ L+ L ++  KL   P     L++L  L  SG  +  +     +L SIK    + + THI         LQ  E      NL  +   S G L R +          S+  F +FP  +L    L+ L  S    S +P+E+  L NL    +D                          + IL    G L    +     + L  PPYE+  +G+  + AY   L         R KL+L+G   AGKT L + + +K   A  I  +    GID+ +W       +L + ++D +G+  Y     FFL+  A+Y+L+ N++    + F ++ + ++L+ ++   P A + IVGTH+D  ++ E+
Sbjct:   48 IKEIEVLNLGNNALQELPEGLGSTLTRLRILILRRNKFAAVPSAVFQLSQLVELDLSHNCLKH--FSEDIDLLKGLKKLCISHNKIQYLPSQIGTLQCLEELDISFNELHDFPRSFSQLRRLRTLDVDHNKLQHFPPEVLALSDLEELDCSGNKLEGLPGNIMMLQSIKIL--WLSSTHIVSLPETFSDLQNLESLMLDNNLLTALPQSFGKLQRLKMLNL------SSNSFEDFPQVVLKIARLEELYLSRNQLSFLPEEVGLLSNLANLWLDNNRITFLPDSIVELEKLEELVLQGNQIAILPDNFGKLAKVNIWKVKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQPAVKPRLKLVLMGQKNAGKTRLRQCIVSKALDAKTIPGDR---GIDVTNWVADLHR-SLTFIVYDLSGKQNYDLIKPFFLSPGALYILVVNLKAYTCRTF-YSSVGYFLHLLSAKVPHAVVCIVGTHTDLCEEMEL 518          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: ascl1b (si:ch211-210p4.6 [Source:NCBI gene;Acc:560440])

HSP 1 Score: 86.2705 bits (212), Expect = 3.929e-16
Identity = 95/420 (22.62%), Postives = 178/420 (42.38%), Query Frame = 3
Query: 5157 STPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSR--YPSVVGFFFVSSLTG-----KGVKELHD------KIIEETKGQPYIGELVP--------NAWLRFE-KELISQRSSADYLNW------------------------------EAVKKLANNNAIYDGEINQAI-RFLHDLGSIQ-YFEFPLLKDFVIINSQWLVDVMACVVSVKNSII 6254
            +T R  + P ++  C +L  L  SN     +   +  L+ LK+  ++    +++  +      L VL      N    P E+   G++++ ++   L   S +    K M +G   AGK++L R+L         +AE   T GI+I     +  +  +++  WDFAGQ  YY TH  F+T +A  +L  ++    E  G  FW+N++    P++ + +VGTH   VD+ E+     + +      V    +          K ++EL D      ++ E  + + Y+ +L+P          WL+   K+L+S + +  ++                                + ++ L N ++  D E  + I ++LH +G I  Y E P LKD V I   +L+ +      V++ ++
Sbjct:   99 NTNRLTKLPSDLNRCQSLVYLNLSNNSLKDL-QPLVGLRRLKELYVENNQLVELPRALFRASALAVLKV----NGNALPEEVCAGGLKDLQSFYSMLDDSSCSVCTLKTMFLGATMAGKSTLCRSLREGEPVP--VAEADRTVGIEI----CEVDQDGVRFLYWDFAGQEEYYITHHVFITPQAFVILAVDLSSFREKVG--FWINNIQLKVPNSVVLLVGTH---VDQCEVEGEMMKKKNDIQEKVQQMLLDRRESLQQQRKNLEELEDVSLFSEQMREIQRLEEYVLDLIPIDCTKSEDIVWLQNHIKDLVSDKETFPFMEQTLPQCYQQVESTIHELVSDGDVPRHIMNHDDLLEYLQNKHSELDHEKMRLILQYLHRIGIIMWYMEIPDLKDMVFIKPSFLISLFKLQAIVRHDLV 502          
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Match: rhogc (ras homolog gene family, member Gc [Source:ZFIN;Acc:ZDB-GENE-030131-3402])

HSP 1 Score: 57.3806 bits (137), Expect = 3.591e-8
Identity = 52/196 (26.53%), Postives = 82/196 (41.84%), Query Frame = 3
Query: 5478 KLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDF-WLNSVTCHAPSAPIFIVGTHSD-KVDKSEI---------PTTHFQ----SRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEK 6020
            K ++VG G  GKT L+ + T   F      EE I    D  S  T      +  +LWD AGQ  Y            ++++ ++V     HA +   W   V+ H P  P+ +VGT  D + D+  +         PTT  Q    +R    V +   S+L  +GV+E+ ++ +           L PNA  + +K
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNTF-----PEEYIPTVFDNYSTQTCVDGRAVSLNLWDTAGQEEYDRLRTLSYPQTHVFIICFSVASPSSHANVRHKWHPEVSHHCPGVPVLLVGTKRDLRSDRETLERLKEQGLTPTTQQQGAALARSIGAVRYLECSALLQEGVREVFNEAVRAV--------LYPNAKKQAKK 187          
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004441.1 (pep scaffold:Pmarinus_7.0:GL477554:92318:114375:1 gene:ENSPMAG00000004044.1 transcript:ENSPMAT00000004441.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 1.226e-15
Identity = 68/229 (29.69%), Postives = 106/229 (46.29%), Query Frame = 3
Query: 5202 TNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLP----LEV----LSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITD-GIDINSWSTKT--GEINL-----QYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEH-AGLDFWLNSVTCHAPSAPIFIVGTHSDKV 5837
            + L+ L  S+     VP  I SL  L++  +     ++ L   +G+L     LE+    +S    D L  P       G   ++AYL      S+ CY  KLM+VG    GKTSL+ +L ++    P        D  I +++W  +   G  +L     ++S+WD  G       H+   T RA+YLL+WN+  G E    L  WL ++   AP A + +VGTH D++
Sbjct:   75 STLEALNLSSNFMDSVPSSIGSLLALQELYLSRQKGVRELPHALGSLSNLWLLEIDELEISNVPADLLHDP------NGTPAILAYLRAQQRRSQHCYSLKLMVVGPSHQGKTSLLSSLRHRRKPPPPPVSGGCPDVPIVLSTWDLQRPLGLADLKVEKIRFSVWDVGGTASALPVHRCLCTDRALYLLVWNLALGEEGVVSLHHWLLTIQARAPHAAVIVVGTHLDRL 297          
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007368.1 (pep scaffold:Pmarinus_7.0:GL476419:214196:224439:-1 gene:ENSPMAG00000006646.1 transcript:ENSPMAT00000007368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 5.558e-8
Identity = 44/174 (25.29%), Postives = 74/174 (42.53%), Query Frame = 3
Query: 5478 KLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDF-WLNSVTCHAPSAPIFIVGTHSDKVDKSEI----------PTTHFQ----SRYPSVVGFFFVSSLTGKGVKELHDKII 5954
            K ++VG G  GKT ++ + +N  F    I    + D   +N        +NL   LWD AGQ  Y            I+L+ ++V     +  +   W   V  H P  PI +VGT  D+ +  +I          P T+ Q    ++    + +   S+LT +G+K + D+ +
Sbjct:    5 KCVVVGDGAVGKTCMLISFSNNTFPGEYIP--TVFDNYAVN-LMVDGKYVNL--GLWDTAGQEDYDRLRPLSYPQTDIFLICFSVVSPSSYDNVRVKWFKEVRHHCPETPIILVGTKQDQREDKDILKHLEEKSMQPVTNAQGLSLAKEIGAIKYLECSALTQRGLKNVFDETV 173          
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Match: rab4b (RAB4B, member RAS oncogene family [Source:NCBI gene;Acc:445498])

HSP 1 Score: 53.5286 bits (127), Expect = 1.560e-7
Identity = 47/178 (26.40%), Postives = 78/178 (43.82%), Query Frame = 3
Query: 5478 KLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHA--GLDFWL-NSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFV--SSLTGKGVKELHDKIIEETKGQPYIGELVP 5996
            K +++G  G GK+ L+       F   Q +   I  G++  S    TG   ++  +WD AGQ  + +  + +  G A  LL++++  G       L  WL ++ T  +P+  I + G   D     E+ T    SR+       F+  S+LTG+ V+E   K       +   GEL P
Sbjct:   14 KFLVIGSAGTGKSCLLHQFIENKF--KQDSNHTI--GVEFGSKVVNTGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSGSRETYNALTNWLADARTLASPNIAIILCGNKKDLEPDREV-TFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKIESGELDP 186          
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008655.1 (pep scaffold:Pmarinus_7.0:GL484079:6946:12214:1 gene:ENSPMAG00000007829.1 transcript:ENSPMAT00000008655.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 1.746e-7
Identity = 59/216 (27.31%), Postives = 99/216 (45.83%), Query Frame = 3
Query: 4668 LTLSNCGLHEIGPEII--HLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRS-VLSIKE--WSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDG 5300
            L LS+  LH + P++       SL+++ LDGN I+E+P+ LC   LL  L + +  ++SLP  IG L  L+ +   R +L  +P +      LS + +S  ++S + +  + ++S+ E   SD                   L E   +S G L + R  E R     S P+       +   + L+ L      FS VP  +Q L  L++ ++DG
Sbjct:   27 LDLSHTRLHTVPPQVYTPASAQSLQEIHLDGNYIQELPKELCALPLLRVLSVADNDLASLPPAIGGLAGLRRIDASRNELRDIPDNIRSCRQLSVVNVSNNTLSRLPDGLTQLVSLTELYLSDV------------------LLEFLPASLGRLCKLRVLELRDNHLNSLPK------AMHRLSQLRRLDLGCNDFSHVPPVLQQLTTLQELLMDG 218          
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001552.1 (pep scaffold:Pmarinus_7.0:GL476520:43153:47504:1 gene:ENSPMAG00000001403.1 transcript:ENSPMAT00000001552.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 7.912e-7
Identity = 42/165 (25.45%), Postives = 69/165 (41.82%), Query Frame = 3
Query: 5472 RTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHA-PSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFV--SSLTGKGVKELHDKIIE 5957
            R KL+L+G    GKTSL+R L    F    I  E  T G+   S+     E  ++  +WD AGQ  +      F       +L +++        L FW++ +   + P+  + + G+  D ++ S        +R+    G  F+  S+     V EL   I E
Sbjct:   12 RVKLVLIGESNVGKTSLLRRLARNQF----IPNEVATVGVAFQSYVVHLEEAPVRLEIWDTAGQERHRMLTPIFFRNAEAAVLTYDISSQESFNKLQFWISELKEKSHPNVVMALAGSKCD-LEVSRQVQHEEGARFAREHGMIFMETSAQAAMNVVELFHAIAE 171          
BLAST of Roc domain-containing protein vs. Ensembl Yeast
Match: RHO2 (Non-essential small GTPase of the Rho/Rac family of Ras-like proteins; involved in the establishment of cell polarity and in microtubule assembly [Source:SGD;Acc:S000005034])

HSP 1 Score: 53.5286 bits (127), Expect = 5.485e-8
Identity = 48/177 (27.12%), Postives = 73/177 (41.24%), Query Frame = 3
Query: 5457 SETCYRTKLMLVGLGGAGKTSLMRALTNKNFCA---PQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHA--GLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSE---------IPTTHFQ--SRYPSVVGFFFVSSLTGKGVKEL 5939
            SE   R KL+++G G  GKTSL+   T   F     P + E  +TD         +   I +  +LWD AGQ  Y     F  +   I L+ + V   FE        W +    + P API +VG   D   ++          +P    +  +R      +   S+LTG+GV ++
Sbjct:    2 SEKAVRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYVTD--------CRVDGIKVSLTLWDTAGQEEYERLRPFSYSKADIILIGFAV-DNFESLINARTKWADEALRYCPDAPIVLVGLKKDLRQEAHFKENATDEMVPIEDAKQVARAIGAKKYMECSALTGEGVDDV 169          
BLAST of Roc domain-containing protein vs. Ensembl Yeast
Match: CDC42 (Small rho-like GTPase; essential for establishment and maintenance of cell polarity; plays a role late in cell fusion via activation of key cell fusion regulator Fus2p; mutants have defects in the organization of actin and septins; human homolog CDC42 can complement yeast cdc42 mutant [Source:SGD;Acc:S000004219])

HSP 1 Score: 50.0618 bits (118), Expect = 9.053e-7
Identity = 48/184 (26.09%), Postives = 73/184 (39.67%), Query Frame = 3
Query: 5478 KLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNV--RQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEI----------PTTHFQ----SRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYI 5981
            K ++VG G  GKT L+ + T   F A     + +    D  + +   G+      L+D AGQ  Y            ++L+ ++V     FE+   + W   V  H P  P  +VGT  D  D   I          P T  Q    +R    V +   S+LT +G+K + D+ I      P I
Sbjct:    5 KCVVVGDGAVGKTCLLISYTTNQFPA-----DYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVK-EKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVI 182          
BLAST of Roc domain-containing protein vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 49.6766 bits (117), Expect = 1.804e-6
Identity = 43/164 (26.22%), Postives = 74/164 (45.12%), Query Frame = 3
Query: 5478 KLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNV--RQGFEHAGLDFWLNSVTCHAPSAPIF--IVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKG--VKELHDKI 5951
            K++ +G  G GKTSL+       F     A    T GID  S +    +  ++  LWD AGQ  + +    ++    + ++++++  R+ FE+  +D W+  V        +   IVG  SD  D+ +I T   + +   +    F+ + T  G  VK L  KI
Sbjct:   12 KIVFLGEQGVGKTSLITRFMYDTFDDHYQA----TIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEY--IDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKI 169          
BLAST of Roc domain-containing protein vs. Ensembl Yeast
Match: RHO4 (Non-essential small GTPase; member of the Rho/Rac subfamily of Ras-like proteins; likely to be involved in the establishment of cell polarity; has long N-terminal extension that plays an important role in Rho4p function and is shared with Rho4 homologs in other yeasts and filamentous fungi [Source:SGD;Acc:S000001763])

HSP 1 Score: 49.6766 bits (117), Expect = 3.030e-6
Identity = 37/125 (29.60%), Postives = 55/125 (44.00%), Query Frame = 3
Query: 5469 YRTKLMLVGLGGAGKTSLMRALTNKNFCA---PQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGL-DFWLNSVTCHAPSAPIFIVGTHSD 5831
            Y  K+++VG G  GKT L+ +     F     P I E  +T+    N      G+I ++ +LWD AGQ  Y        T   + ++ ++V        + D W   V    PS PI +VG  SD
Sbjct:   71 YHLKIVVVGDGAVGKTCLLISYVQGTFPTDYIPTIFENYVTNIEGPN------GQI-IELALWDTAGQEEYSRLRPLSYTNADVLMVCYSVGSKTSLKNVEDLWFPEVKHFCPSTPIMLVGLKSD 188          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO31971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWE1])

HSP 1 Score: 181.03 bits (458), Expect = 5.196e-47
Identity = 145/513 (28.27%), Postives = 247/513 (48.15%), Query Frame = 3
Query: 5175 EFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTP-------PYEIRRQGM-RNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTK-----------TGEIN--LQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHA-GLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSE-----------IPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEET-----KGQPYIGELVPNAWLRFEKELISQ-------RSSADYLNWEAVKKLANN--NAIYDG-EINQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSV--KNSIIENGKLEHSKIKLVWS--KYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVD-FNQTREANMF------YQFEYLPPGLFNRAQVRL 6530
            EFPV++   T L+TL+ ++ G  +VP  +  L NL +  +    +L+       TLP ++ + ++C  L+         P  +R   + ++ +A+L   +  S   YR KLM+VG+ G GKT+L+ AL  +      +     T GI ++ WS +           T  I   +  S WD AGQ++YY  HQ FLT   +YL +WN   G E    L  WL ++   AP + + I+GTH D++ ++            I   +    +P +VG+  VS++TG+G+ EL + I ++      +GQ  IG+ VP ++++ +  +  +       R     L  E +   A N  N I+D  E+  A RFLHD G + ++   L  L     I+  W+ D++A +V+V  KN  + +G +  S +++V    ++P +     L+L E F++  ++   +   IP +LP++ P     E    F +T   N        YQ  Y+P GL++R   RL
Sbjct:  145 EFPVDLFAPT-LETLLLNDNGLLVVPPSVCRLTNLNELDLSNNPDLR-------TLPPQLGNLRDCWQLRLNKLTLTELPKHVRPGVLSKDTLAFLRATLRKSVPYYRMKLMVVGIQGYGKTTLLAALKGQ-----PLPSNLSTVGIVVDEWSVQISTSLLSRIGITSGIGPTITLSTWDLAGQSVYYAAHQMFLTPSTLYLAVWNATLGEEGVENLRSWLLNIKARAPYSDVIIIGTHLDRIPRASRESRVKELNHMIMKRYDTKGFPKIVGYTVVSAVTGEGITELKELIYKKAINSKEQGQLVIGKQVPLSYIQLQDAIRHEADRRREARKPPILLEEEMLALAAGNKDNDIHDHEELALATRFLHDNGVLLHYNDQLRGLNTLYFIDPAWVCDLIASIVTVREKNGYVRDGIMLTSNVRMVLRDPRFPPNFIPQYLQLMERFEIALTLDDFQI-LIPSMLPHEAPGMKMNELYRLFQRTSPDNSHDSIQRNYQMAYVPSGLWSRLITRL 643          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO30091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1T0])

HSP 1 Score: 105.531 bits (262), Expect = 2.667e-22
Identity = 132/501 (26.35%), Postives = 197/501 (39.32%), Query Frame = 3
Query: 5598 NSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWN------------VRQGFEHAGLD------------FWLNSVTC------------HAPS--------------APIFIVGTHSDKVDKSEIPTTHFQS---------RYPS-VVGFFFV----SSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQ-RSSADYLNWEAVKKLANNNAIY--DGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVK-------------NSIIENGKLEHSKIKLVWSKYP---ESIHKWLLRLTEIFDLT--FSVPGQEFN-----FIPCLLPNKQPEFSWPEFVDF-NQTREANMFYQFE--YLPPGLFNRAQVRLSQ---FSDSFIIWQNGSLL-----NKND---------DKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLIS--EAFSGVKYEYQISCKKCIAE 6764
            NS S K  EI L    WDFAGQ LYY TH  F + RA+Y+L  N            VRQG     LD             WL +V C              P                P+ IVGTH+DK     IP     +         RY   V+  FF      S   KG+++L  KI    K +PY+GE +P  W  FEK +  Q   +  +L    V+++A        D E N  + F HDL  I           V++ SQWLV++   +++++              ++ E G L  S I  V+ ++        + LL + E + L   F+ P +         +P  L       S PEF  F N      +   F   ++P GLF + + RL +   F+    +++NG+       N+ND          K +LT L   T  VC +G     +  ++ E  + L    +    ++YE+ + C  C +E
Sbjct:  603 NSLSEKRKEIVL--DAWDFAGQHLYYATHPVFFSSRAVYVLTHNLSKDLRKKAEPCVRQGVVKKKLDNANNETNLENLISWLVTVHCVQNLEERDKDCKRFPEKTDTTLTSTIKHLRPPVLIVGTHADK---PSIPVEQAHAILAEAICGKRYDEHVIRPFFAVDNSKSSDEKGIQDLRTKIESVLKSEPYMGETLPAKWFNFEKAIAQQIERNVYFLQLSEVRRIAQYECFIADDVEFNTMLNFFHDLRVIVKH-----AGTVVLQSQWLVNLFKKLITIRTFNEMDPSRAKHWKTLEETGVLHQSLIDDVFGEFVPGNSQTQQDLLSMMERYGLVARFNAPDENGKESLQFLVPAQLT------SSPEFKVFPNDCDPCALLIHFPDGFVPHGLFPQLESRLVKHFGFTSPSRLFRNGARFVIGTKNQNDLFLLCGKRYIKVILT-LTTCTGDVCEQGL-AVRVRMLLEESLDELSRDWDWLGHLRYEFCVECSVCASE 1085          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO47069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN40])

HSP 1 Score: 84.3445 bits (207), Expect = 6.812e-16
Identity = 70/267 (26.22%), Postives = 107/267 (40.07%), Query Frame = 3
Query: 5643 LWDFAGQTLYYNTHQFFLTGRAIYLLIWN------------VRQGFEHAGLD------------FWLNSVTCHAP--------------------------SAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVV-----------GFFFVS---SLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQ-RSSADYLNWEAVKKLANNNA--IYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVK 6242
            +WDFAGQ LYY TH  F + RA+Y+L  N            +RQG     LD             WL +V C                               P+ IVGTH+D+     +P     +     +            FF V    S   +G+++L  KI    + +PY+GE +P  W  FEK +  Q   +  +L    V+++A      I D E+N  + F HDL  I           V++ SQWL+++   +++V+
Sbjct:  715 VWDFAGQHLYYATHPVFFSSRAVYVLTHNLSKNLNERAEPCMRQGVADIKLDNANNETNLENLISWLVTVHCIQSLEERDKEAELLSDKTGTTRATKTKYLRPPVLIVGTHADQ---PCVPVKQAHALLAEAICGKTYDEHVIRPFFSVDNTKSSDDQGIQDLKTKIANVLESEPYMGETLPAKWFNFEKAIAEQIERNVYFLPLSEVRRIAQTECFIIDDQEVNTMLNFYHDLRVIVKH-----AGTVVLQSQWLINLFKKLITVR 973          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO37102 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGP5])

HSP 1 Score: 84.3445 bits (207), Expect = 8.205e-16
Identity = 60/231 (25.97%), Postives = 113/231 (48.92%), Query Frame = 3
Query: 5925 GVKELHDKIIE-----ETKGQPYIGELVPNAWLRFEKELISQRSS---ADYLNWEAVKKLANNN----AIYDGEINQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVKN--SIIENGKLEHSKIKLVWSKYPE-----SIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFI 6554
            G++ L ++I+      + KG   +G  VP A++R ++ ++ + +S   A +L    +++L  +     ++ D E+ QA++FLH+ G + +++ P+  L D   +  +WL  V++ VV+  N   ++ NG L+   +  ++   PE      +   LLRL E   +   V   EF  +P  L  K+P  + P   + +  R     Y   ++PPG + R   RL  F+ S I
Sbjct: 1378 GIQALRNRIVNLIVKCKCKGHSLLGSRVPQAFVRLQQLVLQETASGNSAPFLYRGDLRRLLQDQEDEVSMCDSELGQAVKFLHEAGVLVHYDDPVAHLSDVFFVKPEWLCHVISSVVTTGNDKGLVTNGILKRDDLHFLFK--PEVGSHAELTPQLLRLLERSGVLLPVNSTEF-LMPSRLSRKEPTITLP---NPSPERSCRRLYDLAFVPPGFWARLIARLLLFARSMI 1602          
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Match: EDO47001 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN39])

HSP 1 Score: 83.9593 bits (206), Expect = 1.088e-15
Identity = 75/264 (28.41%), Postives = 113/264 (42.80%), Query Frame = 3
Query: 5640 SLWDFAGQTLYYNTHQFFLTGRAIYLLIWN------------VRQGFEHA------------GLDFWLNSVTCHAPS-------------------------APIFIVGTHSD-------KVDKSEIPTTHFQSRYPSVVGFFFVSSLT----GKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADY-LNWEAVKKLANNNAIYDG--EINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVK 6242
            S+WDFAGQ LYY +H  FL+ RA+YLL++N            VRQG                G+  WL  V+ H+                            P+ IVGTH D       K++     +   +S    VV  F V + T     KGV+ L   I E  + +PY+GE VP  W  FEK + +      Y L    ++++ N     D   EI+  + F HDLG I      +    V++ +QWL+D+   +++++
Sbjct:  694 SIWDFAGQHLYYASHPVFLSPRAVYLLVYNLKKDLNAEAEPCVRQGVYDVLLENPDRQTNLDGILSWL--VSIHSIQRGDEDGDSDVVKDEGKTDQKLPYLRPPVIIVGTHEDMAFEDPKKMEMHIKKSLQGKSYQQHVVKPFVVVNNTLSSGDKGVQLLQKTIGEVLRTEPYMGEDVPVRWFNFEKVVETLVQGKTYHLALTDLERIVNEVCFIDDSREISAMLNFYHDLGVIV-----MHGGTVVLQAQWLIDLFRRLITIR 950          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: lrrk2 (leucine rich repeat kinase 2 [Source:NCBI gene;Acc:101155093])

HSP 1 Score: 129.028 bits (323), Expect = 7.045e-29
Identity = 168/738 (22.76%), Postives = 313/738 (42.41%), Query Frame = 3
Query: 4515 RCIANIAIKRSEMDNVKETALVTCTKLRKLEVD---FGTMINISWIIYLPKLSSLTLSNCGL----HEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLA-NLSTLKLSGPSISSIFNK-------RSVLSIKEWSDFCNKTHINGQVLQEEEIF--NLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFS-NQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTK-TGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHA-GLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSR--------YPSV----VGFFFVSSLTGKGVKELHDKIIEET-----KGQPYIGELVPNAWLRFEKELISQRSSAD----YLNWEAVKKLANNNAIY--DGEINQAIRFLHDLGSIQYFEFPLLK--DFVIINSQWLVDVMACVVSVKNSIIE---NGKLEHSKIKLVWSK---YPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSL 6575
            R +  + ++ +++ ++ E  L+    L  L V     G  ++    +  P L  L LS   +    H++G  +      L++L L+GN I E+   LC+  +       N++ +  PD + N   L++L+   + L+      SQL   ++TLKL+    S +          RS+       DF     +       E IF  N  +S   S  V   +R E+       S  +  E P +I     L +L  S N G    PDE+  L  L    +DG   LQ+    +G    +++        K  PY                        +R KL++VG   +GKT+L+  L  +     Q+       GI++  W+ K   +  +  ++WDF G   +  +H  FLT RA+YL+++N+ +G      L  WL ++   AP +P+ +VGTH+D  D+        ++R        +P++    +G+F   S     +  L   I  E      +GQ  +G+LVP++++  E+ ++ +R+        L    + +L     +   + E+  A+ FL ++G + +F  P L+  +   I+ QWL ++++  +++K+  +     G ++ S ++   S+   +P+S     ++L E F +   + G++   +P  L   +P    P       +     FY+  Y P   ++R   RL + S   +  Q+  L
Sbjct:  787 RSLTRLDLQGNQLKSLPE-GLLALPSLSTLNVSRNCIGPTLSFDPAVTCPALKHLNLSFNKISTFPHQLGCSM----QKLEELFLEGNCITELCVPLCLPEIKLLDVSRNSVDNICPDFLSNCCKLEHLNSSASFLAA--SHLSQLPIKITTLKLANNKFSQVPASVLDLPVLRSLDMRANTIDFLPGPSLWASSNIRELIFSQNCIQSLDLSGPVYRWARLEKLHL----SDNKLSEVPAQIGLLDGLTSLDVSHNSGLRSFPDEMGKLSKLWDLPLDG-LRLQLDFKLIGNKTKDIIRSLQQRLKKAVPY------------------------HRMKLIVVGNPSSGKTTLIHQLMKQKR---QLNSNQNAAGINVLDWTIKDRDKKKMVLNVWDFTGGEEFSGSHLHFLTSRAVYLVVYNLSKGSSQVDALKPWLFTIKAVAPLSPVILVGTHADVSDELHFQDCLKKTRAELLNHQGFPAIRDHHMGYFCEDS---DSIANLRKAITREVTSFKIQGQLVMGQLVPDSYVELERRVLLERTRISPEFPVLRRYQLLQLIQECQLQLEEAELPHAVHFLSEVGILLHFNDPGLRLQELYFIDPQWLCNILSQKLTLKSCGLREQPKGIVQRSVMEKFLSESKCFPKSHLVQFVKLLEKFQIALPL-GEDQLLVPSSLSKHRPVIELPH---CENSEVIVRFYEMPYFPMDYWSRQICRLLEVSSYLLCGQDKML 1478          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: mfhas1 (malignant fibrous histiocytoma amplified sequence 1 [Source:NCBI gene;Acc:101173528])

HSP 1 Score: 89.3521 bits (220), Expect = 5.763e-17
Identity = 112/483 (23.19%), Postives = 202/483 (41.82%), Query Frame = 3
Query: 4419 NIQEMFQKKYSVCESHKLSTKVMQVSDLGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFGTMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLS-IKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCY-RTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFE---HAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEI 5852
             + E+ + K++     ++  ++ Q+ +L     C+  ++    ++  +K+   V+  K++ L    G          L  L  L +S   LH + P        L+ L  D N + + P  +     L  L+L+     +LP NI  L  +K L +   +++ LP++F +L NL +L L G  +S++     +L  +K  +   N+  +  Q L                  L     EE     + S  R    P EI     L  L   N   + +PD I  L+NL++ V+ G  ++ +L    G L    +     + L  PPYE+  +G+  +  Y   L         R KL+L+G   AGKT L R+L           +     G+++  W        L + ++D +G   +     FFL+  A+Y+L+ N++       H  +  +L  +    P A +F+VGTH+D   ++E+
Sbjct:   88 RVLELRRNKFTAAP--RVLCELGQLVELDMSHNCLRTLSEGLGQLRALKKLC-VSHNKIQSLPAQIGA---------LQALEELDISFNLLHGL-PRSFSSLTRLRALDADHNQLSQFPVEILALGQLEELDLSGNRFVALPANIWRLTSIKVLWLSSLRMASLPETFCRLQNLESLMLDGNRLSALPPSFGLLQRLKMMNLSSNQLQVFPQAL------------------LGVCGLEEL----YLSRNRLSHVPEEISQLGRLVNLWLDNNSITRLPDSIVDLENLEELVLQG-NHIAVLPDNFGKLSRVNIWKVKDNPLIQPPYEVCMKGIPYIALYQQELAQSQLAVKPRLKLVLMGRKDAGKTLLRRSLMGTR------EDGGGNRGVELVHWEADAHR-KLTFMVFDLSGNPNFDLVKPFFLSPGALYVLVVNLKSYVPKSFHDHVGRFLRLLCAKVPHAVVFVVGTHADLCGEAEL 527          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: rab11ba (ras-related protein Rab-11B [Source:NCBI gene;Acc:101160399])

HSP 1 Score: 57.3806 bits (137), Expect = 3.933e-8
Identity = 43/169 (25.44%), Postives = 75/169 (44.38%), Query Frame = 3
Query: 5460 ETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPS-APIFIVGTHSDKVDKSEIPTTHFQS-RYPSVVGFFFVSSLTGKGVKELHDKIIEE 5960
            E  Y  K++L+G  G GK++L+   T   F      E   T G++  + S +     ++  +WD AGQ  Y      +  G    LL++++ +   +  ++ WL  +  HA S   I +VG  SD      +PT   ++    + + F   S+L    V+E    I+ E
Sbjct:    7 EYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNL----ESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNTLSFIETSALDSTNVEEAFKNILTE 171          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: rab15 (RAB15, member RAS oncogene family [Source:NCBI gene;Acc:101160374])

HSP 1 Score: 56.9954 bits (136), Expect = 5.013e-8
Identity = 45/167 (26.95%), Postives = 78/167 (46.71%), Query Frame = 3
Query: 5478 KLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYN-THQFFLTGRAIYLLIWNV--RQGFEHAGLDFWLNSVTCHAPS-APIFIVGTHSDKVDKSEIPTTH---FQSRYPSVVGFFFVSSLTGKGVKELHDKIIE 5957
            +L+L+G  G GKT L+   T+  F    I+    T G+D    +     + ++  +WD AGQ  Y   T Q++   + I+ L++++   + F+H  +  W + V  +AP      +VG  SD VDK ++ T         Y   + FF  S+ T   + E   ++ E
Sbjct:   10 RLLLLGDSGVGKTCLLCRFTDNEFHPSHIS----TIGVDFKMKTLVIDGVKVRIQIWDTAGQERYQTITKQYYRRAQGIF-LVYDITSERSFQH--IMKWASDVDEYAPDKVQKILVGNKSDDVDKRQVATEQGVKLAQNYG--MDFFETSAFTNHNITETFTRLAE 167          
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Match: rab15 (RAB15, member RAS oncogene family [Source:NCBI gene;Acc:101160374])

HSP 1 Score: 56.9954 bits (136), Expect = 5.013e-8
Identity = 45/167 (26.95%), Postives = 78/167 (46.71%), Query Frame = 3
Query: 5478 KLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYN-THQFFLTGRAIYLLIWNV--RQGFEHAGLDFWLNSVTCHAPS-APIFIVGTHSDKVDKSEIPTTH---FQSRYPSVVGFFFVSSLTGKGVKELHDKIIE 5957
            +L+L+G  G GKT L+   T+  F    I+    T G+D    +     + ++  +WD AGQ  Y   T Q++   + I+ L++++   + F+H  +  W + V  +AP      +VG  SD VDK ++ T         Y   + FF  S+ T   + E   ++ E
Sbjct:   10 RLLLLGDSGVGKTCLLCRFTDNEFHPSHIS----TIGVDFKMKTLVIDGVKVRIQIWDTAGQERYQTITKQYYRRAQGIF-LVYDITSERSFQH--IMKWASDVDEYAPDKVQKILVGNKSDDVDKRQVATEQGVKLAQNYG--MDFFETSAFTNHNITETFTRLAE 167          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000066553.1 (SMESG000066553.1)

HSP 1 Score: 5838.07 bits (15144), Expect = 0.000e+0
Identity = 2931/2931 (100.00%), Postives = 2931/2931 (100.00%), Query Frame = 3
Query:  108 MLKLNYKELFSDLDFEGSYPIEHFATVIPKVVGTSRDIIHFDFSGIDRLSDEVFFVLKEELKVTQKQNVEIIDLTGCCHITDRGIEILSESFINLKELILDGCSQITQLSLYFLMENCSKLTKLSAKFTKISYISNIVDNRWGHESIMYNSLFKENQFAENLPINLVVLVMDTSITCDIGHYLVTGKIRNRKTDQPIIFQPNAMNINETNVNIIQLFCPTVYMAPFITDRSLFIIATDLESDTSNAFNIIKGLDFIRGVVYCCPIQIFSFTSSPSIEKLETLNKVLQSIFSDQQVNMKEHLDQEHYSKSVDKYFIDQWRYVQSLSAIDPEHISLQLLGLYLNDSECNMNYYTTICEPSTNAKIEQTIADFYDTFVNVRDALDRINKADISETKSYTKIPQGLEKLIQCLIQLFHRTQTEFQFLNDPMLMTPFRDYKLLTDDENPENSLNIIKSFFDSKEDLTNNSRGWKLGTAFGLWIEAKWNICEKLAPLKNKLNEFQSMSKTRNDMKTPLELVSVNMKYMIKYMYQHLPSKPTDGISIVTGFIDKQHSPIVTITDISKEISELTSVEISLVLDQLQTTGKVISLFSIGLVIIKVEWFINAMNTILTNWNSPLNNDRVWFLTSQAVLSSIDELAQVLDETTDNELFQNLIKILKHYGLILSVHRSWNTDPLNWEPVDSQDYFNKLLYVSWHQLSLKPDSNIHLVVNKPDLKSNKPSRVLHSVFPDYNTPEFNKDDIXXXXXXXXRIGIPCNLFCQVVSKISLNFRTILLWSQGILVREGAVEVLIFHNIHASRGSSSFDIESRIRGPINGRRPVAVREHKWSVLSEILTIIEAHIIEYPHLHHKIRHYCRGQCYKEFGQENTFSQAEVRKSLNCNYYCNKCREYQMSRSDWLYILGRQMVLPNHDFDKANNGSCRSCWKRKPFSQYLWKSQQKIFPTFGSKVFYSKANKGIKGNLILSGSTESSIISKLKCMKNYLEKAEFQIIDPTNTFIIFFQKMGSSENELFKWDLEKGEITTELKQDIVANICNTKQGDTLGFHFLTEDLENPIMEIEKNHILFGKFNLIHNANIQIRIKVTPEEDESEKLKLIISSLDAGVVGAFHFRPGMILLLKGETKWEPAVITEIIKGKLNCQPLSTVDFNSREIHSTNYQLMSTNSTNILPPGFYPSEINSILDSKNQKSLADSWYKILSQYSEFTPTPFGLFPRLVDKPAYGPLPVFGDDSRECTTSAFGPSKILKLMFFNKPISNRXXXXXXXXXXXXXXVQLLMPQRQIIDHNKNHALHRLCPGNLWRNYLRDMHPMNETPYQMTEGEARYFFQGDFILDVFTIIKNFTTSFSAVYQHIDQCFPEIDPDIDKGFLRDAIISISKAYRDIILFDIVAKIQVYSNNIMFVDKNGDNILSTXXXXXXXXXXPQLAPISSELNGEYFTLSWTEEEMENIQEMFQKKYSVCESHKLSTKVMQVSDLGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFGTMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLHKNQYNVWCEPLIEGTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDKNYTDGALGLETAGDKYINFERVNVYDQKFSELLHDLRTQLDEPDSKTTVVPKPRVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLSVYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEWIKTEIGLLSIEYPKIQFQTSNPSAFEDIFQLVSNKIPSVAPNGETESNLVKMNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFXXXXXXXXXXXXXXXXLMSTNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPINLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNLPYISVIESEESGSLIKLERKRTHLDENLIGNPENYDDSQSNRDAVLLXXXXXXXXXQFSDTDSSIDNRKGGTETNKFLQMVTSSPPINNSFSKERQLKSKNLLPNRXXXXXXXXXXXXXTFQSKTCLIM 8900
            MLKLNYKELFSDLDFEGSYPIEHFATVIPKVVGTSRDIIHFDFSGIDRLSDEVFFVLKEELKVTQKQNVEIIDLTGCCHITDRGIEILSESFINLKELILDGCSQITQLSLYFLMENCSKLTKLSAKFTKISYISNIVDNRWGHESIMYNSLFKENQFAENLPINLVVLVMDTSITCDIGHYLVTGKIRNRKTDQPIIFQPNAMNINETNVNIIQLFCPTVYMAPFITDRSLFIIATDLESDTSNAFNIIKGLDFIRGVVYCCPIQIFSFTSSPSIEKLETLNKVLQSIFSDQQVNMKEHLDQEHYSKSVDKYFIDQWRYVQSLSAIDPEHISLQLLGLYLNDSECNMNYYTTICEPSTNAKIEQTIADFYDTFVNVRDALDRINKADISETKSYTKIPQGLEKLIQCLIQLFHRTQTEFQFLNDPMLMTPFRDYKLLTDDENPENSLNIIKSFFDSKEDLTNNSRGWKLGTAFGLWIEAKWNICEKLAPLKNKLNEFQSMSKTRNDMKTPLELVSVNMKYMIKYMYQHLPSKPTDGISIVTGFIDKQHSPIVTITDISKEISELTSVEISLVLDQLQTTGKVISLFSIGLVIIKVEWFINAMNTILTNWNSPLNNDRVWFLTSQAVLSSIDELAQVLDETTDNELFQNLIKILKHYGLILSVHRSWNTDPLNWEPVDSQDYFNKLLYVSWHQLSLKPDSNIHLVVNKPDLKSNKPSRVLHSVFPDYNTPEFNKDDISFKFSFKFRIGIPCNLFCQVVSKISLNFRTILLWSQGILVREGAVEVLIFHNIHASRGSSSFDIESRIRGPINGRRPVAVREHKWSVLSEILTIIEAHIIEYPHLHHKIRHYCRGQCYKEFGQENTFSQAEVRKSLNCNYYCNKCREYQMSRSDWLYILGRQMVLPNHDFDKANNGSCRSCWKRKPFSQYLWKSQQKIFPTFGSKVFYSKANKGIKGNLILSGSTESSIISKLKCMKNYLEKAEFQIIDPTNTFIIFFQKMGSSENELFKWDLEKGEITTELKQDIVANICNTKQGDTLGFHFLTEDLENPIMEIEKNHILFGKFNLIHNANIQIRIKVTPEEDESEKLKLIISSLDAGVVGAFHFRPGMILLLKGETKWEPAVITEIIKGKLNCQPLSTVDFNSREIHSTNYQLMSTNSTNILPPGFYPSEINSILDSKNQKSLADSWYKILSQYSEFTPTPFGLFPRLVDKPAYGPLPVFGDDSRECTTSAFGPSKILKLMFFNKPISNRTLTSYLPLPYPLTPVQLLMPQRQIIDHNKNHALHRLCPGNLWRNYLRDMHPMNETPYQMTEGEARYFFQGDFILDVFTIIKNFTTSFSAVYQHIDQCFPEIDPDIDKGFLRDAIISISKAYRDIILFDIVAKIQVYSNNIMFVDKNGDNILSTKKEKKKRNNKPQLAPISSELNGEYFTLSWTEEEMENIQEMFQKKYSVCESHKLSTKVMQVSDLGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFGTMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFSLLNSLELNNTLISSLPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLHKNQYNVWCEPLIEGTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDKNYTDGALGLETAGDKYINFERVNVYDQKFSELLHDLRTQLDEPDSKTTVVPKPRVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLSVYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEWIKTEIGLLSIEYPKIQFQTSNPSAFEDIFQLVSNKIPSVAPNGETESNLVKMNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFIDIKDEIEETTIINDDLMSTNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPINLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNLPYISVIESEESGSLIKLERKRTHLDENLIGNPENYDDSQSNRDAVLLEKIEEIIKEQFSDTDSSIDNRKGGTETNKFLQMVTSSPPINNSFSKERQLKSKNLLPNRKLIPPLKVIKIPPTFQSKTCLIM
Sbjct:    1 MLKLNYKELFSDLDFEGSYPIEHFATVIPKVVGTSRDIIHFDFSGIDRLSDEVFFVLKEELKVTQKQNVEIIDLTGCCHITDRGIEILSESFINLKELILDGCSQITQLSLYFLMENCSKLTKLSAKFTKISYISNIVDNRWGHESIMYNSLFKENQFAENLPINLVVLVMDTSITCDIGHYLVTGKIRNRKTDQPIIFQPNAMNINETNVNIIQLFCPTVYMAPFITDRSLFIIATDLESDTSNAFNIIKGLDFIRGVVYCCPIQIFSFTSSPSIEKLETLNKVLQSIFSDQQVNMKEHLDQEHYSKSVDKYFIDQWRYVQSLSAIDPEHISLQLLGLYLNDSECNMNYYTTICEPSTNAKIEQTIADFYDTFVNVRDALDRINKADISETKSYTKIPQGLEKLIQCLIQLFHRTQTEFQFLNDPMLMTPFRDYKLLTDDENPENSLNIIKSFFDSKEDLTNNSRGWKLGTAFGLWIEAKWNICEKLAPLKNKLNEFQSMSKTRNDMKTPLELVSVNMKYMIKYMYQHLPSKPTDGISIVTGFIDKQHSPIVTITDISKEISELTSVEISLVLDQLQTTGKVISLFSIGLVIIKVEWFINAMNTILTNWNSPLNNDRVWFLTSQAVLSSIDELAQVLDETTDNELFQNLIKILKHYGLILSVHRSWNTDPLNWEPVDSQDYFNKLLYVSWHQLSLKPDSNIHLVVNKPDLKSNKPSRVLHSVFPDYNTPEFNKDDISFKFSFKFRIGIPCNLFCQVVSKISLNFRTILLWSQGILVREGAVEVLIFHNIHASRGSSSFDIESRIRGPINGRRPVAVREHKWSVLSEILTIIEAHIIEYPHLHHKIRHYCRGQCYKEFGQENTFSQAEVRKSLNCNYYCNKCREYQMSRSDWLYILGRQMVLPNHDFDKANNGSCRSCWKRKPFSQYLWKSQQKIFPTFGSKVFYSKANKGIKGNLILSGSTESSIISKLKCMKNYLEKAEFQIIDPTNTFIIFFQKMGSSENELFKWDLEKGEITTELKQDIVANICNTKQGDTLGFHFLTEDLENPIMEIEKNHILFGKFNLIHNANIQIRIKVTPEEDESEKLKLIISSLDAGVVGAFHFRPGMILLLKGETKWEPAVITEIIKGKLNCQPLSTVDFNSREIHSTNYQLMSTNSTNILPPGFYPSEINSILDSKNQKSLADSWYKILSQYSEFTPTPFGLFPRLVDKPAYGPLPVFGDDSRECTTSAFGPSKILKLMFFNKPISNRTLTSYLPLPYPLTPVQLLMPQRQIIDHNKNHALHRLCPGNLWRNYLRDMHPMNETPYQMTEGEARYFFQGDFILDVFTIIKNFTTSFSAVYQHIDQCFPEIDPDIDKGFLRDAIISISKAYRDIILFDIVAKIQVYSNNIMFVDKNGDNILSTKKEKKKRNNKPQLAPISSELNGEYFTLSWTEEEMENIQEMFQKKYSVCESHKLSTKVMQVSDLGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFGTMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFSLLNSLELNNTLISSLPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLHKNQYNVWCEPLIEGTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDKNYTDGALGLETAGDKYINFERVNVYDQKFSELLHDLRTQLDEPDSKTTVVPKPRVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLSVYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEWIKTEIGLLSIEYPKIQFQTSNPSAFEDIFQLVSNKIPSVAPNGETESNLVKMNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFIDIKDEIEETTIINDDLMSTNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPINLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNLPYISVIESEESGSLIKLERKRTHLDENLIGNPENYDDSQSNRDAVLLEKIEEIIKEQFSDTDSSIDNRKGGTETNKFLQMVTSSPPINNSFSKERQLKSKNLLPNRKLIPPLKVIKIPPTFQSKTCLIM 2931          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000066553.1 (SMESG000066553.1)

HSP 1 Score: 5833.83 bits (15133), Expect = 0.000e+0
Identity = 2931/2937 (99.80%), Postives = 2931/2937 (99.80%), Query Frame = 3
Query:  108 MLKLNYKELFSDLDFEGSYPIEHFATVIPKVVGTSRDIIHFDFSGIDRLSDEVFFVLKEELKVTQKQNVEIIDLTGCCHITDRGIEILSESFINLKELILDGCSQITQLSLYFLMENCSKLTKLSAKFTKISYISNIVDNRWGHESIMYNSLFKENQFAENLPINLVVLVMDTSITCDIGHYLVTGKIRNRKTDQPIIFQPNAMNINETNVNIIQLFCPTVYMAPFITDRSLFIIATDLESDTSNAFNIIKGLDFIRGVVYCCPIQIFSFTSSPSIEKLETLNKVLQSIFSDQQVNMKEHLDQEHYSKSVDKYFIDQWRYVQSLSAIDPEHISLQLLGLYLNDSECNMNYYTTICEPSTNAKIEQTIADFYDTFVNVRDALDRINKADISETKSYTKIPQGLEKLIQCLIQLFHRTQTEFQFLNDPMLMTPFRDYKLLTDDENPENSLNIIKSFFDSKEDLTN------NSRGWKLGTAFGLWIEAKWNICEKLAPLKNKLNEFQSMSKTRNDMKTPLELVSVNMKYMIKYMYQHLPSKPTDGISIVTGFIDKQHSPIVTITDISKEISELTSVEISLVLDQLQTTGKVISLFSIGLVIIKVEWFINAMNTILTNWNSPLNNDRVWFLTSQAVLSSIDELAQVLDETTDNELFQNLIKILKHYGLILSVHRSWNTDPLNWEPVDSQDYFNKLLYVSWHQLSLKPDSNIHLVVNKPDLKSNKPSRVLHSVFPDYNTPEFNKDDIXXXXXXXXRIGIPCNLFCQVVSKISLNFRTILLWSQGILVREGAVEVLIFHNIHASRGSSSFDIESRIRGPINGRRPVAVREHKWSVLSEILTIIEAHIIEYPHLHHKIRHYCRGQCYKEFGQENTFSQAEVRKSLNCNYYCNKCREYQMSRSDWLYILGRQMVLPNHDFDKANNGSCRSCWKRKPFSQYLWKSQQKIFPTFGSKVFYSKANKGIKGNLILSGSTESSIISKLKCMKNYLEKAEFQIIDPTNTFIIFFQKMGSSENELFKWDLEKGEITTELKQDIVANICNTKQGDTLGFHFLTEDLENPIMEIEKNHILFGKFNLIHNANIQIRIKVTPEEDESEKLKLIISSLDAGVVGAFHFRPGMILLLKGETKWEPAVITEIIKGKLNCQPLSTVDFNSREIHSTNYQLMSTNSTNILPPGFYPSEINSILDSKNQKSLADSWYKILSQYSEFTPTPFGLFPRLVDKPAYGPLPVFGDDSRECTTSAFGPSKILKLMFFNKPISNRXXXXXXXXXXXXXXVQLLMPQRQIIDHNKNHALHRLCPGNLWRNYLRDMHPMNETPYQMTEGEARYFFQGDFILDVFTIIKNFTTSFSAVYQHIDQCFPEIDPDIDKGFLRDAIISISKAYRDIILFDIVAKIQVYSNNIMFVDKNGDNILSTXXXXXXXXXXPQLAPISSELNGEYFTLSWTEEEMENIQEMFQKKYSVCESHKLSTKVMQVSDLGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFGTMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFXXXXXXXXXXXXXXXXPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLHKNQYNVWCEPLIEGTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDKNYTDGALGLETAGDKYINFERVNVYDQKFSELLHDLRTQLDEPDSKTTVVPKPRVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLSVYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEWIKTEIGLLSIEYPKIQFQTSNPSAFEDIFQLVSNKIPSVAPNGETESNLVKMNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFXXXXXXXXXXXXXXXXLMSTNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPINLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNLPYISVIESEESGSLIKLERKRTHLDENLIGNPENYDDSQSNRDAVLLXXXXXXXXXQFSDTDSSIDNRKGGTETNKFLQMVTSSPPINNSFSKERQLKSKNLLPNRXXXXXXXXXXXXXTFQSKTCLIM 8900
            MLKLNYKELFSDLDFEGSYPIEHFATVIPKVVGTSRDIIHFDFSGIDRLSDEVFFVLKEELKVTQKQNVEIIDLTGCCHITDRGIEILSESFINLKELILDGCSQITQLSLYFLMENCSKLTKLSAKFTKISYISNIVDNRWGHESIMYNSLFKENQFAENLPINLVVLVMDTSITCDIGHYLVTGKIRNRKTDQPIIFQPNAMNINETNVNIIQLFCPTVYMAPFITDRSLFIIATDLESDTSNAFNIIKGLDFIRGVVYCCPIQIFSFTSSPSIEKLETLNKVLQSIFSDQQVNMKEHLDQEHYSKSVDKYFIDQWRYVQSLSAIDPEHISLQLLGLYLNDSECNMNYYTTICEPSTNAKIEQTIADFYDTFVNVRDALDRINKADISETKSYTKIPQGLEKLIQCLIQLFHRTQTEFQFLNDPMLMTPFRDYKLLTDDENPENSLNIIKSFFDSKEDLTN      NSRGWKLGTAFGLWIEAKWNICEKLAPLKNKLNEFQSMSKTRNDMKTPLELVSVNMKYMIKYMYQHLPSKPTDGISIVTGFIDKQHSPIVTITDISKEISELTSVEISLVLDQLQTTGKVISLFSIGLVIIKVEWFINAMNTILTNWNSPLNNDRVWFLTSQAVLSSIDELAQVLDETTDNELFQNLIKILKHYGLILSVHRSWNTDPLNWEPVDSQDYFNKLLYVSWHQLSLKPDSNIHLVVNKPDLKSNKPSRVLHSVFPDYNTPEFNKDDISFKFSFKFRIGIPCNLFCQVVSKISLNFRTILLWSQGILVREGAVEVLIFHNIHASRGSSSFDIESRIRGPINGRRPVAVREHKWSVLSEILTIIEAHIIEYPHLHHKIRHYCRGQCYKEFGQENTFSQAEVRKSLNCNYYCNKCREYQMSRSDWLYILGRQMVLPNHDFDKANNGSCRSCWKRKPFSQYLWKSQQKIFPTFGSKVFYSKANKGIKGNLILSGSTESSIISKLKCMKNYLEKAEFQIIDPTNTFIIFFQKMGSSENELFKWDLEKGEITTELKQDIVANICNTKQGDTLGFHFLTEDLENPIMEIEKNHILFGKFNLIHNANIQIRIKVTPEEDESEKLKLIISSLDAGVVGAFHFRPGMILLLKGETKWEPAVITEIIKGKLNCQPLSTVDFNSREIHSTNYQLMSTNSTNILPPGFYPSEINSILDSKNQKSLADSWYKILSQYSEFTPTPFGLFPRLVDKPAYGPLPVFGDDSRECTTSAFGPSKILKLMFFNKPISNRTLTSYLPLPYPLTPVQLLMPQRQIIDHNKNHALHRLCPGNLWRNYLRDMHPMNETPYQMTEGEARYFFQGDFILDVFTIIKNFTTSFSAVYQHIDQCFPEIDPDIDKGFLRDAIISISKAYRDIILFDIVAKIQVYSNNIMFVDKNGDNILSTKKEKKKRNNKPQLAPISSELNGEYFTLSWTEEEMENIQEMFQKKYSVCESHKLSTKVMQVSDLGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFGTMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFSLLNSLELNNTLISSLPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLHKNQYNVWCEPLIEGTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDKNYTDGALGLETAGDKYINFERVNVYDQKFSELLHDLRTQLDEPDSKTTVVPKPRVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLSVYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEWIKTEIGLLSIEYPKIQFQTSNPSAFEDIFQLVSNKIPSVAPNGETESNLVKMNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFIDIKDEIEETTIINDDLMSTNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPINLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNLPYISVIESEESGSLIKLERKRTHLDENLIGNPENYDDSQSNRDAVLLEKIEEIIKEQFSDTDSSIDNRKGGTETNKFLQMVTSSPPINNSFSKERQLKSKNLLPNRKLIPPLKVIKIPPTFQSKTCLIM
Sbjct:    1 MLKLNYKELFSDLDFEGSYPIEHFATVIPKVVGTSRDIIHFDFSGIDRLSDEVFFVLKEELKVTQKQNVEIIDLTGCCHITDRGIEILSESFINLKELILDGCSQITQLSLYFLMENCSKLTKLSAKFTKISYISNIVDNRWGHESIMYNSLFKENQFAENLPINLVVLVMDTSITCDIGHYLVTGKIRNRKTDQPIIFQPNAMNINETNVNIIQLFCPTVYMAPFITDRSLFIIATDLESDTSNAFNIIKGLDFIRGVVYCCPIQIFSFTSSPSIEKLETLNKVLQSIFSDQQVNMKEHLDQEHYSKSVDKYFIDQWRYVQSLSAIDPEHISLQLLGLYLNDSECNMNYYTTICEPSTNAKIEQTIADFYDTFVNVRDALDRINKADISETKSYTKIPQGLEKLIQCLIQLFHRTQTEFQFLNDPMLMTPFRDYKLLTDDENPENSLNIIKSFFDSKEDLTNLNSTIVNSRGWKLGTAFGLWIEAKWNICEKLAPLKNKLNEFQSMSKTRNDMKTPLELVSVNMKYMIKYMYQHLPSKPTDGISIVTGFIDKQHSPIVTITDISKEISELTSVEISLVLDQLQTTGKVISLFSIGLVIIKVEWFINAMNTILTNWNSPLNNDRVWFLTSQAVLSSIDELAQVLDETTDNELFQNLIKILKHYGLILSVHRSWNTDPLNWEPVDSQDYFNKLLYVSWHQLSLKPDSNIHLVVNKPDLKSNKPSRVLHSVFPDYNTPEFNKDDISFKFSFKFRIGIPCNLFCQVVSKISLNFRTILLWSQGILVREGAVEVLIFHNIHASRGSSSFDIESRIRGPINGRRPVAVREHKWSVLSEILTIIEAHIIEYPHLHHKIRHYCRGQCYKEFGQENTFSQAEVRKSLNCNYYCNKCREYQMSRSDWLYILGRQMVLPNHDFDKANNGSCRSCWKRKPFSQYLWKSQQKIFPTFGSKVFYSKANKGIKGNLILSGSTESSIISKLKCMKNYLEKAEFQIIDPTNTFIIFFQKMGSSENELFKWDLEKGEITTELKQDIVANICNTKQGDTLGFHFLTEDLENPIMEIEKNHILFGKFNLIHNANIQIRIKVTPEEDESEKLKLIISSLDAGVVGAFHFRPGMILLLKGETKWEPAVITEIIKGKLNCQPLSTVDFNSREIHSTNYQLMSTNSTNILPPGFYPSEINSILDSKNQKSLADSWYKILSQYSEFTPTPFGLFPRLVDKPAYGPLPVFGDDSRECTTSAFGPSKILKLMFFNKPISNRTLTSYLPLPYPLTPVQLLMPQRQIIDHNKNHALHRLCPGNLWRNYLRDMHPMNETPYQMTEGEARYFFQGDFILDVFTIIKNFTTSFSAVYQHIDQCFPEIDPDIDKGFLRDAIISISKAYRDIILFDIVAKIQVYSNNIMFVDKNGDNILSTKKEKKKRNNKPQLAPISSELNGEYFTLSWTEEEMENIQEMFQKKYSVCESHKLSTKVMQVSDLGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLEVDFGTMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGNPIREVPEILCMFSLLNSLELNNTLISSLPDNIGNLKFLKYLSIERTKLSGLPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVLQEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLHKNQYNVWCEPLIEGTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDKNYTDGALGLETAGDKYINFERVNVYDQKFSELLHDLRTQLDEPDSKTTVVPKPRVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLSVYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEWIKTEIGLLSIEYPKIQFQTSNPSAFEDIFQLVSNKIPSVAPNGETESNLVKMNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFIDIKDEIEETTIINDDLMSTNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPINLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNLPYISVIESEESGSLIKLERKRTHLDENLIGNPENYDDSQSNRDAVLLEKIEEIIKEQFSDTDSSIDNRKGGTETNKFLQMVTSSPPINNSFSKERQLKSKNLLPNRKLIPPLKVIKIPPTFQSKTCLIM 2937          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000073246.1 (SMESG000073246.1)

HSP 1 Score: 522.316 bits (1344), Expect = 1.422e-148
Identity = 361/1173 (30.78%), Postives = 596/1173 (50.81%), Query Frame = 3
Query: 5178 FPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANL---QILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEA---ITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQE--FNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIA-----EREPEPFVFNKSILQRATQSKTI-----FIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLH--KNQYNVWCEPLIE--GTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDKNYTDGALGLETAGDKYIN------------FERVNVYDQKFS-ELLHDLRTQLDEPDSKTTVVPKP----RVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLS--VYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEW-IKTEIGLLSIEYPK---IQFQTSNPSAFEDIFQLVSNKI---PSVAPNGETESNLVKMNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFXXXXXXXXXXXXXXXXLMSTNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPINLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNL-PYISVIESEESG 8549
            FP+ IL    L TL+  +Q    VPD IQ L+NL+  ++D   N    ++ +     + ++ L   +C ++  PP EI  +G    ++YL  L++ +  C RTKLM VGLG AGKTSL+ AL +    A +I E+    +TDGIDI  W+       +QYS WDFAGQ +YYNTHQFFL+ +AIY+++W+VRQG EH  LDFWL+S++CH+  AP+F+VGT  D+V       +  + RY  +  F  V SL+G G+K+L  K+I  T   PY+ + +P+  L  E +  S RS  +Y+ ++  + +A +  I++ ++   I+ LHD GSIQYF+  +LK++V+IN QW+VD+MA VVSV N  I+NG   H  +K VW K+   +  W+L LTE FDLTF  P  E   N +PCLL  ++PE  WP+F +    +  ++ Y+FE+LP GLFNR QVRL  F+++  +W+ G    KN    L  + N ++L V A G  P N+L +V ++ + L+  +F GV+Y  +ISC  CI        +   +  N S++      K +     ++QC    H+ ++  I+E+TP                  +A+ E+  + ++     S  Q   SL  +S +LV  LH  K+  ++   P+ E      D  I  +  +E        + +N +LC+     + I + K   +    K      + L  + DK I             F ++N    K S E + +++  + +    +TV          F+SYCW NSQ A + G   +         DPR +  Y+   G+ CW+D   +  +  + S ++  LRNS++M+A +S EY +SD CK E  F  + L  P+    VG + EW   +E+GL+  +  +   + F  +N  +   + + +  ++   P +A   + + N ++ +  A  E  ELI R+I   L S I        PRL  ID+  +    + I++D++  + L +   L ++     L  K++CE E+ WH  D+  P  LS  + + ++   + YLY I  + ++     +R    + N    +++ ++ +    S    K  ++ +  + M  D  L    L+   L +G+  W+C +H++  P   +IE + + 
Sbjct: 2021 FPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLE--ILDLSYNPLLEKVSAQISSIISIKQLILVHCPSISVPPPEIIARGTS--LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLALVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEE-LHLNSIKSIKENTPE-----------------TASAEEFINDLI-----SKVQTVKSLYASSDKLVTFLHSTKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYIKLLKKKFILLILSSDKEIRQKWEYYPYFMTVFIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTSGLNSQLSLNLRNSKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYE-KNDQNKIQGHNTALMEQLELISRQILNQLISFITDN----CPRLIVIDVDPDDGTDSQIDNDIIMDSTLQSS--LRASVSGNKLALKVICEGETNWHIADEAYP--LSIEDKDEIIEKCAVYLYMIYQVFEYK-NPGLRCLQPD-NISNMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPKLVNCSLERYRLPSGREFWMCKKHADQNPRCKLIERDRAA 3155          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000073246.1 (SMESG000073246.1)

HSP 1 Score: 521.931 bits (1343), Expect = 1.540e-148
Identity = 361/1173 (30.78%), Postives = 596/1173 (50.81%), Query Frame = 3
Query: 5178 FPVEILHCTNLQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANL---QILSSYVGTLPLEVLSCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEA---ITDGIDINSWSTKTGEINLQYSLWDFAGQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIEETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANNNAIYDGEINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIENGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQE--FNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFIIWQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISEAFSGVKYEYQISCKKCIA-----EREPEPFVFNKSILQRATQSKTI-----FIQCHRNFHIITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDYQNDSSLLNTSKRLVKDLH--KNQYNVWCEPLIE--GTPEDKYIDMLTRSEAVISVISGNFTNNRLCMNLFKLSKITLRKNIILARIDKNYTDGALGLETAGDKYIN------------FERVNVYDQKFS-ELLHDLRTQLDEPDSKTTVVPKP----RVFISYCWDNSQRAFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLS--VYSDITSGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEW-IKTEIGLLSIEYPK---IQFQTSNPSAFEDIFQLVSNKI---PSVAPNGETESNLVKMNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFXXXXXXXXXXXXXXXXLMSTNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPINLSHSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLEANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHSNL-PYISVIESEESG 8549
            FP+ IL    L TL+  +Q    VPD IQ L+NL+  ++D   N    ++ +     + ++ L   +C ++  PP EI  +G    ++YL  L++ +  C RTKLM VGLG AGKTSL+ AL +    A +I E+    +TDGIDI  W+       +QYS WDFAGQ +YYNTHQFFL+ +AIY+++W+VRQG EH  LDFWL+S++CH+  AP+F+VGT  D+V       +  + RY  +  F  V SL+G G+K+L  K+I  T   PY+ + +P+  L  E +  S RS  +Y+ ++  + +A +  I++ ++   I+ LHD GSIQYF+  +LK++V+IN QW+VD+MA VVSV N  I+NG   H  +K VW K+   +  W+L LTE FDLTF  P  E   N +PCLL  ++PE  WP+F +    +  ++ Y+FE+LP GLFNR QVRL  F+++  +W+ G    KN    L  + N ++L V A G  P N+L +V ++ + L+  +F GV+Y  +ISC  CI        +   +  N S++      K +     ++QC    H+ ++  I+E+TP                  +A+ E+  + ++     S  Q   SL  +S +LV  LH  K+  ++   P+ E      D  I  +  +E        + +N +LC+     + I + K   +    K      + L  + DK I             F ++N    K S E + +++  + +    +TV          F+SYCW NSQ A + G   +         DPR +  Y+   G+ CW+D   +  +  + S ++  LRNS++M+A +S EY +SD CK E  F  + L  P+    VG + EW   +E+GL+  +  +   + F  +N  +   + + +  ++   P +A   + + N ++ +  A  E  ELI R+I   L S I        PRL  ID+  +    + I++D++  + L +   L ++     L  K++CE E+ WH  D+  P  LS  + + ++   + YLY I  + ++     +R    + N    +++ ++ +    S    K  ++ +  + M  D  L    L+   L +G+  W+C +H++  P   +IE + + 
Sbjct: 1995 FPMAILQLKKLITLVIQHQSIRYVPDSIQQLENLE--ILDLSYNPLLEKVSAQISSIISIKQLILVHCPSISVPPPEIIARGTS--LSYLKYLLAKTVVCNRTKLMFVGLGEAGKTSLLHALRSDENSAKEIIEQQEKQVTDGIDITKWTVICHNEEIQYSAWDFAGQDVYYNTHQFFLSEKAIYIVVWSVRQGIEHGDLDFWLSSISCHSKYAPVFVVGTRCDQVQADMSCFSSLKKRYSQIEDFILVDSLSGTGIKDLKQKLIHVTLNLPYMHQAIPSTILDLENQFTSIRSQKNYITYQEFQNIAISQGIFEKDVKSVIQILHDFGSIQYFDTEILKNYVVINPQWIVDIMANVVSVVNQKIKNGIFYHENMKDVWDKFESKLFNWMLNLTEEFDLTFPHPTMEPKANIVPCLLSEEEPEIEWPKFSEQTLCKFYHINYKFEFLPAGLFNRIQVRLFDFTEAKKLWKYGMYFEKNGHHVLFMRENKSSLIVRAIGVRPVNVLALVDDVIKGLVKASFHGVRYNLEISCPDCIEYGNNISNDATKYWSNISMIPSKLIKKALIKKVEYLQCEE-LHLNSIKSIKENTPE-----------------TASAEEFINDLI-----SKVQTVKSLYASSDKLVTFLHSTKDLTDLSAMPMKEFDNLFSDCNIVCIKINETSEVKWKTSISNCQLCLICLSENFIQIPKMNEMLEYIKLLKKKFILLILSSDKEIRQKWEYYPYFMTVFIKINATHPKASTEKILEIKKAIQDSIVSSTVNETAGETYDCFVSYCWANSQDAVNKGTKAIPGAIISPDADPRKLARYLIDNGIKCWIDDSHMDKTSGLNSQLSLNLRNSKMMLAFVSDEYDKSDNCKMELNFMVEELRRPVSYVLVGSNMEWRFNSEVGLIMQKRHRSEILDFTNNNNISESRLLEELKVRLRNCPDIAYE-KNDQNKIQGHNTALMEQLELISRQILNQLISFITDN----CPRLIVIDVDPDDGTDSQIDNDIIMDSTLQSS--LRASVSGNKLALKVICEGETNWHIADEAYP--LSIEDKDEIIEKCAVYLYMIYQVFEYK-NPGLRCLQPD-NISNMEFITKITQIAGSSTMTFKESYSNMVKYYMKYDPKLVNCSLERYRLPSGREFWMCKKHADQNPRCKLIERDRAA 3129          
BLAST of Roc domain-containing protein vs. Planmine SMEST
Match: SMESG000056130.1 (SMESG000056130.1)

HSP 1 Score: 122.865 bits (307), Expect = 3.999e-27
Identity = 122/506 (24.11%), Postives = 227/506 (44.86%), Query Frame = 3
Query: 5247 VPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVLSCQNCD--NLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGAGKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSL--WDFAGQTLYYNTHQFFLTGRAIYLLIWNV-RQGFEHAGLDFWLNSVTCHAPSAPIFIVGTHSDKVDKSEIPTT--HFQSR---------YPSVVGFFFVSSLT-GKGVKELHDKII-----EETKGQPYIGELVPNAWLR----FEKELISQRSSADYLNWEAVKKLANNNA--IYDGEINQAIRFLHDLGSIQYFEFPL--LKDFVIINSQWLVDVMACVVSVK--NSIIENGKL----------EHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLPNKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDS-----------FIIWQNGSLLNKNDDKALL 6605
            +  EI +L +L    I    NL+ L   +G L  + L+    D  NL  P +  +   +R ++ Y    +  S      +L+++GL G GKTS++  L       P+   ++    + I    +K  E  + Y L  WD +GQ  ++  H+ FL+ RA YLL++++ ++  E   L   L ++ C AP AP+FIVGTH DK+ ++   T   H +S          +P +    FV +    + +  L +KI+        +    + E  P+++L+    F++ L +   +   L  + VK L   +   + D E+  A++FLH+ G I +F   +  L +   +  QW+  ++   +++   ++ I+NG +          +H   K   +   E++ K  L++ E++D+ F     E   IP  LP + P        +   T + +  + F +LP G + R   R+S  + S           F +W+ G +++  D   L+
Sbjct: 1333 ISSEIGNLSSLTLLDISHNPNLKSLPDEIGLLKGKNLNSLVRDGLNLNIPKHISKNAQLREILKYYYDRLKHSVEYNGLRLVVLGLKGRGKTSVLNLLQGSKL-KPKNNNKSSEIEVSIWKVQSKLSEKAVDYKLTCWDISGQDEFFCNHECFLSQRAFYLLVFDITKETEEIHKLKPLLWNLKCQAPHAPVFIVGTHLDKMKENNRKTQCRHMESNILKLCSTPGFPKISKIVFVDATNFNQTITNLKNKILTVLNDHTIQNDHLLFEKQPSSYLKLEELFQEALKTLPENCPILTEKEVKDLVVKHKLDLNDEELKLAVQFLHNCGVIVHFNDTMENLNNLYFLKPQWICSIIIKTITMNRLDTFIQNGSISLNDFLSLFKDHFFSKETENFKKETLVKQCLKVLELYDVVFRNSNNEI-IIPSKLPIQAP----TNLSENLNTSKISRIFAFSFLPTGFWPRLIARISVLAKSFKHLFDICKLEFKLWRTGVIISMEDSIYLI 1832          
The following BLAST results are available for this feature:
BLAST of Roc domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRK24.649e-3425.05leucine rich repeat kinase 2 [Source:HGNC Symbol;A... [more]
LRRK13.338e-2424.04leucine rich repeat kinase 1 [Source:HGNC Symbol;A... [more]
MFHAS11.986e-1925.31malignant fibrous histiocytoma amplified sequence ... [more]
MFHAS12.313e-1925.31malignant fibrous histiocytoma amplified sequence ... [more]
MFHAS12.313e-1925.31malignant fibrous histiocytoma amplified sequence ... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrk-11.029e-2224.36Leucine-rich repeat serine/threonine-protein kinas... [more]
rab-304.455e-831.30RAB family [Source:UniProtKB/TrEMBL;Acc:Q9XWZ3][more]
rac-21.215e-727.84Ras-related protein rac-2 [Source:UniProtKB/Swiss... [more]
rab-146.971e-722.58RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874][more]
rab-146.971e-722.58RAB family [Source:UniProtKB/TrEMBL;Acc:Q93874][more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrk1.153e-2523.12gene:FBgn0038816 transcript:FBtr0112788[more]
Lrrk1.160e-2523.12gene:FBgn0038816 transcript:FBtr0334640[more]
Lrrk1.307e-2523.12gene:FBgn0038816 transcript:FBtr0334641[more]
Rab143.583e-725.00gene:FBgn0015791 transcript:FBtr0080627[more]
Rab144.806e-725.32gene:FBgn0015791 transcript:FBtr0343678[more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrk18.735e-2622.40leucine-rich repeat kinase 1 [Source:ZFIN;Acc:ZDB-... [more]
ascl1b5.976e-2229.29si:ch211-210p4.6 [Source:NCBI gene;Acc:560440][more]
ascl1b6.068e-2229.29si:ch211-210p4.6 [Source:NCBI gene;Acc:560440][more]
lrrk22.354e-2124.24leucine-rich repeat kinase 2 [Source:ZFIN;Acc:ZDB-... [more]
BX511222.15.891e-2026.22malignant fibrous histiocytoma amplified sequence ... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hes22.457e-3423.90hes family bHLH transcription factor 2 [Source:Xen... [more]
hes22.750e-3423.90hes family bHLH transcription factor 2 [Source:Xen... [more]
hes22.883e-3423.61hes family bHLH transcription factor 2 [Source:Xen... [more]
hes25.126e-3324.21hes family bHLH transcription factor 2 [Source:Xen... [more]
hes25.504e-3324.47hes family bHLH transcription factor 2 [Source:Xen... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrk29.537e-4025.32leucine-rich repeat kinase 2 [Source:MGI Symbol;Ac... [more]
Lrrk12.289e-2523.18leucine-rich repeat kinase 1 [Source:MGI Symbol;Ac... [more]
Mfhas11.349e-1726.14malignant fibrous histiocytoma amplified sequence ... [more]
Mfhas19.401e-1724.94malignant fibrous histiocytoma amplified sequence ... [more]
Rab40c3.049e-825.48Rab40C, member RAS oncogene family [Source:MGI Sym... [more]
back to top
BLAST of Roc domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q55E58|PATS1_DICDI2.359e-7229.52Probable serine/threonine-protein kinase pats1 OS=... [more]
sp|Q8MVR1|GBPC_DICDI4.238e-4625.32Cyclic GMP-binding protein C OS=Dictyostelium disc... [more]
sp|Q6XHB2|ROCO4_DICDI9.471e-4628.14Probable serine/threonine-protein kinase roco4 OS=... [more]
sp|Q1ZXD6|ROCO5_DICDI4.889e-4025.42Probable serine/threonine-protein kinase roco5 OS=... [more]
sp|Q5S006|LRRK2_MOUSE6.671e-3925.32Leucine-rich repeat serine/threonine-protein kinas... [more]
back to top
BLAST of Roc domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TDS13.493e-836.78Roc domain-containing protein OS=Capitella teleta ... [more]
A0A1S3JWY21.015e-5438.39uncharacterized protein LOC106176900 OS=Lingula un... [more]
A0A1S3JRL10.000e+037.98uncharacterized protein LOC106175255 OS=Lingula un... [more]
A0A1S3K0950.000e+037.09uncharacterized protein LOC106177527 isoform X1 OS... [more]
A0A1S3JZG00.000e+037.09uncharacterized protein LOC106177527 isoform X2 OS... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrk22.549e-2623.42leucine-rich repeat kinase 2 [Source:ZFIN;Acc:ZDB-... [more]
lrrk17.599e-2322.50leucine-rich repeat kinase 1 [Source:ZFIN;Acc:ZDB-... [more]
mfhas13.975e-1925.93malignant fibrous histiocytoma amplified sequence ... [more]
ascl1b3.929e-1622.62si:ch211-210p4.6 [Source:NCBI gene;Acc:560440][more]
rhogc3.591e-826.53ras homolog gene family, member Gc [Source:ZFIN;Ac... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004441.11.226e-1529.69pep scaffold:Pmarinus_7.0:GL477554:92318:114375:1 ... [more]
ENSPMAT00000007368.15.558e-825.29pep scaffold:Pmarinus_7.0:GL476419:214196:224439:-... [more]
rab4b1.560e-726.40RAB4B, member RAS oncogene family [Source:NCBI gen... [more]
ENSPMAT00000008655.11.746e-727.31pep scaffold:Pmarinus_7.0:GL484079:6946:12214:1 ge... [more]
ENSPMAT00000001552.17.912e-725.45pep scaffold:Pmarinus_7.0:GL476520:43153:47504:1 g... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
RHO25.485e-827.12Non-essential small GTPase of the Rho/Rac family o... [more]
CDC429.053e-726.09Small rho-like GTPase; essential for establishment... [more]
YPT61.804e-626.22Rab family GTPase; required for endosome-to-Golgii... [more]
RHO43.030e-629.60Non-essential small GTPase; member of the Rho/Rac ... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO319715.196e-4728.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO300912.667e-2226.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470696.812e-1626.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371028.205e-1625.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470011.088e-1528.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Roc domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrk27.045e-2922.76leucine rich repeat kinase 2 [Source:NCBI gene;Acc... [more]
mfhas15.763e-1723.19malignant fibrous histiocytoma amplified sequence ... [more]
rab11ba3.933e-825.44ras-related protein Rab-11B [Source:NCBI gene;Acc:... [more]
rab155.013e-826.95RAB15, member RAS oncogene family [Source:NCBI gen... [more]
rab155.013e-826.95RAB15, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Roc domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066553.10.000e+0100.00SMESG000066553.1[more]
SMESG000066553.10.000e+099.80SMESG000066553.1[more]
SMESG000073246.11.422e-14830.78SMESG000073246.1[more]
SMESG000073246.11.540e-14830.78SMESG000073246.1[more]
SMESG000056130.13.999e-2724.11SMESG000056130.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013176 ID=SMED30013176|Name=Roc domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=8961bp
TGAATTTGAAATGCAATATGATCATCATTAAAAATTGTGCCGTTTAGAGT
AAAATATTTATTATATTGGAAACAATCATAAATTATATTTTATTCTGATA
CTTTGAAATGTTAAAATTAAATTACAAAGAATTATTTAGTGATTTAGATT
TTGAAGGATCATATCCAATAGAACATTTTGCTACTGTTATTCCAAAAGTA
GTCGGTACATCTCGAGACATAATTCATTTCGACTTCAGTGGCATCGATAG
ACTATCAGATGAAGTATTTTTTGTATTGAAAGAAGAATTGAAAGTCACGC
AAAAACAAAATGTTGAAATTATAGATTTGACTGGTTGTTGTCACATAACA
GATAGAGGAATTGAGATTCTTTCCGAATCATTTATTAATCTTAAAGAACT
GATCCTTGATGGATGCAGTCAAATAACTCAGTTGTCATTATATTTCTTAA
TGGAAAATTGTTCAAAGTTGACAAAGTTGTCGGCCAAATTCACAAAGATT
TCATACATCTCAAATATCGTCGATAATAGATGGGGTCACGAATCGATTAT
GTACAATTCTCTTTTTAAAGAAAATCAATTTGCAGAAAATCTTCCGATCA
ATTTGGTAGTATTGGTAATGGATACTTCAATAACTTGTGACATTGGACAT
TATCTGGTTACCGGAAAGATTAGAAATAGGAAAACGGATCAACCTATTAT
TTTTCAACCCAACGCAATGAATATAAATGAAACAAATGTTAACATTATCC
AACTCTTTTGCCCAACTGTATACATGGCTCCATTCATTACCGATAGATCT
CTTTTCATTATTGCTACAGATCTCGAAAGTGATACCAGCAATGCGTTCAA
TATTATAAAAGGACTCGATTTCATTCGAGGAGTAGTTTACTGTTGTCCAA
TCCAGATTTTTTCATTCACTTCTTCTCCTAGCATTGAAAAACTGGAAACA
TTAAACAAAGTATTACAGTCAATATTTTCAGATCAACAAGTAAATATGAA
AGAACATTTAGACCAAGAGCATTATTCAAAGTCCGTTGATAAATATTTCA
TTGACCAATGGCGCTATGTACAATCATTGTCTGCCATAGATCCTGAGCAT
ATTTCACTTCAACTTTTAGGACTTTATCTGAATGATTCTGAATGCAACAT
GAACTATTATACTACAATCTGTGAACCGAGTACAAACGCAAAAATTGAGC
AAACTATTGCAGATTTTTATGACACTTTCGTAAACGTCAGAGATGCATTA
GATAGAATTAACAAAGCAGATATATCAGAGACCAAATCGTATACCAAAAT
ACCCCAAGGACTTGAAAAGCTAATCCAGTGTCTAATTCAATTATTTCATA
GAACACAAACTGAGTTTCAATTTTTAAATGATCCAATGTTGATGACACCA
TTTCGAGATTATAAATTATTAACAGATGATGAAAATCCTGAAAACAGTCT
GAATATTATAAAGAGCTTTTTTGACAGTAAAGAAGACTTAACAAATAATT
CTCGAGGTTGGAAATTAGGAACAGCATTTGGACTTTGGATTGAAGCAAAG
TGGAATATATGCGAAAAGTTGGCACCGTTGAAAAATAAGTTAAACGAATT
TCAATCTATGTCTAAAACCAGAAATGATATGAAAACGCCATTGGAATTGG
TGTCAGTCAATATGAAATACATGATAAAATACATGTATCAACACTTGCCG
TCGAAGCCAACGGATGGGATCTCTATTGTCACAGGATTCATAGATAAACA
ACACTCGCCTATTGTAACCATTACGGATATATCTAAAGAGATATCTGAAC
TTACTTCCGTTGAAATCTCTTTAGTTTTAGATCAACTACAAACTACTGGA
AAAGTGATCTCTCTATTCAGTATAGGATTAGTTATTATTAAAGTGGAATG
GTTTATAAACGCCATGAATACAATATTAACTAATTGGAATTCTCCTTTGA
ATAATGATAGAGTTTGGTTTTTAACCTCTCAAGCGGTTTTGTCCTCAATT
GATGAATTGGCTCAAGTCCTTGATGAGACCACTGACAACGAATTATTTCA
GAATCTTATCAAAATTCTTAAGCATTATGGTTTAATTCTGTCGGTTCATC
GGTCATGGAATACTGATCCATTGAATTGGGAGCCGGTTGATTCTCAGGAC
TATTTTAATAAATTACTTTATGTCAGCTGGCATCAACTGAGTTTAAAACC
GGATTCAAATATTCATTTGGTCGTAAATAAACCTGATCTCAAGTCTAATA
AACCCTCAAGAGTTTTACATAGCGTATTTCCCGACTACAACACCCCAGAA
TTCAACAAAGATGACATATCGTTTAAGTTTTCTTTCAAATTTCGGATCGG
AATCCCATGCAATTTATTCTGTCAAGTTGTGTCTAAAATTTCATTAAATT
TTCGTACAATTTTATTATGGAGCCAAGGAATACTTGTCCGTGAAGGTGCT
GTTGAAGTTCTCATTTTTCACAATATTCATGCAAGTCGCGGATCAAGTTC
TTTTGATATAGAATCAAGAATACGAGGACCAATTAATGGAAGAAGGCCTG
TTGCAGTTCGAGAACATAAATGGAGTGTTTTGAGTGAAATATTAACTATA
ATTGAGGCGCACATTATCGAGTATCCACATCTTCATCATAAGATCCGTCA
CTATTGTCGCGGACAGTGTTACAAGGAGTTTGGTCAAGAAAACACATTTT
CACAAGCTGAAGTTAGAAAAAGTTTAAATTGTAACTATTATTGTAACAAA
TGCCGGGAATATCAAATGTCGAGATCAGACTGGCTTTATATTTTAGGCCG
ACAAATGGTTCTTCCAAATCATGATTTCGATAAGGCAAACAATGGATCGT
GCAGGTCGTGCTGGAAACGCAAACCATTCAGCCAATATTTATGGAAAAGT
CAACAGAAAATATTTCCAACCTTCGGAAGCAAAGTTTTCTATTCTAAAGC
AAACAAAGGCATTAAAGGAAATCTCATTCTATCTGGATCTACTGAATCAT
CAATTATATCAAAACTGAAATGTATGAAAAACTATTTGGAAAAGGCCGAA
TTTCAAATCATTGACCCAACGAACACTTTTATAATATTCTTCCAAAAAAT
GGGTTCTTCTGAGAATGAATTGTTTAAATGGGATTTGGAAAAGGGGGAAA
TAACAACAGAACTGAAACAGGATATTGTTGCAAATATTTGTAATACGAAA
CAAGGAGATACACTTGGATTTCATTTTCTGACAGAAGATCTCGAAAATCC
CATCATGGAAATAGAGAAAAATCATATTTTGTTTGGGAAATTTAATTTAA
TACATAATGCCAATATTCAAATTCGGATAAAAGTGACGCCAGAAGAAGAT
GAATCTGAAAAATTAAAACTAATTATTTCATCTCTTGATGCTGGGGTCGT
TGGAGCTTTTCATTTTCGGCCTGGTATGATACTTTTATTGAAAGGTGAAA
CGAAATGGGAACCTGCAGTAATTACGGAAATAATAAAGGGGAAGCTTAAT
TGTCAGCCTCTAAGTACGGTGGACTTTAATTCTCGGGAAATCCATTCAAC
AAACTATCAACTCATGTCGACAAATTCTACAAATATTTTACCCCCAGGAT
TTTATCCATCAGAAATAAATTCAATTCTAGATTCAAAAAATCAAAAATCG
TTAGCCGATAGTTGGTACAAAATACTCAGTCAATATTCTGAATTTACACC
TACACCTTTTGGATTATTTCCTCGACTAGTTGATAAACCAGCTTATGGCC
CATTACCAGTGTTTGGAGATGATTCCAGAGAATGCACTACAAGCGCTTTT
GGTCCTTCAAAAATTTTGAAATTAATGTTTTTTAACAAACCAATATCAAA
CAGAACTTTGACTTCCTATTTGCCTTTACCTTATCCATTAACTCCTGTTC
AACTTTTGATGCCCCAGAGACAAATTATAGACCACAATAAGAACCATGCA
TTACACAGATTATGTCCTGGTAATTTATGGAGAAACTATCTCAGAGATAT
GCACCCAATGAATGAAACTCCCTATCAAATGACAGAGGGAGAGGCTAGAT
ATTTTTTCCAGGGAGATTTTATTTTAGATGTTTTCACAATTATCAAAAAC
TTCACTACCTCATTTTCAGCAGTTTATCAACACATTGACCAATGTTTTCC
GGAGATTGACCCAGACATTGATAAAGGGTTTCTCAGAGATGCTATTATAA
GCATTAGTAAAGCTTACAGAGATATTATTTTGTTTGATATTGTTGCCAAA
ATTCAAGTCTACAGTAACAATATCATGTTTGTTGATAAAAATGGGGACAA
TATTTTATCTACTAAAAAAGAGAAGAAAAAAAGAAATAATAAGCCACAGT
TAGCTCCCATATCTTCAGAATTGAATGGTGAATATTTTACATTATCTTGG
ACAGAAGAGGAAATGGAAAATATTCAAGAAATGTTTCAGAAAAAGTATTC
CGTCTGCGAAAGCCATAAACTATCGACAAAAGTAATGCAAGTTTCTGATC
TTGGCTCCTATTGCAGATGCATTGCCAATATCGCAATCAAGCGTTCAGAA
ATGGACAATGTTAAAGAAACAGCATTGGTAACTTGTACAAAATTGCGCAA
GCTCGAAGTGGATTTTGGAACTATGATTAATATATCTTGGATAATTTATT
TACCCAAACTTTCTTCTTTAACTCTTTCAAATTGCGGTCTACATGAAATC
GGCCCTGAAATTATTCATTTGAAAGATAGTTTAAAACAGCTTAGTCTTGA
CGGAAATCCTATTCGAGAAGTACCAGAAATTCTCTGCATGTTTTCTCTTC
TTAATAGCTTGGAGCTAAACAATACATTAATTAGTAGTCTGCCAGATAAC
ATAGGTAACCTAAAGTTTTTGAAGTACCTTTCAATAGAACGTACAAAATT
GTCCGGTCTACCTAAATCCTTCTCTCAATTAGCAAACTTATCAACTCTTA
AACTAAGCGGTCCATCAATAAGTAGTATATTTAACAAAAGGTCCGTTTTA
TCTATCAAAGAATGGAGTGATTTCTGTAACAAAACTCACATTAATGGACA
AGTTCTGCAAGAAGAAGAAATATTTAATTTGTTTGAAAGCACAACTTCGA
GCGATGGCGTGTTAAATCGTTCGAGATTCGAGGAGTTTAGAGCACTTTTT
TTCGAAAGTACTCCGAGATTTCGAGAATTCCCAGTTGAAATATTGCATTG
TACAAACCTGCAAACCTTGATATTTTCGAACCAGGGATTTTCAATTGTTC
CCGATGAAATTCAAAGCTTAAAAAATCTAAAGAAATTTGTGATTGATGGA
TGTGCTAATTTGCAAATTTTAAGCAGTTATGTTGGCACTTTGCCATTAGA
AGTTTTAAGTTGTCAGAATTGTGACAATCTCAAAACACCACCGTATGAAA
TTCGCAGGCAAGGAATGAGAAACATGATTGCTTATCTGCTTCGACTTGTA
AGTGGAAGTGAAACTTGTTATAGAACAAAATTAATGTTGGTAGGCTTAGG
CGGTGCTGGTAAAACAAGTCTAATGAGAGCACTGACCAATAAGAATTTTT
GCGCTCCGCAAATTGCGGAAGAAGCTATCACAGATGGTATTGATATCAAC
AGCTGGTCAACTAAAACTGGAGAGATAAATTTACAATATTCCTTATGGGA
TTTTGCTGGTCAAACTCTTTATTACAACACTCATCAATTTTTTCTGACGG
GACGAGCTATTTATTTACTTATTTGGAATGTGAGACAAGGATTTGAACAT
GCGGGTCTGGATTTCTGGTTGAATAGTGTAACATGCCATGCTCCATCAGC
TCCAATATTTATTGTTGGAACTCATTCTGACAAGGTTGACAAAAGTGAAA
TACCCACTACTCACTTTCAATCTCGCTATCCTTCAGTTGTCGGTTTCTTT
TTTGTCAGTTCCTTGACAGGAAAGGGTGTCAAAGAACTTCATGACAAAAT
TATTGAAGAAACAAAGGGACAACCTTACATAGGAGAGCTTGTGCCTAATG
CTTGGTTGAGATTCGAAAAAGAATTAATAAGTCAAAGAAGCAGTGCTGAT
TATTTGAATTGGGAAGCCGTAAAGAAATTGGCCAACAACAATGCTATATA
TGATGGAGAGATAAATCAAGCAATTCGGTTTTTGCATGATTTGGGAAGTA
TTCAATATTTTGAATTCCCTCTTCTAAAGGATTTTGTTATAATCAACTCT
CAATGGCTGGTCGACGTTATGGCCTGCGTTGTCAGTGTAAAAAACTCTAT
AATAGAGAATGGCAAATTGGAGCATTCCAAAATCAAACTTGTTTGGTCTA
AATATCCTGAGTCTATTCATAAATGGCTATTACGTTTGACAGAAATTTTC
GACCTAACCTTTTCTGTTCCAGGACAAGAATTTAATTTCATTCCTTGTCT
GTTACCGAATAAACAACCAGAATTCTCTTGGCCAGAATTTGTAGATTTCA
ATCAAACAAGAGAAGCAAATATGTTTTATCAGTTTGAATATCTACCTCCA
GGTCTATTTAACAGAGCTCAGGTACGCCTGTCTCAATTTTCTGACAGCTT
TATAATATGGCAAAATGGATCTTTGCTCAACAAGAACGACGATAAAGCAC
TATTGACAAAATTAAATGATACCACTTTGAGAGTATGTGCCAGAGGATTT
TGGCCGGAAAATATTTTATTTATTGTTCATGAAATGTTTGAAACTTTGAT
TTCTGAAGCTTTTAGTGGCGTAAAATACGAATATCAAATCTCTTGTAAGA
AGTGTATAGCAGAAAGAGAACCAGAACCTTTTGTTTTTAACAAATCAATA
TTACAAAGAGCTACTCAATCAAAAACAATATTTATTCAATGTCACAGAAA
CTTCCACATTATTACTATGACTGAAATTCAAGAAAGCACTCCTCCAGATT
CAATAGAAGACTACGATTTACAGTTCAAAAAATCTGTTCATTTCATATCA
GCTAACCGTGAACAACATAACCACTCAATCATGATCCTTGTGTCCGAATC
TGATTATCAAAATGATTCCTCTTTACTCAACACCTCAAAAAGATTAGTTA
AAGATTTACATAAAAATCAATATAATGTGTGGTGTGAACCGTTGATTGAA
GGAACCCCAGAAGACAAATATATAGATATGTTAACTCGTTCTGAAGCTGT
TATCAGTGTGATTTCTGGGAACTTTACCAACAACAGACTTTGCATGAATC
TATTTAAATTATCGAAAATTACTTTGAGAAAAAACATAATTCTGGCTCGA
ATTGATAAGAATTATACAGATGGAGCTCTAGGTTTAGAGACTGCTGGGGA
TAAATATATAAACTTTGAACGTGTTAATGTTTATGATCAAAAGTTTAGCG
AACTTCTCCACGATCTCAGAACCCAGCTTGATGAGCCAGATTCTAAAACA
ACTGTCGTGCCAAAACCTAGAGTATTTATATCTTATTGTTGGGACAATTC
TCAACGAGCTTTTGATAGTGGAAATTCCAAAGTCCTCAATAAAAATGCTA
TTGGTTGGGGTGATCCTCGAGATATCAAGGATTATATAGAACAAAAAGGT
TTAAGTTGCTGGTTGGATGTGGAAATGATTGGATTGTCAGTTTATTCTGA
CATAACATCTGGATTACGTAACAGTGAAATAATGGTTGCCTGTCTATCAA
CAGAATACGCCCAATCAGACGCATGCAAAAAAGAATTTATGTTTGCTAGA
CAAAATCTTAATCTACCTATTGTAATAGCGGAAGTTGGTTGTTCTCAAGA
GTGGATAAAGACAGAAATCGGTTTGTTAAGTATAGAATATCCAAAAATTC
AATTCCAGACTTCTAACCCATCAGCTTTTGAAGATATTTTCCAGCTTGTG
AGCAATAAAATTCCTTCTGTCGCGCCAAATGGTGAAACCGAATCCAATTT
AGTAAAAATGAACAAAATAGCTTCACAGGAAGATTTTGAGTTAATTCAAA
GAAAAATCTTTCGACTTTTGTCGTCAGGAATTGGCAGTGAAGAATCAAGA
TTATATCCGAGATTATTTTTTATTGATATCAAAGATGAAATCGAAGAAAC
CACCATTATTAATGATGATTTGATGAGCACGAATCCTTTGTTCAATGGAC
ATCTTTTGTCCTCGAATACCCCAAACATGTCTTTATGTTTCAAGATTTTG
TGTGAAAGTGAAAGCGGTTGGCATACTGTCGATGATGGGATCCCAATAAA
TCTCAGTCATTCAGAATTGGAAAGATTATTGATACTCGGGTCTCCTTATC
TTTATAGAATAACGCTTCTTTTGAAATTTTCAGGTGGAGAAAACATACGT
TTGTTTAATTCGGAAATAAATCAGGAAATAACAAAATATGTCATGGAGTT
GTTAGAAGCGAATTCCAAATCTTGGAGTTATATGAAACCAATTCATAATG
CTTTGAGAACTCATATTATGAGCAGAGATATAAATCTTAGATATGGTGGT
CTGCAAAGCTGTTGTCTCAACAATGGTAAAGTTGTATGGCTGTGTAATGA
ACATAGCAATCTCCCGTACATATCTGTAATTGAGTCTGAAGAATCTGGTT
CTTTGATAAAATTGGAAAGGAAAAGAACACATCTAGACGAAAATTTAATC
GGGAATCCTGAAAATTATGATGATTCCCAGTCAAATAGAGACGCTGTTTT
ATTAGAGAAAATAGAAGAAATAATTAAAGAACAATTTTCAGACACTGATT
CTTCCATTGATAATCGCAAAGGTGGAACTGAAACCAACAAATTTCTTCAA
ATGGTGACTTCATCACCACCCATAAATAATAGTTTTTCTAAAGAAAGGCA
GCTGAAGTCAAAGAATTTATTGCCAAACAGAAAATTAATTCCTCCATTGA
AAGTTATTAAAATTCCTCCAACGTTTCAAAGCAAAACATGCTTAATAATG
TGAATCTTTTTTGTTAAAAGACTTTTTATCATGATAAATTATTTTTGAAA
TATAATCAAAG
back to top

protein sequence of SMED30013176-orf-1

>SMED30013176-orf-1 ID=SMED30013176-orf-1|Name=SMED30013176-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2932bp
MLKLNYKELFSDLDFEGSYPIEHFATVIPKVVGTSRDIIHFDFSGIDRLS
DEVFFVLKEELKVTQKQNVEIIDLTGCCHITDRGIEILSESFINLKELIL
DGCSQITQLSLYFLMENCSKLTKLSAKFTKISYISNIVDNRWGHESIMYN
SLFKENQFAENLPINLVVLVMDTSITCDIGHYLVTGKIRNRKTDQPIIFQ
PNAMNINETNVNIIQLFCPTVYMAPFITDRSLFIIATDLESDTSNAFNII
KGLDFIRGVVYCCPIQIFSFTSSPSIEKLETLNKVLQSIFSDQQVNMKEH
LDQEHYSKSVDKYFIDQWRYVQSLSAIDPEHISLQLLGLYLNDSECNMNY
YTTICEPSTNAKIEQTIADFYDTFVNVRDALDRINKADISETKSYTKIPQ
GLEKLIQCLIQLFHRTQTEFQFLNDPMLMTPFRDYKLLTDDENPENSLNI
IKSFFDSKEDLTNNSRGWKLGTAFGLWIEAKWNICEKLAPLKNKLNEFQS
MSKTRNDMKTPLELVSVNMKYMIKYMYQHLPSKPTDGISIVTGFIDKQHS
PIVTITDISKEISELTSVEISLVLDQLQTTGKVISLFSIGLVIIKVEWFI
NAMNTILTNWNSPLNNDRVWFLTSQAVLSSIDELAQVLDETTDNELFQNL
IKILKHYGLILSVHRSWNTDPLNWEPVDSQDYFNKLLYVSWHQLSLKPDS
NIHLVVNKPDLKSNKPSRVLHSVFPDYNTPEFNKDDISFKFSFKFRIGIP
CNLFCQVVSKISLNFRTILLWSQGILVREGAVEVLIFHNIHASRGSSSFD
IESRIRGPINGRRPVAVREHKWSVLSEILTIIEAHIIEYPHLHHKIRHYC
RGQCYKEFGQENTFSQAEVRKSLNCNYYCNKCREYQMSRSDWLYILGRQM
VLPNHDFDKANNGSCRSCWKRKPFSQYLWKSQQKIFPTFGSKVFYSKANK
GIKGNLILSGSTESSIISKLKCMKNYLEKAEFQIIDPTNTFIIFFQKMGS
SENELFKWDLEKGEITTELKQDIVANICNTKQGDTLGFHFLTEDLENPIM
EIEKNHILFGKFNLIHNANIQIRIKVTPEEDESEKLKLIISSLDAGVVGA
FHFRPGMILLLKGETKWEPAVITEIIKGKLNCQPLSTVDFNSREIHSTNY
QLMSTNSTNILPPGFYPSEINSILDSKNQKSLADSWYKILSQYSEFTPTP
FGLFPRLVDKPAYGPLPVFGDDSRECTTSAFGPSKILKLMFFNKPISNRT
LTSYLPLPYPLTPVQLLMPQRQIIDHNKNHALHRLCPGNLWRNYLRDMHP
MNETPYQMTEGEARYFFQGDFILDVFTIIKNFTTSFSAVYQHIDQCFPEI
DPDIDKGFLRDAIISISKAYRDIILFDIVAKIQVYSNNIMFVDKNGDNIL
STKKEKKKRNNKPQLAPISSELNGEYFTLSWTEEEMENIQEMFQKKYSVC
ESHKLSTKVMQVSDLGSYCRCIANIAIKRSEMDNVKETALVTCTKLRKLE
VDFGTMINISWIIYLPKLSSLTLSNCGLHEIGPEIIHLKDSLKQLSLDGN
PIREVPEILCMFSLLNSLELNNTLISSLPDNIGNLKFLKYLSIERTKLSG
LPKSFSQLANLSTLKLSGPSISSIFNKRSVLSIKEWSDFCNKTHINGQVL
QEEEIFNLFESTTSSDGVLNRSRFEEFRALFFESTPRFREFPVEILHCTN
LQTLIFSNQGFSIVPDEIQSLKNLKKFVIDGCANLQILSSYVGTLPLEVL
SCQNCDNLKTPPYEIRRQGMRNMIAYLLRLVSGSETCYRTKLMLVGLGGA
GKTSLMRALTNKNFCAPQIAEEAITDGIDINSWSTKTGEINLQYSLWDFA
GQTLYYNTHQFFLTGRAIYLLIWNVRQGFEHAGLDFWLNSVTCHAPSAPI
FIVGTHSDKVDKSEIPTTHFQSRYPSVVGFFFVSSLTGKGVKELHDKIIE
ETKGQPYIGELVPNAWLRFEKELISQRSSADYLNWEAVKKLANNNAIYDG
EINQAIRFLHDLGSIQYFEFPLLKDFVIINSQWLVDVMACVVSVKNSIIE
NGKLEHSKIKLVWSKYPESIHKWLLRLTEIFDLTFSVPGQEFNFIPCLLP
NKQPEFSWPEFVDFNQTREANMFYQFEYLPPGLFNRAQVRLSQFSDSFII
WQNGSLLNKNDDKALLTKLNDTTLRVCARGFWPENILFIVHEMFETLISE
AFSGVKYEYQISCKKCIAEREPEPFVFNKSILQRATQSKTIFIQCHRNFH
IITMTEIQESTPPDSIEDYDLQFKKSVHFISANREQHNHSIMILVSESDY
QNDSSLLNTSKRLVKDLHKNQYNVWCEPLIEGTPEDKYIDMLTRSEAVIS
VISGNFTNNRLCMNLFKLSKITLRKNIILARIDKNYTDGALGLETAGDKY
INFERVNVYDQKFSELLHDLRTQLDEPDSKTTVVPKPRVFISYCWDNSQR
AFDSGNSKVLNKNAIGWGDPRDIKDYIEQKGLSCWLDVEMIGLSVYSDIT
SGLRNSEIMVACLSTEYAQSDACKKEFMFARQNLNLPIVIAEVGCSQEWI
KTEIGLLSIEYPKIQFQTSNPSAFEDIFQLVSNKIPSVAPNGETESNLVK
MNKIASQEDFELIQRKIFRLLSSGIGSEESRLYPRLFFIDIKDEIEETTI
INDDLMSTNPLFNGHLLSSNTPNMSLCFKILCESESGWHTVDDGIPINLS
HSELERLLILGSPYLYRITLLLKFSGGENIRLFNSEINQEITKYVMELLE
ANSKSWSYMKPIHNALRTHIMSRDINLRYGGLQSCCLNNGKVVWLCNEHS
NLPYISVIESEESGSLIKLERKRTHLDENLIGNPENYDDSQSNRDAVLLE
KIEEIIKEQFSDTDSSIDNRKGGTETNKFLQMVTSSPPINNSFSKERQLK
SKNLLPNRKLIPPLKVIKIPPTFQSKTCLIM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035897Toll_tir_struct_dom_sf
IPR013684MIRO-like
IPR032675LRR_dom_sf
IPR027417P-loop_NTPase
IPR000157TIR_dom
IPR032171COR
IPR020859ROC_dom
IPR001611Leu-rich_rpt
IPR003133T_Ag_DNA-bd
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0007165signal transduction
GO:0006260DNA replication
GO:0006468protein phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0005515protein binding
GO:0003688DNA replication origin binding
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 1790..1811
score: 37.27
coord: 1930..1952
score: 21.28
coord: 1896..1909
score: 30.16
coord: 1835..1857
score: 24.69
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 1792..1955
e-value: 0.0082
score: -80.7
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 1790..1955
e-value: 3.1E-4
score: -56.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1793..1963
e-value: 3.5E-58
score: 199.3
NoneNo IPR availablePFAMPF08477Roccoord: 1791..1909
e-value: 7.8E-22
score: 77.7
NoneNo IPR availableGENE3DG3DSA:1.10.10.2190coord: 1769..2019
e-value: 3.5E-58
score: 199.3
NoneNo IPR availablePANTHERPTHR23257SERINE-THREONINE PROTEIN KINASEcoord: 1703..2065
NoneNo IPR availablePANTHERPTHR23257:SF711CYCLIC GMP-BINDING PROTEIN C-RELATEDcoord: 1703..2065
NoneNo IPR availableSUPERFAMILYSSF52047RNI-likecoord: 32..129
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 1480..1763
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 1430..1647
e-value: 2.0E-23
score: 84.5
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 5..148
e-value: 4.5E-12
score: 47.5
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 1655..1768
e-value: 1.7E-6
score: 28.8
IPR000157Toll/interleukin-1 receptor homology (TIR) domainPFAMPF13676TIR_2coord: 2471..2532
e-value: 1.6E-8
score: 35.2
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilyGENE3DG3DSA:3.40.50.10140coord: 2405..2549
e-value: 5.3E-12
score: 47.5
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilySUPERFAMILYSSF52200Toll/Interleukin receptor TIR domaincoord: 2473..2557
IPR032171C-terminal of Roc (COR) domainPFAMPF16095CORcoord: 1963..2157
e-value: 1.8E-47
score: 161.7
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 1564..1585
score: 5.317
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 1541..1562
score: 7.335
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 1517..1539
score: 5.895
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 1610..1631
score: 5.394
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 94..115
score: 4.585
IPR020859Roc domainPROSITEPS51424ROCcoord: 1783..1955
score: 44.861
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1788..1964