26S proteasome regulatory subunit 10B

Overview
Name26S proteasome regulatory subunit 10B
Smed IDSMED30013172
Length (bp)925
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 26S proteasome regulatory subunit 10B (SMED30013172) t-SNE clustered cells

Violin plots show distribution of expression levels for 26S proteasome regulatory subunit 10B (SMED30013172) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 26S proteasome regulatory subunit 10B (SMED30013172) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 26S proteasome regulatory subunit 10B (SMED30013172) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013172

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013172h1SMcG0001885 SmedASXL_007374SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30013172h1SMcG0001885 SmedASXL_007375SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30013172h1SMcG0001885 SmedASXL_007375SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Human
Match: PSMC6 (proteasome 26S subunit, ATPase 6 [Source:HGNC Symbol;Acc:HGNC:9553])

HSP 1 Score: 362.459 bits (929), Expect = 2.299e-124
Identity = 166/215 (77.21%), Postives = 196/215 (91.16%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IH+  ++KHG+ D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+  +V+ EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  175 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Human
Match: PSMC6 (proteasome 26S subunit, ATPase 6 [Source:HGNC Symbol;Acc:HGNC:9553])

HSP 1 Score: 362.459 bits (929), Expect = 4.154e-124
Identity = 166/215 (77.21%), Postives = 196/215 (91.16%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IH+  ++KHG+ D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+  +V+ EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  189 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 403          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Human
Match: PSMC5 (proteasome 26S subunit, ATPase 5 [Source:HGNC Symbol;Acc:HGNC:9552])

HSP 1 Score: 243.047 bits (619), Expect = 1.577e-77
Identity = 117/207 (56.52%), Postives = 150/207 (72.46%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   DC F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILD AL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  183 PPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Human
Match: PSMC5 (proteasome 26S subunit, ATPase 5 [Source:HGNC Symbol;Acc:HGNC:9552])

HSP 1 Score: 243.047 bits (619), Expect = 1.577e-77
Identity = 117/207 (56.52%), Postives = 150/207 (72.46%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   DC F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILD AL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  183 PPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Human
Match: PSMC5 (proteasome 26S subunit, ATPase 5 [Source:HGNC Symbol;Acc:HGNC:9552])

HSP 1 Score: 243.047 bits (619), Expect = 1.577e-77
Identity = 117/207 (56.52%), Postives = 150/207 (72.46%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   DC F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILD AL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  183 PPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Celegans
Match: rpt-4 (Probable 26S proteasome regulatory subunit 10B [Source:UniProtKB/Swiss-Prot;Acc:O17071])

HSP 1 Score: 366.311 bits (939), Expect = 5.228e-126
Identity = 164/215 (76.28%), Postives = 202/215 (93.95%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSS+IVDKYIGESAR++REMF YA+ H+PC++FMDEIDAIGG+RF++G S+DREIQRTLMELLNQ+DGFD+LGKVK+IMATNRPD LDPAL+RPGR+DRKIEI LPNE +RL+I+ IHS+K++KHG+ DF+ ++K+S+GF+ ADLRNVCTEAGMFA+RAER +VI+EDF+KAVRKVGD+K+LE+KL+YK V
Sbjct:  192 PPGTGKTLLARAVASQLDCNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDSLGKVKVIMATNRPDTLDPALLRPGRLDRKIEIGLPNEQSRLEILKIHSNKITKHGEIDFEAVVKLSDGFSAADLRNVCTEAGMFAIRAEREFVIDEDFMKAVRKVGDAKRLETKLDYKPV 406          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Celegans
Match: rpt-4 (Probable 26S proteasome regulatory subunit 10B [Source:UniProtKB/Swiss-Prot;Acc:O17071])

HSP 1 Score: 365.54 bits (937), Expect = 6.422e-126
Identity = 164/215 (76.28%), Postives = 202/215 (93.95%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSS+IVDKYIGESAR++REMF YA+ H+PC++FMDEIDAIGG+RF++G S+DREIQRTLMELLNQ+DGFD+LGKVK+IMATNRPD LDPAL+RPGR+DRKIEI LPNE +RL+I+ IHS+K++KHG+ DF+ ++K+S+GF+ ADLRNVCTEAGMFA+RAER +VI+EDF+KAVRKVGD+K+LE+KL+YK V
Sbjct:  184 PPGTGKTLLARAVASQLDCNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDSLGKVKVIMATNRPDTLDPALLRPGRLDRKIEIGLPNEQSRLEILKIHSNKITKHGEIDFEAVVKLSDGFSAADLRNVCTEAGMFAIRAEREFVIDEDFMKAVRKVGDAKRLETKLDYKPV 398          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Celegans
Match: rpt-1 (26S proteasome regulatory subunit 7 [Source:UniProtKB/Swiss-Prot;Acc:Q18787])

HSP 1 Score: 244.202 bits (622), Expect = 6.714e-78
Identity = 107/200 (53.50%), Postives = 149/200 (74.50%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTL ARAVA + D  F++V+ S +V KY+GE AR+VRE+F  A++ + C+IF DEIDA+GG RF DG   D E+QRT++EL+NQ+DGFD  G +K++MATNRPD LDPAL+RPGR+DRK+E +LP+   R  I+ IH+ ++S   D  +D + ++     GA++R+VCTEAGMFA+RA R     +DF++A+ KV
Sbjct:  219 PPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAVGGARFDDGQGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFALPDLAGRAHILKIHAKQMSVERDIRYDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAINKV 418          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Celegans
Match: rpt-1 (26S proteasome regulatory subunit 7 [Source:UniProtKB/Swiss-Prot;Acc:Q18787])

HSP 1 Score: 244.202 bits (622), Expect = 6.714e-78
Identity = 107/200 (53.50%), Postives = 149/200 (74.50%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTL ARAVA + D  F++V+ S +V KY+GE AR+VRE+F  A++ + C+IF DEIDA+GG RF DG   D E+QRT++EL+NQ+DGFD  G +K++MATNRPD LDPAL+RPGR+DRK+E +LP+   R  I+ IH+ ++S   D  +D + ++     GA++R+VCTEAGMFA+RA R     +DF++A+ KV
Sbjct:  219 PPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAVGGARFDDGQGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFALPDLAGRAHILKIHAKQMSVERDIRYDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAINKV 418          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Celegans
Match: rpt-6 (Proteasome Regulatory Particle, ATPase-like [Source:UniProtKB/TrEMBL;Acc:Q9XTT9])

HSP 1 Score: 239.58 bits (610), Expect = 2.969e-76
Identity = 115/207 (55.56%), Postives = 149/207 (71.98%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   +C F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R    +  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILDPAL+RPGRIDRKIE   P+E AR DI+ IHS K++     +   I +   G +GA++++VCTEAGMFA+R  R++V  EDF  AV KV   DS+K
Sbjct:  201 PPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPAPDEKARADILKIHSRKMNLMRGINMAKIAEQIPGASGAEVKSVCTEAGMFALRERRIHVTQEDFEMAVGKVMQKDSEK 407          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Fly
Match: Rpt4 (gene:FBgn0028685 transcript:FBtr0305495)

HSP 1 Score: 362.459 bits (929), Expect = 1.373e-124
Identity = 166/215 (77.21%), Postives = 198/215 (92.09%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLD NF+KVVSS+IVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFD+LG+VK+IMATNRPD LDPAL+RPGR+DRKIEI LPNE ARL+I+ IH+ K++KHG+ D++ I+K+S+ FNGADLRNVCTEAG+FA+RAER YVI EDF+KAVRKV D+KKLESKL+YK V
Sbjct:  183 PPGTGKTLLARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEILKIHALKIAKHGEIDYEAIVKLSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKAVRKVSDNKKLESKLDYKPV 397          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Fly
Match: Rpt4R (gene:FBgn0036224 transcript:FBtr0346545)

HSP 1 Score: 351.288 bits (900), Expect = 4.042e-120
Identity = 156/215 (72.56%), Postives = 196/215 (91.16%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARA+A Q+D NF+KVVSS+IVDKYIGESAR++REMFAYA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFD LG+VK+IMATNRPD LDPAL+RPGR+DRK+EI LPNEVAR+DI+ IH+  L+K G+ D++ ++K+S+ FNGADLRN+CTEAG+FA+R +R +VI EDF+KAVRK+ D+KKLES+L+YK +
Sbjct:  184 PPGTGKTLLARAIASQMDANFLKVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEIPLPNEVARMDILKIHAEPLNKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQEDFMKAVRKIADNKKLESRLDYKPI 398          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Fly
Match: Rpt4R (gene:FBgn0036224 transcript:FBtr0076040)

HSP 1 Score: 351.288 bits (900), Expect = 4.042e-120
Identity = 156/215 (72.56%), Postives = 196/215 (91.16%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARA+A Q+D NF+KVVSS+IVDKYIGESAR++REMFAYA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFD LG+VK+IMATNRPD LDPAL+RPGR+DRK+EI LPNEVAR+DI+ IH+  L+K G+ D++ ++K+S+ FNGADLRN+CTEAG+FA+R +R +VI EDF+KAVRK+ D+KKLES+L+YK +
Sbjct:  184 PPGTGKTLLARAIASQMDANFLKVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKMIMATNRPDTLDPALLRPGRLDRKLEIPLPNEVARMDILKIHAEPLNKRGEIDYEAVVKLSDLFNGADLRNICTEAGLFALRCDREFVIQEDFMKAVRKIADNKKLESRLDYKPI 398          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Fly
Match: Rpt6 (gene:FBgn0020369 transcript:FBtr0077189)

HSP 1 Score: 244.973 bits (624), Expect = 2.215e-78
Identity = 116/207 (56.04%), Postives = 151/207 (72.95%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   +C F++V  S +V K+IGE +R+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILDPAL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  190 PPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 396          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Fly
Match: Rpt1 (gene:FBgn0028687 transcript:FBtr0088947)

HSP 1 Score: 245.358 bits (625), Expect = 3.230e-78
Identity = 111/200 (55.50%), Postives = 148/200 (74.00%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTL ARAVA + D  F++V+ S +V KY+GE AR+VRE+F  A+S + C+IF DEIDAIGG RF DG   D E+QRT++EL+NQ+DGFD  G +K++MATNRPD LDPAL+RPGR+DRK+E  LP++  R  I  IH+  +S   D  FD + ++     GA++R+VCTEAGMFA+RA R     +DF++AV+KV
Sbjct:  217 PPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIRFDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVKKV 416          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 367.081 bits (941), Expect = 2.124e-126
Identity = 169/215 (78.60%), Postives = 195/215 (90.70%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IHS  ++KHGD D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+  YV  EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  175 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHEYVTQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 367.081 bits (941), Expect = 2.124e-126
Identity = 169/215 (78.60%), Postives = 195/215 (90.70%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IHS  ++KHGD D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+  YV  EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  175 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHEYVTQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 367.081 bits (941), Expect = 2.124e-126
Identity = 169/215 (78.60%), Postives = 195/215 (90.70%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IHS  ++KHGD D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+  YV  EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  175 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHEYVTQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Zebrafish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6547])

HSP 1 Score: 243.432 bits (620), Expect = 1.178e-77
Identity = 117/207 (56.52%), Postives = 150/207 (72.46%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   DC F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILD AL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  191 PPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 397          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Zebrafish
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1327])

HSP 1 Score: 243.047 bits (619), Expect = 3.078e-77
Identity = 111/200 (55.50%), Postives = 147/200 (73.50%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTL ARAVA + D  F++V+ S +V KY+GE AR+VRE+F  A++ + C+IF DEIDAIGG RF DG   D E+QRT++EL+NQ+DGFD  G +K++MATNRPD LDPAL+RPGR+DRKIE SLP+   R  I  IH+  +S   D  F+ + ++     GA++R+VCTEAGMFA+RA R     +DF++AV KV
Sbjct:  217 PPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Xenopus
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:394968])

HSP 1 Score: 362.844 bits (930), Expect = 1.782e-125
Identity = 167/215 (77.67%), Postives = 197/215 (91.63%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IH+  ++KHG+ D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+R +V+ EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  118 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADRDFVVQEDFMKAVRKVADSKKLESKLDYKPV 332          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Xenopus
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:394968])

HSP 1 Score: 364.77 bits (935), Expect = 7.919e-125
Identity = 167/215 (77.67%), Postives = 197/215 (91.63%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IH+  ++KHG+ D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+R +V+ EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  205 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADRDFVVQEDFMKAVRKVADSKKLESKLDYKPV 419          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Xenopus
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:394968])

HSP 1 Score: 345.125 bits (884), Expect = 7.028e-118
Identity = 158/210 (75.24%), Postives = 189/210 (90.00%), Query Frame = 2
Query:   17 KTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            + L  RAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IH+  ++KHG+ D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+R +V+ EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  157 RELRERAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADRDFVVQEDFMKAVRKVADSKKLESKLDYKPV 366          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Xenopus
Match: map7 (microtubule associated protein 7 [Source:Xenbase;Acc:XB-GENE-961210])

HSP 1 Score: 243.817 bits (621), Expect = 9.110e-78
Identity = 117/207 (56.52%), Postives = 150/207 (72.46%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   DC F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILD AL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  183 PPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Xenopus
Match: pip5k1a (phosphatidylinositol-4-phosphate 5-kinase, type I, alpha [Source:Xenbase;Acc:XB-GENE-5748350])

HSP 1 Score: 243.047 bits (619), Expect = 1.430e-77
Identity = 111/200 (55.50%), Postives = 147/200 (73.50%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTL ARAVA + D  F++V+ S +V KY+GE AR+VRE+F  A++ + C+IF DEIDAIGG RF DG   D E+QRT++EL+NQ+DGFD  G +K++MATNRPD LDPAL+RPGR+DRKIE SLP+   R  I  IH+  +S   D  F+ + ++     GA++R+VCTEAGMFA+RA R     +DF++AV KV
Sbjct:  182 PPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKV 381          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Mouse
Match: Psmc6 (proteasome (prosome, macropain) 26S subunit, ATPase, 6 [Source:MGI Symbol;Acc:MGI:1914339])

HSP 1 Score: 362.459 bits (929), Expect = 1.579e-124
Identity = 166/215 (77.21%), Postives = 196/215 (91.16%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IH+  ++KHG+ D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+  +V+ EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  175 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Mouse
Match: Psmc5 (protease (prosome, macropain) 26S subunit, ATPase 5 [Source:MGI Symbol;Acc:MGI:105047])

HSP 1 Score: 243.432 bits (620), Expect = 1.205e-77
Identity = 117/207 (56.52%), Postives = 150/207 (72.46%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   DC F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILD AL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  191 PPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 397          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Mouse
Match: Psmc2 (proteasome (prosome, macropain) 26S subunit, ATPase 2 [Source:MGI Symbol;Acc:MGI:109555])

HSP 1 Score: 243.432 bits (620), Expect = 7.007e-77
Identity = 111/200 (55.50%), Postives = 147/200 (73.50%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTL ARAVA + D  F++V+ S +V KY+GE AR+VRE+F  A++ + C+IF DEIDAIGG RF DG   D E+QRT++EL+NQ+DGFD  G +K++MATNRPD LDPAL+RPGR+DRKIE SLP+   R  I  IH+  +S   D  F+ + ++     GA++R+VCTEAGMFA+RA R     +DF++AV KV
Sbjct:  259 PPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 458          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Mouse
Match: Psmc1 (protease (prosome, macropain) 26S subunit, ATPase 1 [Source:MGI Symbol;Acc:MGI:106054])

HSP 1 Score: 232.261 bits (591), Expect = 6.392e-73
Identity = 106/200 (53.00%), Postives = 145/200 (72.50%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTLLA+AVA Q    F++VV S ++ KY+G+  ++VRE+F  A+ H P ++F+DEIDAIG KR+   +  +REIQRT++ELLNQ+DGFD+ G VK+IMATNR + LDPALIRPGRIDRKIE  LP+E  +  I  IH+S+++   D   D ++   +  +GAD++ +CTEAG+ A+R  RM V NEDF K+   V
Sbjct:  227 PPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKKRIFQIHTSRMTLADDVTLDDLIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKENV 426          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Mouse
Match: Psmc3 (proteasome (prosome, macropain) 26S subunit, ATPase 3 [Source:MGI Symbol;Acc:MGI:1098754])

HSP 1 Score: 218.394 bits (555), Expect = 5.547e-68
Identity = 105/214 (49.07%), Postives = 147/214 (68.69%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKA 643
            PPGTGKTLLARA A Q    F+K+    +V  +IG+ A++VR+ FA AK   P +IF+DE+DAIG KRF    + DRE+QRT++ELLNQ+DGF    +VK+I ATNR DILDPAL+R GR+DRKIE  +PNE AR  I+ IHS K++   D +++ + + ++ FNGA  + VC EAGM A+R     + +ED+++ + +V   KK  + L+Y A
Sbjct:  189 PPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKK--ANLQYYA 400          
BLAST of 26S proteasome regulatory subunit 10B vs. UniProt/SwissProt
Match: sp|O17071|PRS10_CAEEL (Probable 26S proteasome regulatory subunit 10B OS=Caenorhabditis elegans OX=6239 GN=rpt-4 PE=1 SV=2)

HSP 1 Score: 366.311 bits (939), Expect = 6.650e-125
Identity = 164/215 (76.28%), Postives = 202/215 (93.95%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSS+IVDKYIGESAR++REMF YA+ H+PC++FMDEIDAIGG+RF++G S+DREIQRTLMELLNQ+DGFD+LGKVK+IMATNRPD LDPAL+RPGR+DRKIEI LPNE +RL+I+ IHS+K++KHG+ DF+ ++K+S+GF+ ADLRNVCTEAGMFA+RAER +VI+EDF+KAVRKVGD+K+LE+KL+YK V
Sbjct:  192 PPGTGKTLLARAVASQLDCNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDSLGKVKVIMATNRPDTLDPALLRPGRLDRKIEIGLPNEQSRLEILKIHSNKITKHGEIDFEAVVKLSDGFSAADLRNVCTEAGMFAIRAEREFVIDEDFMKAVRKVGDAKRLETKLDYKPV 406          
BLAST of 26S proteasome regulatory subunit 10B vs. UniProt/SwissProt
Match: sp|P62334|PRS10_MOUSE (26S proteasome regulatory subunit 10B OS=Mus musculus OX=10090 GN=Psmc6 PE=1 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.104e-123
Identity = 166/215 (77.21%), Postives = 196/215 (91.16%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IH+  ++KHG+ D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+  +V+ EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  175 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit 10B vs. UniProt/SwissProt
Match: sp|P62335|PRS10_ICTTR (26S proteasome regulatory subunit 10B OS=Ictidomys tridecemlineatus OX=43179 GN=PSMC6 PE=2 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.104e-123
Identity = 166/215 (77.21%), Postives = 196/215 (91.16%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IH+  ++KHG+ D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+  +V+ EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  175 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit 10B vs. UniProt/SwissProt
Match: sp|P62333|PRS10_HUMAN (26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.104e-123
Identity = 166/215 (77.21%), Postives = 196/215 (91.16%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IH+  ++KHG+ D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+  +V+ EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  175 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit 10B vs. UniProt/SwissProt
Match: sp|Q2KIW6|PRS10_BOVIN (26S proteasome regulatory subunit 10B OS=Bos taurus OX=9913 GN=PSMC6 PE=2 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 2.525e-122
Identity = 165/215 (76.74%), Postives = 195/215 (90.70%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IH+  ++KHG+ D++ I+K+S+GFNGADL NVCTEAGMFA+RA+  +V+ EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  175 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLGNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit 10B vs. TrEMBL
Match: A0A3M7RPR5 (26S protease regulatory subunit 10B OS=Brachionus plicatilis OX=10195 GN=BpHYR1_035615 PE=3 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 2.408e-126
Identity = 174/215 (80.93%), Postives = 201/215 (93.49%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDC+F+KVVSS+IVDKYIGESAR++REMFAYAK HEPC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTLGKVKIIMATNRPD LDPAL+RPGR+DRKIEISLPNE  RLDI+ IH+S ++K GD DF+ ++K+S+GFNGADLRNVCTEAGMFA+RAER YVI+EDF+KAVRKV +SKKLESKL+YK +
Sbjct:  186 PPGTGKTLLARAVASQLDCSFLKVVSSAIVDKYIGESARMIREMFAYAKDHEPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDTLDPALLRPGRLDRKIEISLPNEQGRLDILKIHASNIAKKGDIDFEAVVKLSDGFNGADLRNVCTEAGMFAIRAERDYVIDEDFMKAVRKVAESKKLESKLDYKPI 400          
BLAST of 26S proteasome regulatory subunit 10B vs. TrEMBL
Match: A0A0B2VH61 (Putative 26S protease regulatory subunit 10B OS=Toxocara canis OX=6265 GN=rpt-4 PE=3 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 3.974e-125
Identity = 167/215 (77.67%), Postives = 203/215 (94.42%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSS+IVDKYIGESAR++REMF YA+ H+PC++FMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFD+LGKVKIIMATNRPD LDPAL+RPGR+DRKIEI LPNE +RL+++ IH+SK++KHGD D++ I+K+S+GF+GADLRNVCTEAG++A+RAER YVI+EDF+KAVRKVGD+KKLE+KL+YK V
Sbjct:  186 PPGTGKTLLARAVASQLDCNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGKVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQSRLEVLKIHASKITKHGDIDYEAIVKLSDGFSGADLRNVCTEAGLYAIRAEREYVIDEDFMKAVRKVGDAKKLETKLDYKPV 400          
BLAST of 26S proteasome regulatory subunit 10B vs. TrEMBL
Match: A0A3P6TLE0 (AAA domain-containing protein OS=Litomosoides sigmodontis OX=42156 GN=NLS_LOCUS5454 PE=3 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 7.395e-125
Identity = 166/215 (77.21%), Postives = 203/215 (94.42%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSS+IVDKYIGESAR++REMF YA+ H+PC++FMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFD+LG+VKIIMATNRPD LDPAL+RPGR+DRKIEI LPNE +RL+++ IH+SK++KHGD D++ ++K+S+GF+GADLRNVCTEAG+FA+RAER YVI+EDF+KAVRKVGD+KKLE+KL+YK V
Sbjct:  184 PPGTGKTLLARAVASQLDCNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGRVKIIMATNRPDTLDPALLRPGRLDRKIEIGLPNEQSRLEVLKIHASKITKHGDIDYEAVVKLSDGFSGADLRNVCTEAGLFAIRAEREYVIDEDFMKAVRKVGDAKKLETKLDYKPV 398          
BLAST of 26S proteasome regulatory subunit 10B vs. TrEMBL
Match: A0A238BPR9 (Putative proteasome-activating nucleotidase OS=Onchocerca flexuosa OX=387005 GN=X798_05703 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.071e-124
Identity = 166/215 (77.21%), Postives = 203/215 (94.42%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSS+IVDKYIGESAR++REMF YA+ H+PC++FMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFD+LG+VKIIMATNRPD LDPAL+RPGR+DRKIEI LPNE +RL+++ IH+SK++KHGD D++ I+K+S+GF+GADLRNVCTEAG+FA+RAER YVI+EDF+KAVRKVGD+K+LE+KL+YK V
Sbjct:  184 PPGTGKTLLARAVASQLDCNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGRVKIIMATNRPDTLDPALLRPGRLDRKIEIGLPNEQSRLEVLKIHASKITKHGDIDYEAIVKLSDGFSGADLRNVCTEAGLFAIRAEREYVIDEDFMKAVRKVGDAKRLETKLDYKPV 398          
BLAST of 26S proteasome regulatory subunit 10B vs. TrEMBL
Match: A0A2K6WM07 (AAA domain-containing protein OS=Onchocerca volvulus OX=6282 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.169e-124
Identity = 166/215 (77.21%), Postives = 203/215 (94.42%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSS+IVDKYIGESAR++REMF YA+ H+PC++FMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFD+LG+VKIIMATNRPD LDPAL+RPGR+DRKIEI LPNE +RL+++ IH+SK++KHGD D++ I+K+S+GF+GADLRNVCTEAG+FA+RAER YVI+EDF+KAVRKVGD+K+LE+KL+YK V
Sbjct:  184 PPGTGKTLLARAVASQLDCNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDSLGRVKIIMATNRPDTLDPALLRPGRLDRKIEIGLPNEQSRLEVLKIHASKITKHGDIDYEAIVKLSDGFSGADLRNVCTEAGLFAIRAEREYVIDEDFMKAVRKVGDAKRLETKLDYKPV 398          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Cavefish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:103029726])

HSP 1 Score: 368.622 bits (945), Expect = 5.191e-127
Identity = 170/215 (79.07%), Postives = 196/215 (91.16%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IHS  ++KHGD D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+R YV  EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  175 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADRDYVTQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Cavefish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:103029726])

HSP 1 Score: 367.081 bits (941), Expect = 7.088e-127
Identity = 170/215 (79.07%), Postives = 196/215 (91.16%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IHS  ++KHGD D++ I+K+S+GFNGADLRNVCTEAGMFA+RA+R YV  EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  151 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSGPITKHGDIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADRDYVTQEDFMKAVRKVADSKKLESKLDYKPV 365          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Cavefish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:103027731])

HSP 1 Score: 244.202 bits (622), Expect = 2.593e-78
Identity = 117/207 (56.52%), Postives = 150/207 (72.46%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   DC F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILD AL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  172 PPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 378          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Cavefish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:103027731])

HSP 1 Score: 244.202 bits (622), Expect = 2.766e-78
Identity = 117/207 (56.52%), Postives = 150/207 (72.46%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   DC F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILD AL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  172 PPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 378          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Cavefish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:103027731])

HSP 1 Score: 243.432 bits (620), Expect = 8.046e-78
Identity = 117/207 (56.52%), Postives = 150/207 (72.46%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   DC F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILD AL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  191 PPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 397          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Sea Lamprey
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6547])

HSP 1 Score: 244.588 bits (623), Expect = 7.457e-79
Identity = 116/207 (56.04%), Postives = 151/207 (72.95%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   +C F++V  S +V K+IGE +R+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILDPAL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  195 PPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 401          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001244.1 (pep scaffold:Pmarinus_7.0:GL482260:6416:9764:-1 gene:ENSPMAG00000001115.1 transcript:ENSPMAT00000001244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 236.113 bits (601), Expect = 2.985e-75
Identity = 110/200 (55.00%), Postives = 144/200 (72.00%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTL ARAVA + D  F++V+ S +V KY+GE AR+VRE+F  A+    C+IF DEIDAIGG RF DG   D E+QRT++EL+NQ+DGFD  G +K++MATNRPD LDPAL+RPGR+DRKIE  LP+   R  I  IH+  +S   D  F+ + ++     GA++R+VCTEAGMFA+RA R     +DF++AV KV
Sbjct:  227 PPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARKA--CLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFGLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKV 424          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010299.1 (pep scaffold:Pmarinus_7.0:GL479893:343:6144:1 gene:ENSPMAG00000009320.1 transcript:ENSPMAT00000010299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.394 bits (555), Expect = 1.081e-68
Identity = 106/214 (49.53%), Postives = 146/214 (68.22%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKA 643
            PPGTGKTLLARA A Q    F+K+    +V  +IG+ A++VR+ FA AK   P +IF+DE+DAIG KRF    + DRE+QRT++ELLNQ+DGF    +VK+I ATNR DILDPAL+R GR+DRKIE  +PNE AR  I+ IHS K++   D +F+ + + ++ FNGA  + VC EAGM A+R     + +ED++  + +V   KK  + L+Y A
Sbjct:  204 PPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNFEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMDGILEVQAKKK--ANLQYYA 415          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006168.1 (pep scaffold:Pmarinus_7.0:GL486395:211235:217029:-1 gene:ENSPMAG00000005566.1 transcript:ENSPMAT00000006168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 2.430e-51
Identity = 81/155 (52.26%), Postives = 108/155 (69.68%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFD 466
            PPG GKT+LA+AVA      F++VV S  V KY+GE  R+VR++F  AK + P +IF+DEIDAI  KRF     +DRE+QR L+ELLNQMDGFD    VK+IMATNR D LDPAL+RPGR+DRKIE  +P+   +  I +  ++K++   + D +
Sbjct:  162 PPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPMPDRRQKRLIFSTVTAKMNLSEEVDLE 316          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Sea Lamprey
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 145.206 bits (365), Expect = 2.250e-40
Identity = 74/184 (40.22%), Postives = 110/184 (59.78%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDII--NIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMR 547
            PPG GKTLLA+A+A +   NF+ +    ++  + GES   VR++F  A+   P V+F+DE+D+I   R            R + ++L +MDG      V II ATNRPDI+DPA++RPGR+D+ I I LP+E +R  I+  N+  S ++K  D D  ++ K + GF+GADL  +C  A   A+R
Sbjct:  159 PPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARQASPTVLFLDELDSIAKARGGGVGDGGGAADRVINQILTEMDGMGVNKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRTAILKANLRKSPIAK--DVDIGYLSKTTNGFSGADLMEICQRACKLAIR 340          

HSP 2 Score: 57.7658 bits (138), Expect = 9.534e-10
Identity = 28/74 (37.84%), Postives = 46/74 (62.16%), Query Frame = 2
Query:  356 GRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINED 577
            GR DR+++I +P+   RL+I+ IH+  +    D D + I   + G  GADL  +C+EA + A+R ++M VI+ D
Sbjct:    1 GRFDREVDIGIPDSTGRLEILQIHTKNMKLSVDVDLEQIANQTHGHVGADLAALCSEAALQAIR-KKMDVIDLD 73          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Yeast
Match: RPT4 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in degradation of ubiquitinated substrates; contributes preferentially to ERAD; required for spindle pole body duplication; mainly nuclear localization [Source:SGD;Acc:S000005785])

HSP 1 Score: 317.39 bits (812), Expect = 3.633e-107
Identity = 145/215 (67.44%), Postives = 179/215 (83.26%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLA+AVA  +  NF+   +S IVDKYIGESARI+REMFAYAK HEPC+IFMDE+DAIGG+RF++G S+DREIQRTLMELL QMDGFD LG+ KIIMATNRPD LDPAL+RPGR+DRK+EI LPNE  RL+I  IH++K+ K G+FDF+  +KMS+GFNGAD+RN  TEAG FA+R +R ++  +D +KAVRKV + KKLE  +EY+ +
Sbjct:  223 PPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPGRLDRKVEIPLPNEAGRLEIFKIHTAKVKKTGEFDFEAAVKMSDGFNGADIRNCATEAGFFAIRDDRDHINPDDLMKAVRKVAEVKKLEGTIEYQKL 437          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Yeast
Match: RPT1 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; required for optimal CDC20 transcription; interacts with Rpn12p and Ubr1p; mutant has aneuploidy tolerance [Source:SGD;Acc:S000001628])

HSP 1 Score: 240.736 bits (613), Expect = 6.780e-77
Identity = 113/213 (53.05%), Postives = 149/213 (69.95%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV-GDSKKLESKLEY 637
            PPGTGKTL ARAVA + D  F++V+ S +V KY+GE AR+VRE+F  A++ + C+IF DEIDA+GG RF DG   D E+QRT++EL+ Q+DGFD  G +K++ ATNRP+ LDPAL+RPGRIDRK+E SLP+   R +I  IHS  +S      ++ I ++     GA+LR+VCTEAGMFA+RA R     +DF+KAV KV    KK  S   Y
Sbjct:  251 PPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRY 463          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Yeast
Match: RPT6 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; bound by ubiquitin-protein ligases Ubr1p and Ufd4p; localized mainly to the nucleus throughout the cell cycle; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003016])

HSP 1 Score: 236.113 bits (601), Expect = 8.658e-76
Identity = 111/200 (55.50%), Postives = 143/200 (71.50%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTLLARAVA   DC F++V  + +V KYIGE +R+VRE+F  A+ H P +IFMDEID+IG  R       D E+QRT++ELLNQ+DGF+T   +KIIMATNR DILDPAL+RPGRIDRKIE   P+  AR +I+ IHS K++     +   + +   G +GAD++ VCTEAGM+A+R  R++V  EDF  AV KV
Sbjct:  190 PPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGSGGGDSEVQRTMLELLNQLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPSVAARAEILRIHSRKMNLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKV 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Yeast
Match: RPT5 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; recruited to the GAL1-10 promoter region upon induction of transcription; similar to human TBP1 [Source:SGD;Acc:S000005643])

HSP 1 Score: 221.476 bits (563), Expect = 8.339e-70
Identity = 103/200 (51.50%), Postives = 143/200 (71.50%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTLLARA A Q +  F+K+ +  +V  YIGE A++VR+ FA AK   P +IF+DE+DAIG KRF    S DRE+QRT++ELLNQ+DGF +  +VK++ ATNR D+LDPAL+R GR+DRKIE  LP+E +R  I+ IHS K++   D ++  + + ++ FNGA L+ V  EAGM A+R  +  V +EDFV+ + +V
Sbjct:  223 PPGTGKTLLARACAAQTNATFLKLAAPQLVQMYIGEGAKLVRDAFALAKEKAPTIIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLRSGRLDRKIEFPLPSEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVEAGMIALRNGQSSVKHEDFVEGISEV 422          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Yeast
Match: RPT2 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; required for normal peptide hydrolysis by the core 20S particle; N-myristoylation of Rpt2p at Gly2 is involved in regulating the proper intracellular distribution of proteasome activity by controlling the nuclear localization of the 26S proteasome [Source:SGD;Acc:S000002165])

HSP 1 Score: 211.846 bits (538), Expect = 5.245e-66
Identity = 101/210 (48.10%), Postives = 146/210 (69.52%), Query Frame = 2
Query:    5 PGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLE 634
            PGTGKTLLA+AVA Q    F+++V S ++ KY+G+  R+ R++F  A  + P ++F+DEIDAIG KR+   +  +REIQRT++ELLNQ+DGFD  G VK+IMATN+ + LDPALIRPGRIDRKI    P+   +  I+ IH+SK++   D + + ++   +  +GAD++ +CTEAG+ A+R  RM V  EDF +A  +V  + K+E  LE
Sbjct:  225 PGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSKMNLSEDVNLETLVTTKDDLSGADIQAMCTEAGLLALRERRMQVTAEDFKQAKERVMKN-KVEENLE 433          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Nematostella
Match: EDO34160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ60])

HSP 1 Score: 367.851 bits (943), Expect = 4.161e-127
Identity = 167/215 (77.67%), Postives = 199/215 (92.56%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLD NF+KVVSS+IVDKYIGESAR++REMF YA+ HEPC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFD LG+VK+IMATNRPD LDPAL+RPGR+DRKIEI+LPNE AR+DI+ IHSS+++KHG+ D++ ++K+S+GFNGADLRNVCTEAGMFA+R ER YVI EDF+KAVRKV D+KKLESKL+YK +
Sbjct:  177 PPGTGKTLLARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFGYARDHEPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDVLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIALPNEQARMDILKIHSSRITKHGEIDYEAVVKLSDGFNGADLRNVCTEAGMFAIRGERDYVIEEDFMKAVRKVSDNKKLESKLDYKPI 391          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Nematostella
Match: EDO49524 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGH4])

HSP 1 Score: 241.506 bits (615), Expect = 1.484e-77
Identity = 115/207 (55.56%), Postives = 149/207 (71.98%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   +C F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILD AL+RPGRIDRKIE   PNE AR DI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  183 PPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARQDILKIHSRKMNLTRGINLKKIAELMPGASGAEIKGVCTEAGMYALRERRVHVTQEDFEMAVTKVMQKDSEK 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Nematostella
Match: EDO37473 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFJ3])

HSP 1 Score: 239.58 bits (610), Expect = 1.993e-76
Identity = 107/200 (53.50%), Postives = 146/200 (73.00%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTL ARAVA + D  F++V+ S +V KY+GE AR+VRE+F  A++ + C++F DEIDAIGG RF DG   D E+QRT++EL+NQ+DGFD  G +K++MATNRPD LDPAL+RPGR+DRK+E  LP+   R  I  IH+  +S   D  ++ + ++     GA++R+VCTEAGMFA+RA R     +DF++AV KV
Sbjct:  218 PPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRAHIFKIHARSMSVERDIRYELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKV 417          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Nematostella
Match: EDO37502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFP4])

HSP 1 Score: 219.935 bits (559), Expect = 7.132e-69
Identity = 105/205 (51.22%), Postives = 143/205 (69.76%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKK 616
            PPGTGKTLLARA A Q    F+K+    +V  +IG+ A++VR+ FA AK   P +IF+DE+DAIG KRF    + DRE+QRT++ELLNQ+DGF +   +K+I ATNR DILDPAL+R GR+DRKIE   P++ AR  I+ IHS K++  GD +FD + + ++ FNGA L+ VC EAGM A+R E   V +ED++  + +V   KK
Sbjct:  217 PPGTGKTLLARACAAQTKSTFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPAIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFSSHHDIKVIAATNRVDILDPALLRSGRLDRKIEFPNPDQEARARILQIHSRKMNVSGDVNFDELSRCTDDFNGAMLKAVCVEAGMIALRREATEVCHEDYMDGIMEVNAKKK 421          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Nematostella
Match: EDO43481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYL2])

HSP 1 Score: 199.904 bits (507), Expect = 2.888e-61
Identity = 101/212 (47.64%), Postives = 139/212 (65.57%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEY 637
            PPG GKT+LA+AVA      F++VV S  V KY+GE  R+VR++F  AK + P +IF+DEIDAI  KRF     +DRE+QR L+ELLNQMDGFD    VK+IMATNR D LDPAL+RPGR+DRKIE  LP+   +  I +  ++K++   + D +  +   +  +GAD+  VC EAGM A+R  R  ++ +DF K  +   + KK E + E+
Sbjct:  206 PPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQNVNVKVIMATNRQDTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITNKMNLSEEVDLEDYVARPDKISGADINAVCQEAGMQAVRENRYIILAKDFEKGYK--NNVKKDEQEHEF 415          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Medaka
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:101172300])

HSP 1 Score: 367.466 bits (942), Expect = 1.208e-126
Identity = 168/215 (78.14%), Postives = 197/215 (91.63%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLDCNF+KVVSSSIVDKYIGESAR++REMF YA+ H+PC+IFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFDTL +VK+IMATNRPD LDPAL+RPGR+DRKI I LPNE ARLDI+ IHSS ++KHG+ D++ I+K+S+GFNGADLRNVCTEAG+FA+R++R YV  EDF+KAVRKV DSKKLESKL+YK V
Sbjct:  175 PPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDTLHRVKMIMATNRPDTLDPALLRPGRLDRKIHIELPNEQARLDILKIHSSPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGLFAIRSDREYVTQEDFMKAVRKVADSKKLESKLDYKPV 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Medaka
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:101158979])

HSP 1 Score: 243.432 bits (620), Expect = 9.710e-78
Identity = 117/207 (56.52%), Postives = 150/207 (72.46%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   DC F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILD AL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  191 PPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 397          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Medaka
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:101158979])

HSP 1 Score: 243.047 bits (619), Expect = 9.829e-78
Identity = 117/207 (56.52%), Postives = 150/207 (72.46%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV--GDSKK 616
            PPGTGKTLLARAVA   DC F++V  S +V K+IGE AR+VRE+F  A+ H P +IFMDEID+IG  R   G+  D E+QRT++ELLNQ+DGF+    +K+IMATNR DILD AL+RPGRIDRKIE   PNE ARLDI+ IHS K++     +   I ++  G +GA+++ VCTEAGM+A+R  R++V  EDF  AV KV   DS+K
Sbjct:  183 PPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEK 389          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Medaka
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:NCBI gene;Acc:101175703])

HSP 1 Score: 242.662 bits (618), Expect = 1.105e-77
Identity = 111/200 (55.50%), Postives = 147/200 (73.50%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTL ARAVA + D  F++V+ S +V KY+GE AR+VRE+F  A++ + C+IF DEIDAIGG RF DG   D E+QRT++EL+NQ+DGFD  G +K++MATNRPD LDPAL+RPGR+DRKIE SLP+   R  I  IH+  +S   D  F+ + ++     GA++R+VCTEAGMFA+RA R     +DF++AV KV
Sbjct:  177 PPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 376          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Medaka
Match: psmc2 (proteasome 26S subunit, ATPase 2 [Source:NCBI gene;Acc:101175703])

HSP 1 Score: 243.047 bits (619), Expect = 2.303e-77
Identity = 111/200 (55.50%), Postives = 147/200 (73.50%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV 601
            PPGTGKTL ARAVA + D  F++V+ S +V KY+GE AR+VRE+F  A++ + C+IF DEIDAIGG RF DG   D E+QRT++EL+NQ+DGFD  G +K++MATNRPD LDPAL+RPGR+DRKIE SLP+   R  I  IH+  +S   D  F+ + ++     GA++R+VCTEAGMFA+RA R     +DF++AV KV
Sbjct:  217 PPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKV 416          
BLAST of 26S proteasome regulatory subunit 10B vs. Planmine SMEST
Match: SMESG000075089.1 (SMESG000075089.1)

HSP 1 Score: 443.736 bits (1140), Expect = 1.085e-156
Identity = 215/215 (100.00%), Postives = 215/215 (100.00%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV
Sbjct:  180 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 394          
BLAST of 26S proteasome regulatory subunit 10B vs. Planmine SMEST
Match: SMESG000062610.1 (SMESG000062610.1)

HSP 1 Score: 438.728 bits (1127), Expect = 7.887e-155
Identity = 212/215 (98.60%), Postives = 215/215 (100.00%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDI+NIHSSKLSKHG+FDFDFI+KMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV
Sbjct:  180 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDILNIHSSKLSKHGEFDFDFIIKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 394          
BLAST of 26S proteasome regulatory subunit 10B vs. Planmine SMEST
Match: SMESG000035469.1 (SMESG000035469.1)

HSP 1 Score: 369.777 bits (948), Expect = 1.327e-127
Identity = 170/215 (79.07%), Postives = 197/215 (91.63%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLD NF+KVVSS IVDKYIGESAR++REMF+YA+ HEPCVIFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFD LG+VKIIMATNRPD LDPAL+RPGR+DRKIEI LPNE AR+D++ IH+S LSKHGD D++ I+K+S+GFNGADLRNVCTEAGMFA+R ER Y+I EDF+KAVRK+ DSKKLESKL+YK +
Sbjct:  182 PPGTGKTLLARAVASQLDANFLKVVSSGIVDKYIGESARLIREMFSYARDHEPCVIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARMDVLKIHASTLSKHGDIDWEAIVKLSDGFNGADLRNVCTEAGMFAIRNEREYIIEEDFMKAVRKLADSKKLESKLDYKPI 396          
BLAST of 26S proteasome regulatory subunit 10B vs. Planmine SMEST
Match: SMESG000047180.1 (SMESG000047180.1)

HSP 1 Score: 368.237 bits (944), Expect = 5.232e-127
Identity = 173/215 (80.47%), Postives = 195/215 (90.70%), Query Frame = 2
Query:    2 PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            PPGTGKTLLARAVA QLD NF+KVVSSSIVDK+IGESAR++REMFAYAK HEPCVIFMDEIDAIGG+RF +G SSDREIQRTLMELLNQMDGFD LG+VKIIMATNRPD LDPAL+RPGR+DRKIEI LP E  RLDI+ IHS K+SKHG+ D+D ++K+S+GFNGAD+RNVCTEAGMFA+R ER YVIN+DF+KAVRK+ D KKLESKLEYK V
Sbjct:  176 PPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEIDAIGGRRFNNGTSSDREIQRTLMELLNQMDGFDVLGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPKEQGRLDILKIHSDKISKHGEIDWDSLVKLSDGFNGADMRNVCTEAGMFAIRDERDYVINQDFMKAVRKMQDMKKLESKLEYKPV 390          
BLAST of 26S proteasome regulatory subunit 10B vs. Planmine SMEST
Match: SMESG000047188.1 (SMESG000047188.1)

HSP 1 Score: 364.77 bits (935), Expect = 8.145e-126
Identity = 168/213 (78.87%), Postives = 195/213 (91.55%), Query Frame = 2
Query:    8 GTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVKIIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHGDFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKVGDSKKLESKLEYKAV 646
            GTGKTLLARAVA QLD NF+KVVSS IVDKYIGESAR++REMF+YA+ HEPCVIFMDEIDAIGG+RF++G S+DREIQRTLMELLNQMDGFD LG+VKIIMATNRPD LDPAL+RPGR+DRKIEI LPNE AR+D++ IH+S LSKHGD D++ I+K+S+GFNGADLRNVCTEAGMFA+R ER Y+I EDF+KAVRK+ DSKKLESKL+YK +
Sbjct:  170 GTGKTLLARAVASQLDANFLKVVSSGIVDKYIGESARLIREMFSYARDHEPCVIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFDALGQVKIIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARMDVLKIHASTLSKHGDIDWEAIVKLSDGFNGADLRNVCTEAGMFAIRNEREYIIEEDFMKAVRKLADSKKLESKLDYKPI 382          
The following BLAST results are available for this feature:
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSMC62.299e-12477.21proteasome 26S subunit, ATPase 6 [Source:HGNC Symb... [more]
PSMC64.154e-12477.21proteasome 26S subunit, ATPase 6 [Source:HGNC Symb... [more]
PSMC51.577e-7756.52proteasome 26S subunit, ATPase 5 [Source:HGNC Symb... [more]
PSMC51.577e-7756.52proteasome 26S subunit, ATPase 5 [Source:HGNC Symb... [more]
PSMC51.577e-7756.52proteasome 26S subunit, ATPase 5 [Source:HGNC Symb... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpt-45.228e-12676.28Probable 26S proteasome regulatory subunit 10B [S... [more]
rpt-46.422e-12676.28Probable 26S proteasome regulatory subunit 10B [S... [more]
rpt-16.714e-7853.5026S proteasome regulatory subunit 7 [Source:UniPr... [more]
rpt-16.714e-7853.5026S proteasome regulatory subunit 7 [Source:UniPr... [more]
rpt-62.969e-7655.56Proteasome Regulatory Particle, ATPase-like [Sour... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpt41.373e-12477.21gene:FBgn0028685 transcript:FBtr0305495[more]
Rpt4R4.042e-12072.56gene:FBgn0036224 transcript:FBtr0346545[more]
Rpt4R4.042e-12072.56gene:FBgn0036224 transcript:FBtr0076040[more]
Rpt62.215e-7856.04gene:FBgn0020369 transcript:FBtr0077189[more]
Rpt13.230e-7855.50gene:FBgn0028687 transcript:FBtr0088947[more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc62.124e-12678.60proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
psmc62.124e-12678.60proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
psmc62.124e-12678.60proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
psmc51.178e-7756.52proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:... [more]
psmc23.078e-7755.50proteasome 26S subunit, ATPase 2 [Source:ZFIN;Acc:... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc61.782e-12577.67proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc67.919e-12577.67proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc67.028e-11875.24proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
map79.110e-7856.52microtubule associated protein 7 [Source:Xenbase;A... [more]
pip5k1a1.430e-7755.50phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Psmc61.579e-12477.21proteasome (prosome, macropain) 26S subunit, ATPas... [more]
Psmc51.205e-7756.52protease (prosome, macropain) 26S subunit, ATPase ... [more]
Psmc27.007e-7755.50proteasome (prosome, macropain) 26S subunit, ATPas... [more]
Psmc16.392e-7353.00protease (prosome, macropain) 26S subunit, ATPase ... [more]
Psmc35.547e-6849.07proteasome (prosome, macropain) 26S subunit, ATPas... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O17071|PRS10_CAEEL6.650e-12576.28Probable 26S proteasome regulatory subunit 10B OS=... [more]
sp|P62334|PRS10_MOUSE1.104e-12377.2126S proteasome regulatory subunit 10B OS=Mus muscu... [more]
sp|P62335|PRS10_ICTTR1.104e-12377.2126S proteasome regulatory subunit 10B OS=Ictidomys... [more]
sp|P62333|PRS10_HUMAN1.104e-12377.2126S proteasome regulatory subunit 10B OS=Homo sapi... [more]
sp|Q2KIW6|PRS10_BOVIN2.525e-12276.7426S proteasome regulatory subunit 10B OS=Bos tauru... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M7RPR52.408e-12680.9326S protease regulatory subunit 10B OS=Brachionus ... [more]
A0A0B2VH613.974e-12577.67Putative 26S protease regulatory subunit 10B OS=To... [more]
A0A3P6TLE07.395e-12577.21AAA domain-containing protein OS=Litomosoides sigm... [more]
A0A238BPR91.071e-12477.21Putative proteasome-activating nucleotidase OS=Onc... [more]
A0A2K6WM071.169e-12477.21AAA domain-containing protein OS=Onchocerca volvul... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc65.191e-12779.07proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc67.088e-12779.07proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc52.593e-7856.52proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc52.766e-7856.52proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc58.046e-7856.52proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc57.457e-7956.04proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:... [more]
ENSPMAT00000001244.12.985e-7555.00pep scaffold:Pmarinus_7.0:GL482260:6416:9764:-1 ge... [more]
ENSPMAT00000010299.11.081e-6849.53pep scaffold:Pmarinus_7.0:GL479893:343:6144:1 gene... [more]
ENSPMAT00000006168.12.430e-5152.26pep scaffold:Pmarinus_7.0:GL486395:211235:217029:-... [more]
vcp2.250e-4040.22valosin containing protein [Source:NCBI gene;Acc:3... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RPT43.633e-10767.44ATPase of the 19S regulatory particle of the 26S p... [more]
RPT16.780e-7753.05ATPase of the 19S regulatory particle of the 26S p... [more]
RPT68.658e-7655.50ATPase of the 19S regulatory particle of the 26S p... [more]
RPT58.339e-7051.50ATPase of the 19S regulatory particle of the 26S p... [more]
RPT25.245e-6648.10ATPase of the 19S regulatory particle of the 26S p... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO341604.161e-12777.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495241.484e-7755.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374731.993e-7653.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375027.132e-6951.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434812.888e-6147.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc61.208e-12678.14proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc59.710e-7856.52proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc59.829e-7856.52proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc21.105e-7755.50proteasome 26S subunit, ATPase 2 [Source:NCBI gene... [more]
psmc22.303e-7755.50proteasome 26S subunit, ATPase 2 [Source:NCBI gene... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075089.11.085e-156100.00SMESG000075089.1[more]
SMESG000062610.17.887e-15598.60SMESG000062610.1[more]
SMESG000035469.11.327e-12779.07SMESG000035469.1[more]
SMESG000047180.15.232e-12780.47SMESG000047180.1[more]
SMESG000047188.18.145e-12678.87SMESG000047188.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013172 ID=SMED30013172|Name=26S proteasome regulatory subunit 10B|organism=Schmidtea mediterranea sexual|type=transcript|length=925bp
TCCTCCAGGAACAGGAAAAACCTTGCTAGCTCGAGCAGTTGCAAAACAAC
TGGACTGTAATTTTGTCAAAGTGGTATCAAGTAGCATCGTTGACAAATAT
ATTGGAGAAAGTGCCCGAATAGTGAGAGAAATGTTTGCATATGCAAAATC
TCACGAACCTTGTGTTATTTTCATGGACGAGATTGATGCAATCGGTGGCA
AAAGATTTACTGATGGAAACAGTTCTGACAGAGAAATTCAAAGAACCTTG
ATGGAACTTTTGAATCAAATGGATGGATTTGATACTCTTGGTAAAGTTAA
AATCATAATGGCAACTAATCGACCAGATATTCTCGACCCAGCTCTTATTC
GACCAGGAAGAATAGATAGAAAAATTGAAATCTCTCTTCCAAATGAAGTT
GCAAGATTAGATATTATCAATATTCATAGTTCAAAATTATCAAAACATGG
AGACTTTGATTTTGATTTCATAATGAAGATGTCAGAAGGATTTAACGGTG
CTGATTTGAGAAACGTTTGTACTGAAGCAGGCATGTTTGCAATGAGAGCT
GAAAGAATGTATGTTATAAACGAAGACTTTGTGAAAGCTGTTAGAAAAGT
AGGAGATAGTAAAAAACTAGAGTCAAAACTTGAATACAAAGCTGTCTAAA
ATATTTTGATAGATAAAATAAATTTTATTAATCTTATTTCTTTAACACTT
AATATGCATTTGAAAAGGCTGGGCCAAAAATTTTAAATATGATAAAAACG
TGTAGGCGTTTTATTTTACCGCATCAAAAAATATCCGTGAAATAATTCAA
ATTTTTCAAAAACAGTTTTGTAACCTTATAAATAAGGCGCATATATGTTC
ATTTAATTATTATTATCATCATTTTTATTTTTTATGTTTTATAATTTATG
TCTAGGTTAACCCATTTGTAGAGTG
back to top

protein sequence of SMED30013172-orf-1

>SMED30013172-orf-1 ID=SMED30013172-orf-1|Name=SMED30013172-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=216bp
PPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKS
HEPCVIFMDEIDAIGGKRFTDGNSSDREIQRTLMELLNQMDGFDTLGKVK
IIMATNRPDILDPALIRPGRIDRKIEISLPNEVARLDIINIHSSKLSKHG
DFDFDFIMKMSEGFNGADLRNVCTEAGMFAMRAERMYVINEDFVKAVRKV
GDSKKLESKLEYKAV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR041569AAA_lid_3
IPR035263PSMC6
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR003959ATPase_AAA_core
IPR003960ATPase_AAA_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0016787hydrolase activity
GO:0016887ATPase activity
GO:0017025TBP-class protein binding
GO:0036402proteasome-activating ATPase activity
GO:0000166nucleotide binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0008540proteasome regulatory particle, base subcomplex
GO:0031595nuclear proteasome complex
GO:0031597cytosolic proteasome complex
GO:0000502proteasome complex
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO:0030163protein catabolic process
GO:0030433ubiquitin-dependent ERAD pathway
GO:0045899positive regulation of RNA polymerase II transcriptional preinitiation complex assembly
GO:1901800positive regulation of proteasomal protein catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 1..131
e-value: 1.7E-13
score: 60.8
IPR041569AAA ATPase, AAA+ lid domainPFAMPF17862AAA_lid_3coord: 151..193
e-value: 2.2E-9
score: 37.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..128
e-value: 3.5E-49
score: 169.0
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 130..201
e-value: 6.5E-20
score: 72.6
NoneNo IPR availablePANTHERPTHR2307326S PROTEASE REGULATORY SUBUNITcoord: 1..215
NoneNo IPR availableCDDcd00009AAAcoord: 1..129
e-value: 1.73355E-23
score: 89.8979
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 1..128
e-value: 2.8E-40
score: 137.8
IPR03526326S proteasome regulatory subunit 10BPANTHERPTHR23073:SF7626S PROTEASOME REGULATORY SUBUNIT 10Bcoord: 1..215
IPR003960ATPase, AAA-type, conserved sitePROSITEPS00674AAAcoord: 99..117
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1..199