Arginine kinase

Overview
NameArginine kinase
Smed IDSMED30013170
Length (bp)644
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013170

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30013170h1SMcG0010253 PL06011B1H04smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30013170h1SMcG0010253 Contig53301newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013170h1SMcG0010253 Contig53301uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30013170h1SMcG0010253 Contig4813GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30013170h1SMcG0010253 Contig51498uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013170h1SMcG0010253 Contig51498newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30013170h1SMcG0015041 Contig4813GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Arginine kinase vs. Ensembl Human
Match: CKMT1A (creatine kinase, mitochondrial 1A [Source:HGNC Symbol;Acc:HGNC:31736])

HSP 1 Score: 157.532 bits (397), Expect = 1.358e-45
Identity = 77/169 (45.56%), Postives = 109/169 (64.50%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN +K+FL+WV EEDH R+ISM+ GG++ +V++R   G+K +E  +      F   ++ GY+  CPSNLGT +RA VH+K+P LS D + F  I +   LQ RG  G  T + GG++DISN  RLG +E++ V  + +GV  +ID E  L
Sbjct:  233 PLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-SRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL 400          
BLAST of Arginine kinase vs. Ensembl Human
Match: CKMT1A (creatine kinase, mitochondrial 1A [Source:HGNC Symbol;Acc:HGNC:31736])

HSP 1 Score: 157.532 bits (397), Expect = 1.358e-45
Identity = 77/169 (45.56%), Postives = 109/169 (64.50%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN +K+FL+WV EEDH R+ISM+ GG++ +V++R   G+K +E  +      F   ++ GY+  CPSNLGT +RA VH+K+P LS D + F  I +   LQ RG  G  T + GG++DISN  RLG +E++ V  + +GV  +ID E  L
Sbjct:  233 PLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-SRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL 400          
BLAST of Arginine kinase vs. Ensembl Human
Match: CKMT1B (creatine kinase, mitochondrial 1B [Source:HGNC Symbol;Acc:HGNC:1995])

HSP 1 Score: 157.532 bits (397), Expect = 1.358e-45
Identity = 77/169 (45.56%), Postives = 109/169 (64.50%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN +K+FL+WV EEDH R+ISM+ GG++ +V++R   G+K +E  +      F   ++ GY+  CPSNLGT +RA VH+K+P LS D + F  I +   LQ RG  G  T + GG++DISN  RLG +E++ V  + +GV  +ID E  L
Sbjct:  233 PLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-SRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL 400          
BLAST of Arginine kinase vs. Ensembl Human
Match: CKMT1B (creatine kinase, mitochondrial 1B [Source:HGNC Symbol;Acc:HGNC:1995])

HSP 1 Score: 157.532 bits (397), Expect = 1.358e-45
Identity = 77/169 (45.56%), Postives = 109/169 (64.50%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN +K+FL+WV EEDH R+ISM+ GG++ +V++R   G+K +E  +      F   ++ GY+  CPSNLGT +RA VH+K+P LS D + F  I +   LQ RG  G  T + GG++DISN  RLG +E++ V  + +GV  +ID E  L
Sbjct:  233 PLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-SRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL 400          
BLAST of Arginine kinase vs. Ensembl Human
Match: CKB (creatine kinase B [Source:HGNC Symbol;Acc:HGNC:1991])

HSP 1 Score: 156.377 bits (394), Expect = 1.775e-45
Identity = 75/169 (44.38%), Postives = 107/169 (63.31%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIE-----EKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V+ R   G+  IE     +   F      GY+  CPSNLGT +RA VH+K+P L   +  F+++  +  LQ RG  G  T + GG++D+SN  RLG +E++ V  + +GVK +I++E  L
Sbjct:  200 PLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHE-KFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRL 367          
BLAST of Arginine kinase vs. Ensembl Celegans
Match: F46H5.3 (Probable arginine kinase F46H5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q10454])

HSP 1 Score: 199.904 bits (507), Expect = 5.034e-63
Identity = 93/164 (56.71%), Postives = 122/164 (74.39%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMS 493
            D  L+ A   R WP GRGIFHN +KTFL+W  EEDH+RIISMQ GG++ QV +RL+ G+K IE++  FS   + G+LT CPSNLGTT+RASVH+++PK+S+ K  F  ICD   LQ RG +GEH+ES GG+YDISNK RLGLTE +AV +M +G+  +I +E +
Sbjct:  196 DRFLQAANACRYWPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHIRLPKISA-KPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAHLIALEKA 358          
BLAST of Arginine kinase vs. Ensembl Celegans
Match: F46H5.3 (Probable arginine kinase F46H5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q10454])

HSP 1 Score: 199.904 bits (507), Expect = 5.034e-63
Identity = 93/164 (56.71%), Postives = 122/164 (74.39%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMS 493
            D  L+ A   R WP GRGIFHN +KTFL+W  EEDH+RIISMQ GG++ QV +RL+ G+K IE++  FS   + G+LT CPSNLGTT+RASVH+++PK+S+ K  F  ICD   LQ RG +GEH+ES GG+YDISNK RLGLTE +AV +M +G+  +I +E +
Sbjct:  196 DRFLQAANACRYWPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHIRLPKISA-KPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAHLIALEKA 358          
BLAST of Arginine kinase vs. Ensembl Celegans
Match: F46H5.3 (Probable arginine kinase F46H5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q10454])

HSP 1 Score: 199.904 bits (507), Expect = 5.034e-63
Identity = 93/164 (56.71%), Postives = 122/164 (74.39%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMS 493
            D  L+ A   R WP GRGIFHN +KTFL+W  EEDH+RIISMQ GG++ QV +RL+ G+K IE++  FS   + G+LT CPSNLGTT+RASVH+++PK+S+ K  F  ICD   LQ RG +GEH+ES GG+YDISNK RLGLTE +AV +M +G+  +I +E +
Sbjct:  196 DRFLQAANACRYWPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHIRLPKISA-KPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAHLIALEKA 358          
BLAST of Arginine kinase vs. Ensembl Celegans
Match: F46H5.3 (Probable arginine kinase F46H5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q10454])

HSP 1 Score: 199.904 bits (507), Expect = 5.034e-63
Identity = 93/164 (56.71%), Postives = 122/164 (74.39%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMS 493
            D  L+ A   R WP GRGIFHN +KTFL+W  EEDH+RIISMQ GG++ QV +RL+ G+K IE++  FS   + G+LT CPSNLGTT+RASVH+++PK+S+ K  F  ICD   LQ RG +GEH+ES GG+YDISNK RLGLTE +AV +M +G+  +I +E +
Sbjct:  196 DRFLQAANACRYWPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHIRLPKISA-KPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAHLIALEKA 358          
BLAST of Arginine kinase vs. Ensembl Celegans
Match: F46H5.3 (Probable arginine kinase F46H5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q10454])

HSP 1 Score: 199.904 bits (507), Expect = 1.534e-62
Identity = 93/164 (56.71%), Postives = 122/164 (74.39%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMS 493
            D  L+ A   R WP GRGIFHN +KTFL+W  EEDH+RIISMQ GG++ QV +RL+ G+K IE++  FS   + G+LT CPSNLGTT+RASVH+++PK+S+ K  F  ICD   LQ RG +GEH+ES GG+YDISNK RLGLTE +AV +M +G+  +I +E +
Sbjct:  233 DRFLQAANACRYWPKGRGIFHNNQKTFLIWCNEEDHLRIISMQEGGNVGQVLERLIKGVKTIEKQAPFSRDDRLGWLTFCPSNLGTTVRASVHIRLPKISA-KPDFKSICDGLKLQIRGIHGEHSESEGGVYDISNKARLGLTEFEAVKQMYDGIAHLIALEKA 395          
BLAST of Arginine kinase vs. Ensembl Fly
Match: Argk (gene:FBgn0000116 transcript:FBtr0331550)

HSP 1 Score: 215.312 bits (547), Expect = 5.699e-69
Identity = 97/165 (58.79%), Postives = 125/165 (75.76%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            D  L+ A   R WPSGRGI+HN  KTFLVW  EEDH+RIISMQ GGDL Q+Y+RLV  +  IE+++ FSH  + G+LT CP+NLGTT+RASVH+K+PKL+S+K    ++  KY+LQ RG  GEHTE+ GG+YDISNK R+GLTE +AV EM +G+  +I +E SL
Sbjct:  192 DRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 356          
BLAST of Arginine kinase vs. Ensembl Fly
Match: Argk (gene:FBgn0000116 transcript:FBtr0076545)

HSP 1 Score: 215.312 bits (547), Expect = 5.699e-69
Identity = 97/165 (58.79%), Postives = 125/165 (75.76%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            D  L+ A   R WPSGRGI+HN  KTFLVW  EEDH+RIISMQ GGDL Q+Y+RLV  +  IE+++ FSH  + G+LT CP+NLGTT+RASVH+K+PKL+S+K    ++  KY+LQ RG  GEHTE+ GG+YDISNK R+GLTE +AV EM +G+  +I +E SL
Sbjct:  192 DRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 356          
BLAST of Arginine kinase vs. Ensembl Fly
Match: Argk (gene:FBgn0000116 transcript:FBtr0345030)

HSP 1 Score: 215.312 bits (547), Expect = 5.699e-69
Identity = 97/165 (58.79%), Postives = 125/165 (75.76%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            D  L+ A   R WPSGRGI+HN  KTFLVW  EEDH+RIISMQ GGDL Q+Y+RLV  +  IE+++ FSH  + G+LT CP+NLGTT+RASVH+K+PKL+S+K    ++  KY+LQ RG  GEHTE+ GG+YDISNK R+GLTE +AV EM +G+  +I +E SL
Sbjct:  192 DRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 356          
BLAST of Arginine kinase vs. Ensembl Fly
Match: Argk (gene:FBgn0000116 transcript:FBtr0112791)

HSP 1 Score: 215.312 bits (547), Expect = 9.736e-69
Identity = 97/165 (58.79%), Postives = 125/165 (75.76%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            D  L+ A   R WPSGRGI+HN  KTFLVW  EEDH+RIISMQ GGDL Q+Y+RLV  +  IE+++ FSH  + G+LT CP+NLGTT+RASVH+K+PKL+S+K    ++  KY+LQ RG  GEHTE+ GG+YDISNK R+GLTE +AV EM +G+  +I +E SL
Sbjct:  211 DRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 375          
BLAST of Arginine kinase vs. Ensembl Fly
Match: Argk (gene:FBgn0000116 transcript:FBtr0076544)

HSP 1 Score: 216.853 bits (551), Expect = 1.375e-68
Identity = 97/165 (58.79%), Postives = 125/165 (75.76%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            D  L+ A   R WPSGRGI+HN  KTFLVW  EEDH+RIISMQ GGDL Q+Y+RLV  +  IE+++ FSH  + G+LT CP+NLGTT+RASVH+K+PKL+S+K    ++  KY+LQ RG  GEHTE+ GG+YDISNK R+GLTE +AV EM +G+  +I +E SL
Sbjct:  268 DRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 432          
BLAST of Arginine kinase vs. Ensembl Zebrafish
Match: ckmb (creatine kinase, muscle b [Source:ZFIN;Acc:ZDB-GENE-040426-2128])

HSP 1 Score: 162.925 bits (411), Expect = 3.790e-48
Identity = 80/169 (47.34%), Postives = 111/169 (65.68%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP GRGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V++R  +G++ IE+        F   +  G++  CPSNLGT +R  VHVK+PKLS+    F +I  +  LQ RG  G  T S GG++DISN  RLG +E+  V  + +GVK ++++E  L
Sbjct:  199 PLLLAAGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQKIEDVFKKHNHGFMWNEHLGFILTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVQQVQLVVDGVKLMVEMEKKL 366          
BLAST of Arginine kinase vs. Ensembl Zebrafish
Match: ckmb (creatine kinase, muscle b [Source:ZFIN;Acc:ZDB-GENE-040426-2128])

HSP 1 Score: 162.925 bits (411), Expect = 3.790e-48
Identity = 80/169 (47.34%), Postives = 111/169 (65.68%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP GRGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V++R  +G++ IE+        F   +  G++  CPSNLGT +R  VHVK+PKLS+    F +I  +  LQ RG  G  T S GG++DISN  RLG +E+  V  + +GVK ++++E  L
Sbjct:  199 PLLLAAGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQKIEDVFKKHNHGFMWNEHLGFILTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVQQVQLVVDGVKLMVEMEKKL 366          
BLAST of Arginine kinase vs. Ensembl Zebrafish
Match: ckbb (creatine kinase, brain b [Source:ZFIN;Acc:ZDB-GENE-020103-2])

HSP 1 Score: 157.532 bits (397), Expect = 1.123e-47
Identity = 77/169 (45.56%), Postives = 107/169 (63.31%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V+ R   G+  IEE        F   +  GY+  CPSNLGT +R  VHVK+P +S  +  F +I  +  LQ RG  G  T + GG++DISN  RLG +E++ V  + +GVK ++++E  L
Sbjct:   60 PLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMREVFNRFCTGLTKIEELFKEKGHEFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPNVSKHE-KFGEILKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLVEMEKRL 227          
BLAST of Arginine kinase vs. Ensembl Zebrafish
Match: ckma (creatine kinase, muscle a [Source:ZFIN;Acc:ZDB-GENE-980526-109])

HSP 1 Score: 160.999 bits (406), Expect = 1.937e-47
Identity = 79/169 (46.75%), Postives = 111/169 (65.68%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V++R  +G++ IEE        F   +  G++  CPSNLGT +R  VHVK+PKLS+    F +I  +  LQ RG  G  T S GG++DISN  R+G +E++ V  + +GVK ++++E  L
Sbjct:  200 PLLLAAGMARDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQRIEEIFKKHNHGFMWNEHLGFVLTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRIGSSEVEQVQCVVDGVKLMVEMEKKL 367          
BLAST of Arginine kinase vs. Ensembl Zebrafish
Match: ckma (creatine kinase, muscle a [Source:ZFIN;Acc:ZDB-GENE-980526-109])

HSP 1 Score: 160.999 bits (406), Expect = 1.937e-47
Identity = 79/169 (46.75%), Postives = 111/169 (65.68%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V++R  +G++ IEE        F   +  G++  CPSNLGT +R  VHVK+PKLS+    F +I  +  LQ RG  G  T S GG++DISN  R+G +E++ V  + +GVK ++++E  L
Sbjct:  200 PLLLAAGMARDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLQRIEEIFKKHNHGFMWNEHLGFVLTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRIGSSEVEQVQCVVDGVKLMVEMEKKL 367          
BLAST of Arginine kinase vs. Ensembl Xenopus
Match: ckb (creatine kinase, brain [Source:NCBI gene;Acc:733543])

HSP 1 Score: 159.844 bits (403), Expect = 7.680e-47
Identity = 77/169 (45.56%), Postives = 109/169 (64.50%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP  RGI+HN  KTFLVW+ EEDH+R+ISMQ GG++  V+QR   G+  IE        +F   +  GY+  CPSNLGT +RA VH+K+P LS ++  F +I  +  LQ RG  G  T + GG++DISN  RLG +E++ V  + +GVK ++++E  L
Sbjct:  202 PLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKDVFQRFCTGLTKIEAIFKNKGSAFMWNQHLGYVLTCPSNLGTGLRAGVHIKLPNLSKNE-KFGEILKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLVEMEKCL 369          
BLAST of Arginine kinase vs. Ensembl Xenopus
Match: ckb (creatine kinase, brain [Source:NCBI gene;Acc:733543])

HSP 1 Score: 159.458 bits (402), Expect = 8.599e-47
Identity = 77/169 (45.56%), Postives = 109/169 (64.50%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP  RGI+HN  KTFLVW+ EEDH+R+ISMQ GG++  V+QR   G+  IE        +F   +  GY+  CPSNLGT +RA VH+K+P LS ++  F +I  +  LQ RG  G  T + GG++DISN  RLG +E++ V  + +GVK ++++E  L
Sbjct:  195 PLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKDVFQRFCTGLTKIEAIFKNKGSAFMWNQHLGYVLTCPSNLGTGLRAGVHIKLPNLSKNE-KFGEILKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLVEMEKCL 362          
BLAST of Arginine kinase vs. Ensembl Xenopus
Match: ckb (creatine kinase, brain [Source:NCBI gene;Acc:733543])

HSP 1 Score: 159.458 bits (402), Expect = 8.812e-47
Identity = 77/169 (45.56%), Postives = 109/169 (64.50%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP  RGI+HN  KTFLVW+ EEDH+R+ISMQ GG++  V+QR   G+  IE        +F   +  GY+  CPSNLGT +RA VH+K+P LS ++  F +I  +  LQ RG  G  T + GG++DISN  RLG +E++ V  + +GVK ++++E  L
Sbjct:  200 PLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKDVFQRFCTGLTKIEAIFKNKGSAFMWNQHLGYVLTCPSNLGTGLRAGVHIKLPNLSKNE-KFGEILKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLVEMEKCL 367          
BLAST of Arginine kinase vs. Ensembl Xenopus
Match: ckb (creatine kinase, brain [Source:NCBI gene;Acc:733543])

HSP 1 Score: 159.458 bits (402), Expect = 9.483e-47
Identity = 77/169 (45.56%), Postives = 109/169 (64.50%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP  RGI+HN  KTFLVW+ EEDH+R+ISMQ GG++  V+QR   G+  IE        +F   +  GY+  CPSNLGT +RA VH+K+P LS ++  F +I  +  LQ RG  G  T + GG++DISN  RLG +E++ V  + +GVK ++++E  L
Sbjct:  198 PLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKDVFQRFCTGLTKIEAIFKNKGSAFMWNQHLGYVLTCPSNLGTGLRAGVHIKLPNLSKNE-KFGEILKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLVEMEKCL 365          
BLAST of Arginine kinase vs. Ensembl Xenopus
Match: rsf1 (remodeling and spacing factor 1 [Source:Xenbase;Acc:XB-GENE-988570])

HSP 1 Score: 159.073 bits (401), Expect = 1.469e-46
Identity = 79/169 (46.75%), Postives = 107/169 (63.31%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V++R   G++ IEE        F   +  GY+  CPSNLGT +R  VH K+P LS     F +I  +  LQ RG  G  T + GG++DISN  RLG +E+D V  + +GVK +I++E  L
Sbjct:  200 PLLLASGMGRDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFRRFCEGLQKIEEIFKQAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHAKLPNLSK-HPKFDEILGRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVDQVQMVVDGVKLMIEMEKKL 367          
BLAST of Arginine kinase vs. Ensembl Mouse
Match: Ckb (creatine kinase, brain [Source:MGI Symbol;Acc:MGI:88407])

HSP 1 Score: 155.606 bits (392), Expect = 2.234e-45
Identity = 74/169 (43.79%), Postives = 107/169 (63.31%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIE-----EKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP  RGI+HN  KTFLVW+ EEDH+R+ISMQ GG++ +V+ R   G+  IE     +   F      GY+  CPSNLGT +RA VH+K+P L   +  F+++  +  LQ RG  G  T + GG++D+SN  RLG +E++ V  + +GVK +I++E  L
Sbjct:  200 PLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPHLGKHE-KFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRL 367          
BLAST of Arginine kinase vs. Ensembl Mouse
Match: Ckmt1 (creatine kinase, mitochondrial 1, ubiquitous [Source:MGI Symbol;Acc:MGI:99441])

HSP 1 Score: 155.221 bits (391), Expect = 7.634e-45
Identity = 76/169 (44.97%), Postives = 108/169 (63.91%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN +K+FL+WV EEDH R+ISM+ GG++ +V++R   G+K +E+ +      F   ++ GY+  CPSNLGT +RA VH+K+P LS D   F  I +   LQ RG  G  T + G ++DISN  RLG +E++ V  + +GV  +ID E  L
Sbjct:  234 PLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEKLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-NRFPKILENLRLQKRGTGGVDTAATGSVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL 401          
BLAST of Arginine kinase vs. Ensembl Mouse
Match: Ckmt1 (creatine kinase, mitochondrial 1, ubiquitous [Source:MGI Symbol;Acc:MGI:99441])

HSP 1 Score: 155.221 bits (391), Expect = 7.634e-45
Identity = 76/169 (44.97%), Postives = 108/169 (63.91%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN +K+FL+WV EEDH R+ISM+ GG++ +V++R   G+K +E+ +      F   ++ GY+  CPSNLGT +RA VH+K+P LS D   F  I +   LQ RG  G  T + G ++DISN  RLG +E++ V  + +GV  +ID E  L
Sbjct:  234 PLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVEKLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKD-NRFPKILENLRLQKRGTGGVDTAATGSVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL 401          
BLAST of Arginine kinase vs. Ensembl Mouse
Match: Ckmt2 (creatine kinase, mitochondrial 2 [Source:MGI Symbol;Acc:MGI:1923972])

HSP 1 Score: 154.451 bits (389), Expect = 1.579e-44
Identity = 76/169 (44.97%), Postives = 107/169 (63.31%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN  KTFL+W+ EEDH R+ISM+ GG++ +V++R   G+K +E  +      F   ++ GY+  CPSNLGT +RA VHV+IPKLS D   F+ I +   LQ RG  G  T +   +YDISN  R+G +E++ V  + +GV  ++D E  L
Sbjct:  234 PLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKD-PRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKL 401          
BLAST of Arginine kinase vs. Ensembl Mouse
Match: Ckm (creatine kinase, muscle [Source:MGI Symbol;Acc:MGI:88413])

HSP 1 Score: 150.984 bits (380), Expect = 3.113e-44
Identity = 74/169 (43.79%), Postives = 107/169 (63.31%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP  RGI+HN  K+FLVWV EEDH+R+ISM+ GG++ +V++R  +G++ IEE        F   +  GY+  CPSNLGT +R  VHVK+  LS     F +I  +  LQ RG  G  T + G ++DISN  RLG +E++ V  + +GVK ++++E  L
Sbjct:  131 PLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLANLSK-HPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKL 298          
BLAST of Arginine kinase vs. UniProt/SwissProt
Match: sp|P16641|KTRC_SCHMA (Taurocyamine kinase OS=Schistosoma mansoni OX=6183 GN=Smp_194770 PE=1 SV=3)

HSP 1 Score: 251.521 bits (641), Expect = 4.800e-78
Identity = 117/165 (70.91%), Postives = 130/165 (78.79%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            DPVLRDAGGYRDWP GRGIFHN  KTFLVWVCEEDH+RIISMQ GG+L  VY+RL+ GI AI + + F+H  KYGY+TCCPSNLGT+MRASV +KIPKLSS      +IC KY LQARG YGEHTES  G YDISNK RLGLTEL A  EMA GV  +I+IE  L
Sbjct:  582 DPVLRDAGGYRDWPVGRGIFHNNSKTFLVWVCEEDHMRIISMQQGGNLAAVYKRLIEGINAIGKSMKFAHSDKYGYITCCPSNLGTSMRASVLLKIPKLSSQPKKLDEICAKYMLQARGLYGEHTESPDGTYDISNKRRLGLTELQAAHEMAEGVAKMIEIEKGL 746          

HSP 2 Score: 221.09 bits (562), Expect = 1.378e-66
Identity = 103/165 (62.42%), Postives = 131/165 (79.39%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            D VLRDAGGY DWP+GRGIF N +K FLVW+ EEDHIR+ISMQ GGDL+ VY+RL   I+ + + L F+   + G++T CPSNLGTT+RASVH KIP L+S    F +IC+K+ +Q RG +GEHTES GGIYD+SNK RLGLTELDAVTEM +GV+A++++E+ L
Sbjct:  219 DNVLRDAGGYIDWPTGRGIFINKQKNFLVWINEEDHIRVISMQKGGDLIAVYKRLADAIQELSKSLKFAFNDRLGFITFCPSNLGTTLRASVHAKIPMLAS-LPNFKEICEKHGIQPRGTHGEHTESVGGIYDLSNKRRLGLTELDAVTEMHSGVRALLELEVML 382          
BLAST of Arginine kinase vs. UniProt/SwissProt
Match: sp|O15990|KARG_LIOJA (Arginine kinase OS=Liolophura japonica OX=13599 PE=2 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 2.266e-72
Identity = 106/164 (64.63%), Postives = 129/164 (78.66%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMS 493
            D  L+ A GY DWP+GRGIF N  KTFLVWV EEDHIRIISMQ GGDL  VY+RLV GIK +E+KL F+ +   GYLT CPSNLGTT+RASVH+KIPK++  K  F +ICDK +LQARG +GEHTES GG+YDISNK R+GL+E++A+ EM  GV+ II +E +
Sbjct:  186 DRFLKAASGYDDWPTGRGIFFNDNKTFLVWVNEEDHIRIISMQKGGDLAAVYKRLVGGIKELEKKLEFARLPNLGYLTFCPSNLGTTLRASVHIKIPKVAK-KPEFKEICDKLNLQARGIHGEHTESVGGVYDISNKRRMGLSEIEAIQEMRKGVEEIIKLEKA 348          
BLAST of Arginine kinase vs. UniProt/SwissProt
Match: sp|Q95PM9|KARG_PLOIN (Arginine kinase OS=Plodia interpunctella OX=58824 GN=ARGK PE=1 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 2.242e-70
Identity = 100/165 (60.61%), Postives = 127/165 (76.97%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            D  L+ A   R WPSGRGI+HN  KTFLVW  EEDH+R+ISMQMGGDL QVY+RLV G+  I +++ FSH ++ G+LT CP+NLGTT+RASVH+K+PKL++DK    ++  KYHLQ RG  GEHTE+ GG+YDISNK R+GLTE +AV EM +G+  +I IE SL
Sbjct:  191 DRFLQAANACRFWPSGRGIYHNENKTFLVWCNEEDHLRLISMQMGGDLKQVYKRLVRGVNDIAKRIPFSHNERLGFLTFCPTNLGTTVRASVHIKLPKLAADKAKLEEVASKYHLQVRGTRGEHTEAEGGVYDISNKRRMGLTEYEAVKEMYDGIAELIKIEKSL 355          
BLAST of Arginine kinase vs. UniProt/SwissProt
Match: sp|P48610|KARG_DROME (Arginine kinase OS=Drosophila melanogaster OX=7227 GN=Argk PE=2 SV=2)

HSP 1 Score: 215.312 bits (547), Expect = 5.713e-68
Identity = 97/165 (58.79%), Postives = 125/165 (75.76%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            D  L+ A   R WPSGRGI+HN  KTFLVW  EEDH+RIISMQ GGDL Q+Y+RLV  +  IE+++ FSH  + G+LT CP+NLGTT+RASVH+K+PKL+S+K    ++  KY+LQ RG  GEHTE+ GG+YDISNK R+GLTE +AV EM +G+  +I +E SL
Sbjct:  192 DRFLQAANACRFWPSGRGIYHNDAKTFLVWCNEEDHLRIISMQQGGDLGQIYKRLVTAVNEIEKRVPFSHDDRLGFLTFCPTNLGTTIRASVHIKVPKLASNKAKLEEVAAKYNLQVRGTRGEHTEAEGGVYDISNKRRMGLTEFEAVKEMYDGITELIKLEKSL 356          
BLAST of Arginine kinase vs. UniProt/SwissProt
Match: sp|P51541|KARG_LIMPO (Arginine kinase OS=Limulus polyphemus OX=6850 PE=1 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 6.689e-68
Identity = 100/162 (61.73%), Postives = 121/162 (74.69%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIE 487
            D  L+ A   R WP+GRGIFHN  KTFLVWV EEDH+RIISMQ GGDL  VY+RLV  +  IE KL FSH  ++G+LT CP+NLGTTMRASVH+++PKL+ D+    DI  K++LQ RG  GEHTES GG+YDISNK RLGLTE  AV EM +G+  +I +E
Sbjct:  192 DRFLQTANACRYWPTGRGIFHNDAKTFLVWVNEEDHLRIISMQKGGDLKTVYKRLVTAVDNIESKLPFSHDDRFGFLTFCPTNLGTTMRASVHIQLPKLAKDRKVLEDIASKFNLQVRGTRGEHTESEGGVYDISNKRRLGLTEYQAVREMQDGILEMIKME 353          
BLAST of Arginine kinase vs. TrEMBL
Match: S4VGM4 (Taurocyamine kinase OS=Dugesia sp. BJR-2013 OX=1350396 PE=2 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 5.915e-101
Identity = 145/165 (87.88%), Postives = 154/165 (93.33%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            DPVLRDAGGYRDWPSGRGIFHNT KTFLVWVCEEDHIRIISMQ GGDL QVYQRLVLGI+ IEEK+ F+HMKKYGYLTCCPSNLGTTMRASVHVKIPKLSS++  F+++CDKYHLQARG YGEHTES GG+YDISNKHRLGLTELDA TEMANGVKAIIDIE SL
Sbjct:  551 DPVLRDAGGYRDWPSGRGIFHNTNKTFLVWVCEEDHIRIISMQKGGDLPQVYQRLVLGIRTIEEKMPFAHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSNQAKFSEVCDKYHLQARGLYGEHTESVGGVYDISNKHRLGLTELDAATEMANGVKAIIDIEKSL 715          

HSP 2 Score: 235.343 bits (599), Expect = 1.034e-69
Identity = 111/166 (66.87%), Postives = 133/166 (80.12%), Query Frame = 2
Query:    8 VLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL*SF 505
            VLRDAGGYRDWP+GRGI+ N K  FLVWV EEDH+RIISM+ GGDL +VY+RLV GIK +EE L F+  ++YGYLT CPSNLGTTMRASVHV+IP +SS    F +IC KY LQARG YGEHTES GGIYD+SN+ RLG TE++A  EMA GVK I+++E ++  F
Sbjct:  191 VLRDAGGYRDWPTGRGIYLNHKNNFLVWVNEEDHLRIISMESGGDLSRVYRRLVKGIKTLEENLGFARHQRYGYLTFCPSNLGTTMRASVHVRIPMVSS-LPNFKEICQKYQLQARGTYGEHTESLGGIYDLSNQRRLGYTEIEAAQEMAVGVKEIVELEATMQEF 355          
BLAST of Arginine kinase vs. TrEMBL
Match: A0A3S5AIW1 (Phosphagen kinase C-terminal domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS31484 PE=3 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 1.509e-90
Identity = 123/163 (75.46%), Postives = 142/163 (87.12%), Query Frame = 2
Query:    8 VLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            +LRDAGGYRDWPSGRGIFHN+ KTFLVWVCEEDHIRIISMQ GG+L+ VY+RL+ GIKAIEEK+ F+H  KYGYLTCCPSNLGTTMRASVHV++PKLS++K  F ++C K++LQARGF+GEHTES  GIYDISNK RLGLTEL+A TEM  GV  II IE S+
Sbjct:    1 LLRDAGGYRDWPSGRGIFHNSAKTFLVWVCEEDHIRIISMQKGGNLLAVYKRLIQGIKAIEEKMKFAHSTKYGYLTCCPSNLGTTMRASVHVRVPKLSANKEKFQEVCSKFNLQARGFHGEHTESPDGIYDISNKRRLGLTELEAATEMGKGVAEIIKIESSM 163          
BLAST of Arginine kinase vs. TrEMBL
Match: Q5C101 (SJCHGC06211 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 252.292 bits (643), Expect = 1.798e-81
Identity = 115/165 (69.70%), Postives = 132/165 (80.00%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            DPVLRDAGGYRDWP GRGIFHN  KTFLVWVCEEDH+RIISMQ GGDL  VY+RL+ GI AI + + F+H  KYGY+TCCPSNLGT+MRASV +KIPKLS+      +IC+KY LQARG YGEHTES  G YDISN+ RLGLTEL A  EMA GV  +I++E +L
Sbjct:   78 DPVLRDAGGYRDWPVGRGIFHNKAKTFLVWVCEEDHMRIISMQKGGDLASVYKRLIEGINAIGKSMKFAHSDKYGYITCCPSNLGTSMRASVLLKIPKLSAQPKKLNEICEKYILQARGLYGEHTESPDGTYDISNRRRLGLTELQAAHEMAEGVAKMIEVEKAL 242          
BLAST of Arginine kinase vs. TrEMBL
Match: C7BCG0 (Taurocyamine kinase OS=Paragonimus westermani OX=34504 PE=2 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 1.319e-80
Identity = 122/165 (73.94%), Postives = 135/165 (81.82%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            DPVLRDAGGYRDWP+GRGIFHN  KTFLVWVCEEDH+R+ISMQ GGDL  V++RL+ G+KAIE KL F H  KYGY+TCCPSNLGTTMRASV VKIPKLS+ K    ++C KY LQARG +GEHTES  GI+DISNK RLGLTELDA  EMA GV  II IE SL
Sbjct:  552 DPVLRDAGGYRDWPTGRGIFHNNNKTFLVWVCEEDHMRVISMQQGGDLAAVFKRLIQGLKAIETKLKFEHSDKYGYVTCCPSNLGTTMRASVLVKIPKLSAQKDKLDEVCAKYRLQARGLHGEHTESPDGIHDISNKRRLGLTELDAAKEMAEGVAHIIAIEQSL 716          

HSP 2 Score: 224.172 bits (570), Expect = 2.083e-65
Identity = 102/168 (60.71%), Postives = 130/168 (77.38%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL*SF 505
            D VLRDAGGY DWP+GRGIF N  + FLVW+ EEDHIR+ISMQ GGDL+ +Y+RL   I  + + L F+   ++G++T CPSNLGTT+RASVH ++P LSS    F  IC+KY +QARG +GEHT S GG+YD+SNK RLGLTE+DAVTEM NGV+A++D+E  L S+
Sbjct:  189 DSVLRDAGGYIDWPNGRGIFINDAQNFLVWINEEDHIRVISMQKGGDLIAIYKRLAGAINELSKTLKFAFNNRFGFITFCPSNLGTTLRASVHARVPFLSS-LPNFNQICEKYAIQARGTHGEHTASVGGVYDLSNKRRLGLTEIDAVTEMYNGVRALLDLEKQLVSY 355          
BLAST of Arginine kinase vs. TrEMBL
Match: A0A4S2LJT5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008370 PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 2.495e-80
Identity = 119/165 (72.12%), Postives = 136/165 (82.42%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            DPVLRDAGGYRDWP GRGIFHN  KTFLVW+CEEDH+RIISMQ GGDL  VY+RL+ GI+AIE+ L F+H  KYGY+TCCPSNLGTTMRASV +KIPKLS+ K    ++C KY LQARG +GEHTES  GI+DISNK RLGLTEL+A  EMA+GV  +I IE SL
Sbjct:  383 DPVLRDAGGYRDWPHGRGIFHNANKTFLVWLCEEDHMRIISMQKGGDLAAVYKRLIQGIQAIEKTLPFAHSDKYGYITCCPSNLGTTMRASVLLKIPKLSAQKAKLDEVCAKYRLQARGLHGEHTESPEGIHDISNKRRLGLTELEAAKEMADGVAQMIAIEKSL 547          

HSP 2 Score: 221.09 bits (562), Expect = 1.328e-65
Identity = 101/165 (61.21%), Postives = 130/165 (78.79%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            D VLRDAGGY DWP+GRGIF N  + FLVWV EEDHIR+ISMQ GGDL+ VY+RL   I  + + L+F+   ++G++T CPSNLGTT+RASVH ++P LS+    F  IC+KY++QARG +GEHT S GG+YD+SNK RLGLTE++AVTEM NGV+A++D+E  L
Sbjct:   20 DSVLRDAGGYIDWPNGRGIFINETENFLVWVNEEDHIRVISMQKGGDLIAVYKRLANAISELGKSLTFATNDRFGFITFCPSNLGTTLRASVHARVPYLSA-LPNFEQICEKYNIQARGTHGEHTASVGGVYDLSNKRRLGLTEIEAVTEMYNGVQALLDLEKQL 183          
BLAST of Arginine kinase vs. Ensembl Cavefish
Match: ckma (creatine kinase M-type [Source:NCBI gene;Acc:103045415])

HSP 1 Score: 164.081 bits (414), Expect = 1.155e-48
Identity = 81/169 (47.93%), Postives = 110/169 (65.09%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V++R  +G+  IEE        F   +  GY+  CPSNLGT +R  VHVK+PKLS+    F +I  +  LQ RG  G  T S GG++DISN  R+G +E+D V  + +GVK ++++E  L
Sbjct:  200 PLLLAAGMARDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLNKIEEVFKKHNHGFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRIGSSEVDQVQCVVDGVKLMVEMEKKL 367          
BLAST of Arginine kinase vs. Ensembl Cavefish
Match: ckma (creatine kinase M-type [Source:NCBI gene;Acc:103045415])

HSP 1 Score: 164.081 bits (414), Expect = 1.155e-48
Identity = 81/169 (47.93%), Postives = 110/169 (65.09%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V++R  +G+  IEE        F   +  GY+  CPSNLGT +R  VHVK+PKLS+    F +I  +  LQ RG  G  T S GG++DISN  R+G +E+D V  + +GVK ++++E  L
Sbjct:  200 PLLLAAGMARDWPDARGIWHNENKTFLVWVNEEDHLRVISMQKGGNMKEVFKRFCVGLNKIEEVFKKHNHGFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRIGSSEVDQVQCVVDGVKLMVEMEKKL 367          
BLAST of Arginine kinase vs. Ensembl Cavefish
Match: ckmb (creatine kinase, muscle b [Source:ZFIN;Acc:ZDB-GENE-040426-2128])

HSP 1 Score: 162.925 bits (411), Expect = 7.421e-48
Identity = 80/169 (47.34%), Postives = 110/169 (65.09%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQ+GG++ +V++R   G++ IEE        F   +  G++  CPSNLGT +R  VHVK+PKLS+    F +I  +  LQ RG  G  T S GG++DISN  RLG +E+  V  + +GVK ++++E  L
Sbjct:  199 PLLLAAGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQLGGNMKEVFKRFCTGLQKIEETFKKHNHGFMWNEHLGFILTCPSNLGTGLRGGVHVKLPKLST-HAKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVQQVQLVVDGVKLMVEMEKKL 366          
BLAST of Arginine kinase vs. Ensembl Cavefish
Match: ckba (creatine kinase B-type [Source:NCBI gene;Acc:103021922])

HSP 1 Score: 160.614 bits (405), Expect = 2.120e-47
Identity = 80/169 (47.34%), Postives = 108/169 (63.91%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V+ R   G+  IEE       SF   +  GY+  CPSNLGT +R  VHVK+P +S   + F +I  K  LQ RG  G  T + GG++DISN  RLG +E++ V  + +GVK +I++E  L
Sbjct:  200 PLLLASGMARDWPDARGIWHNDSKTFLVWVNEEDHLRVISMQKGGNMKEVFNRFCTGLTKIEELFKNKGHSFMWNEHLGYVLTCPSNLGTGLRGGVHVKLPNVSK-HSKFEEILKKLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLIEMEKRL 367          
BLAST of Arginine kinase vs. Ensembl Cavefish
Match: ckbb (creatine kinase, brain b [Source:ZFIN;Acc:ZDB-GENE-020103-2])

HSP 1 Score: 159.073 bits (401), Expect = 1.167e-46
Identity = 79/169 (46.75%), Postives = 109/169 (64.50%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAI-----EEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP GRGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V+ R   G+  I     E+   F   +  GY+  CPSNLGT +RA VHVK+P +S ++  F +I  K  LQ RG  G  T + GG++DISN  RLG +E++ V  + +GV  +I++E  L
Sbjct:  208 PLLLASGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMREVFNRFCTGLTKIEGLFKEKGHEFMWNEHLGYVLTCPSNLGTGLRAGVHVKLPNVSKNE-KFGEILKKLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVNLLIEMEKRL 375          
BLAST of Arginine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005045.1 (pep scaffold:Pmarinus_7.0:GL495569:1868:3379:-1 gene:ENSPMAG00000004586.1 transcript:ENSPMAT00000005045.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 4.716e-22
Identity = 45/103 (43.69%), Postives = 61/103 (59.22%), Query Frame = 2
Query:  188 EEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            E    F   ++ GY+  CPSNLGT +RA VHVK+P LS DK  F+ I D   LQ RG  G  + + G  +DISN  RLG +E++ V  + +GV  +I+ E  L
Sbjct:    8 ERGWEFMWNERLGYILTCPSNLGTGLRAGVHVKLPHLSKDK-RFSQILDNLRLQKRGTGGVDSATTGDTFDISNLDRLGKSEVELVQLVVDGVNYLIECEKKL 109          
BLAST of Arginine kinase vs. Ensembl Nematostella
Match: EDO49262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGZ5])

HSP 1 Score: 203.371 bits (516), Expect = 1.223e-61
Identity = 95/167 (56.89%), Postives = 123/167 (73.65%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAG---GIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMS 493
            D  L  AG  ++WP GRGIFHN +KTFLVWV EED +RIISM+MG D+  V+ RL   +  +++KL F H K +GYLT CP+NLGT MRASVHVKIP  + D   F  IC+K+H+QARG +GEH+ES G   G+YDISNK RLGL+E+  V +M NGVK++++IE +
Sbjct:  190 DRFLDAAGCNKEWPEGRGIFHNNEKTFLVWVNEEDQLRIISMEMGSDIGSVFSRLCRAVNELDKKLGFQHTKSHGYLTSCPTNLGTGMRASVHVKIPH-AKDHPEFDKICEKFHIQARGIHGEHSESTGEDAGVYDISNKRRLGLSEVQCVQDMYNGVKSLLEIERA 355          

HSP 2 Score: 191.045 bits (484), Expect = 5.386e-57
Identity = 90/167 (53.89%), Postives = 119/167 (71.26%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAG---GIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMS 493
            D  L  AG  + WP GRGIFHN  KTFLVW+ EED +RIISM+ G D+  V+ RL   +  +++KL F H   +GYL+ CP+NLGT MRASVHVKIPK +S+   F  ICD++H+QARG +GEH+ S G   G++DISNK RLGL+E+  V +M NGVK +++IE +
Sbjct:  542 DRFLEAAGVNKLWPEGRGIFHNNDKTFLVWINEEDQLRIISMEKGSDIGSVFSRLCRAVNELDKKLGFQHTDAHGYLSGCPTNLGTGMRASVHVKIPK-ASEHPDFQKICDEFHIQARGIHGEHSVSTGEDAGVFDISNKRRLGLSEVQCVQDMYNGVKKLLEIEKA 707          
BLAST of Arginine kinase vs. Ensembl Nematostella
Match: EDO34236 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPV6])

HSP 1 Score: 193.741 bits (491), Expect = 1.680e-60
Identity = 91/167 (54.49%), Postives = 119/167 (71.26%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAG---GIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMS 493
            D  L  AG  R+WP GRGIFHN  KTFLVWV EED +RIISM+MG D+  V++RL   +  ++ KL F  +  +GYL+ CP+NLGT MRASVHVKIP  S+    F  ICD++H+QARG +GEH+ S G   G++DISNK RLGL+E+  V +M NGVK +++IE +
Sbjct:  223 DRFLEAAGVNREWPEGRGIFHNNDKTFLVWVNEEDQLRIISMEMGSDIGSVFRRLCTAVNELDNKLGFQQLPGHGYLSSCPTNLGTGMRASVHVKIPHASA-HPDFQKICDEFHIQARGIHGEHSVSTGADAGVFDISNKRRLGLSEVQCVQDMYNGVKKLLEIEKA 388          
BLAST of Arginine kinase vs. Ensembl Nematostella
Match: EDO34237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPV7])

HSP 1 Score: 195.667 bits (496), Expect = 7.793e-59
Identity = 92/167 (55.09%), Postives = 122/167 (73.05%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAG---GIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMS 493
            D  L  AG  + WP GRGIFHN  KTFLVWV EED +RIISM+MG D+  V+ RL   +  I+++L F+H + +GYL+ CP+NLGT MRASVHVKIPK +S+   F  ICD++H+QARG +GEH+ S G   G++DISNK RLGL+E+  V +M NGVK +++IE +
Sbjct:  518 DRFLEAAGVNKMWPEGRGIFHNNDKTFLVWVNEEDQLRIISMEMGSDIGSVFSRLCRAVNEIDKQLGFAHKETHGYLSGCPTNLGTGMRASVHVKIPK-ASEHPDFQKICDEFHIQARGIHGEHSVSTGEDAGVFDISNKRRLGLSEVQCVQDMYNGVKKLLEIEKA 683          

HSP 2 Score: 194.512 bits (493), Expect = 2.381e-58
Identity = 91/167 (54.49%), Postives = 121/167 (72.46%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAG---GIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMS 493
            D  L  AG  + WP GRGIFHN  KTFLVWV EED +RIISM+MG D+  V++RL   +  I+++L F H +++GYL+ CP+NLGT MRASVHVKIP  S+    F  ICD++H+QARG +GEH+ S G   G++DISNK RLGL+E+  V +M NGVK +++IE +
Sbjct:  166 DRFLEAAGVNKLWPEGRGIFHNNDKTFLVWVNEEDQLRIISMEMGSDIGSVFKRLCTAVNEIDKQLGFQHTEEHGYLSSCPTNLGTGMRASVHVKIPHASA-HPDFQKICDEFHIQARGIHGEHSVSTGADAGVFDISNKRRLGLSEVQCVQDMYNGVKKLLEIERA 331          
BLAST of Arginine kinase vs. Ensembl Nematostella
Match: EDO46231 (Cytoplasmic creatine kinase protein; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQU9])

HSP 1 Score: 158.303 bits (399), Expect = 4.870e-47
Identity = 80/169 (47.34%), Postives = 103/169 (60.95%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN  K FLVWV EEDH R+ISM+ GGD+  V+ R   G+  +E  +      F   +  GY+  CPSNLGT +RA VH+KIP LS D+     I  K  LQ RG  G  T S GG+YDISN  R+G +E++ V  M +GV  +I++E  L
Sbjct:  196 PLLTCAGMARDWPDARGIWHNENKNFLVWVNEEDHTRVISMEKGGDMRAVFTRFCNGLNKVESLIKEAGYEFMWNEHLGYVLTCPSNLGTGLRAGVHLKIPLLSQDEKRLDAILAKLKLQKRGTGGVDTASVGGVYDISNADRIGFSEVELVQGMVDGVGLLIEMEKRL 364          
BLAST of Arginine kinase vs. Ensembl Nematostella
Match: EDO46975 (Mitochondrial creatine kinase; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNR3])

HSP 1 Score: 159.073 bits (401), Expect = 6.449e-47
Identity = 81/169 (47.93%), Postives = 104/169 (61.54%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN  K FL+WV EEDH R+ISMQ GGD+  V+ R   G+  +E  +      F   +  GY+  CPSNLGT +RA VHVK+P L  DK   T I DK  LQ RG  G  T + GG +DISN  RLG +E++ V ++ +GV  +ID+E  L
Sbjct:  232 PLLTCAGMARDWPDARGIWHNDSKNFLIWVNEEDHTRVISMQQGGDMRSVFDRFCRGLNQVEGLIKKKGHEFMWNQHLGYILTCPSNLGTGLRAGVHVKLPNLGKDKRLDT-ILDKLRLQKRGTGGVDTAAVGGTFDISNSDRLGYSEVELVQKVIDGVNLLIDMEKRL 399          
BLAST of Arginine kinase vs. Ensembl Medaka
Match: CKM (creatine kinase M-type [Source:NCBI gene;Acc:101163677])

HSP 1 Score: 165.236 bits (417), Expect = 8.584e-49
Identity = 82/169 (48.52%), Postives = 112/169 (66.27%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP GRGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V++R  +G++ IEE        F   +  GY+  CPSNLGT +R  VHVK+PKLS+    F +I  +  LQ RG  G  T S GG++DISN  RLG +E+D V  + +GVK ++++E  L
Sbjct:  240 PLLTCSGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFRRFCVGLQKIEEIFKKHNHGFMWNEHLGYILTCPSNLGTGLRGGVHVKLPKLST-HPKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVDQVQLVVDGVKLMVEMEKKL 407          
BLAST of Arginine kinase vs. Ensembl Medaka
Match: CKM (creatine kinase M-type [Source:NCBI gene;Acc:101166239])

HSP 1 Score: 163.696 bits (413), Expect = 1.250e-48
Identity = 82/169 (48.52%), Postives = 111/169 (65.68%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP GRGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V++R  +G++ IEE        F   +  GY+  CPSNLGT +R  VHVK+PKLS+    F +I  +  LQ RG  G  T S GG++DISN  RLG +E+  V  + +GVK ++++E  L
Sbjct:  200 PLLTCAGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMREVFRRFCVGLQKIEEIFKKHNHGFMWNEHLGYILTCPSNLGTGLRGGVHVKLPKLST-HPKFEEILTRLRLQKRGTGGVDTASVGGVFDISNADRLGSSEVAQVQLVVDGVKLMVEMEKKL 367          
BLAST of Arginine kinase vs. Ensembl Medaka
Match: ENSORLT00000025242.2 (creatine kinase B-type [Source:NCBI gene;Acc:101167262])

HSP 1 Score: 159.073 bits (401), Expect = 9.657e-47
Identity = 78/169 (46.15%), Postives = 107/169 (63.31%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP GRGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V+ R   G+  IEE        F   +  GY+  CPSNLGT +RA VHVK+P LS  +  F ++  +  LQ RG  G  T + GG++DISN  RLG +E++ V  + +GV  ++ +E  L
Sbjct:  200 PLLLSSGMARDWPDGRGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMREVFNRFCTGLTKIEELFKEQGHEFMWNEHLGYVLTCPSNLGTGLRAGVHVKLPNLSKHE-KFGEVLKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVNLLVSMEKCL 367          
BLAST of Arginine kinase vs. Ensembl Medaka
Match: ENSORLT00000001794.2 (creatine kinase U-type, mitochondrial [Source:NCBI gene;Acc:101164721])

HSP 1 Score: 157.918 bits (398), Expect = 4.869e-46
Identity = 78/169 (46.15%), Postives = 108/169 (63.91%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLS-----FSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  AG  RDWP  RGI+HN +KTFL+WV EEDH R+ISM+ GG++ +V++R   G+K +E  +      F   ++ GY+  CPSNLGT +RA VHVK+P LS D   F+ I D   LQ RG  G  T + GG++DISN  RLG +E+  V  + +GV  +++ E  L
Sbjct:  234 PLLTCAGMARDWPDARGIWHNNEKTFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVKLPLLSKD-PRFSKILDNLRLQKRGTGGVDTAAVGGVFDISNLDRLGHSEVQLVQTVIDGVNYLVECEKKL 401          
BLAST of Arginine kinase vs. Ensembl Medaka
Match: CKB (creatine kinase B [Source:NCBI gene;Acc:101174062])

HSP 1 Score: 154.066 bits (388), Expect = 6.865e-45
Identity = 75/169 (44.38%), Postives = 105/169 (62.13%), Query Frame = 2
Query:    5 PVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKL-----SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            P+L  +G  RDWP  RGI+HN  KTFLVWV EEDH+R+ISMQ GG++ +V+ R   G+  IE         F   +  GY+  CPSNLGT +RA VH+K+P +S     F ++  +  LQ RG  G  T + GG++DISN  RLG +E++ V  + +GVK + ++E  L
Sbjct:  200 PLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFNRFCTGLTKIESLFKEKGHEFMWNEHLGYVLTCPSNLGTGLRAGVHMKLPNMSK-HAKFEEVLKRLRLQKRGTGGVDTAAVGGVFDISNADRLGFSEVELVQMVVDGVKLLTEMEKRL 367          
BLAST of Arginine kinase vs. Planmine SMEST
Match: SMESG000063979.1 (SMESG000063979.1)

HSP 1 Score: 348.977 bits (894), Expect = 7.131e-117
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL
Sbjct:  562 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 726          

HSP 2 Score: 194.897 bits (494), Expect = 4.584e-58
Identity = 95/145 (65.52%), Postives = 113/145 (77.93%), Query Frame = 2
Query:   71 KKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL*SF 505
            +  FLVWV EEDH+RIISM+ GGDL +VY+RLV GIK +E+KL F+   +YGYLT CPSNLGTTMRASVH KIP LS+    F +IC KY LQARG YGEHTES  GIYD+SN+ RLG TE+DAV EMA GVKAI+++E  +  F
Sbjct:  223 ENNFLVWVNEEDHLRIISMEAGGDLAKVYRRLVKGIKTMEDKLGFARHGRYGYLTFCPSNLGTTMRASVHAKIPMLST-LPNFKEICQKYQLQARGTYGEHTESLNGIYDLSNQRRLGYTEIDAVNEMAIGVKAIVELEALMQRF 366          
BLAST of Arginine kinase vs. Planmine SMEST
Match: SMESG000063979.1 (SMESG000063979.1)

HSP 1 Score: 348.206 bits (892), Expect = 2.586e-116
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL
Sbjct:  574 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 738          

HSP 2 Score: 238.424 bits (607), Expect = 3.329e-74
Identity = 115/168 (68.45%), Postives = 133/168 (79.17%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL*SF 505
            D VLRDAGGYRDWPSGRGI+ N K  FLVWV EEDH+RIISM+ GGDL +VY+RLV GIK +E+KL F+   +YGYLT CPSNLGTTMRASVH KIP LS+    F +IC KY LQARG YGEHTES  GIYD+SN+ RLG TE+DAV EMA GVKAI+++E  +  F
Sbjct:  212 DSVLRDAGGYRDWPSGRGIYLNHKNNFLVWVNEEDHLRIISMEAGGDLAKVYRRLVKGIKTMEDKLGFARHGRYGYLTFCPSNLGTTMRASVHAKIPMLST-LPNFKEICQKYQLQARGTYGEHTESLNGIYDLSNQRRLGYTEIDAVNEMAIGVKAIVELEALMQRF 378          
BLAST of Arginine kinase vs. Planmine SMEST
Match: SMESG000069023.1 (SMESG000069023.1)

HSP 1 Score: 276.559 bits (706), Expect = 4.312e-89
Identity = 126/165 (76.36%), Postives = 143/165 (86.67%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            DPVLRDAGGYRDWPSGRGIFHN +KTFLVWVCEEDH+RIISMQ GGD+  V+ RLV GI+ IE KL+F+H KKYGYLTCCPSNLGTTMRASVH+KIPKLSSDKT   ++CD+++LQARGF+GEHTES  GIYDISNK RLGL E++A TEMA GV  +I IE SL
Sbjct:  541 DPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIEKSL 705          

HSP 2 Score: 232.646 bits (592), Expect = 2.359e-72
Identity = 109/165 (66.06%), Postives = 131/165 (79.39%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            D VLRDAGGYRDWPSGRGIF N +KTF+VW+ EEDHIRIISM+ GGDL +VY+RL+ G+K +EE L F   K++G+LT CP+NLGTTMRASVH+KIP LS     F  IC++Y LQARG YGEHTE+ GG++DISN+ RLGLTE+ A  EM +GV AII IE  L
Sbjct:  178 DQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSM-LPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 341          
BLAST of Arginine kinase vs. Planmine SMEST
Match: SMESG000069023.1 (SMESG000069023.1)

HSP 1 Score: 276.944 bits (707), Expect = 4.925e-89
Identity = 126/165 (76.36%), Postives = 143/165 (86.67%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            DPVLRDAGGYRDWPSGRGIFHN +KTFLVWVCEEDH+RIISMQ GGD+  V+ RLV GI+ IE KL+F+H KKYGYLTCCPSNLGTTMRASVH+KIPKLSSDKT   ++CD+++LQARGF+GEHTES  GIYDISNK RLGL E++A TEMA GV  +I IE SL
Sbjct:  552 DPVLRDAGGYRDWPSGRGIFHNNEKTFLVWVCEEDHMRIISMQKGGDIAAVFTRLVQGIRQIETKLTFAHSKKYGYLTCCPSNLGTTMRASVHLKIPKLSSDKTKLNEVCDRFNLQARGFHGEHTESPEGIYDISNKRRLGLMEIEAATEMAKGVLEMIQIEKSL 716          

HSP 2 Score: 233.032 bits (593), Expect = 2.500e-72
Identity = 109/165 (66.06%), Postives = 131/165 (79.39%), Query Frame = 2
Query:    2 DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQVYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIEMSL 496
            D VLRDAGGYRDWPSGRGIF N +KTF+VW+ EEDHIRIISM+ GGDL +VY+RL+ G+K +EE L F   K++G+LT CP+NLGTTMRASVH+KIP LS     F  IC++Y LQARG YGEHTE+ GG++DISN+ RLGLTE+ A  EM +GV AII IE  L
Sbjct:  189 DQVLRDAGGYRDWPSGRGIFLNNEKTFVVWINEEDHIRIISMEPGGDLPKVYRRLIAGLKGLEENLEFERHKRFGFLTFCPTNLGTTMRASVHIKIPFLSM-LPNFKQICEQYSLQARGTYGEHTENVGGVFDISNQRRLGLTEIQAAKEMYDGVNAIIAIEKML 352          
BLAST of Arginine kinase vs. Planmine SMEST
Match: SMESG000022010.1 (SMESG000022010.1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.012e-15
Identity = 52/169 (30.77%), Postives = 82/169 (48.52%), Query Frame = 2
Query:    8 VLRDAGGYRDWPSGRGIFH-----NTKKTFLVWVCEE-DHIRIISMQMGGDLVQV-YQRLVLGIKAIEEKL--SFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLSSDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTEMANGVKAIIDIE 487
            V +  G Y DWP  RG+F      N    FLV +    DHI++IS+   G  + + Y R V  +K +  +L   +++   YGYLT  PS++G  MR S  VK+  L  ++      C       RG  G  + +   ++D+S K  L +TE+  +   A  +K +I +E
Sbjct:  596 VNKSCGLYSDWPRHRGVFFAQKNINYPNIFLVILVNFIDHIKVISLDPNGKKLNLCYDRAVNVMKFLNLRLHEKYAYRWGYGYLTTVPSSVGCAMRISALVKLVHLGKNREILEKHCKAMQFAYRGTSGYGSVAVDNVFDLSLKLNLNVTEIWLLMMFAQRLKDLILLE 764          
The following BLAST results are available for this feature:
BLAST of Arginine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CKMT1A1.358e-4545.56creatine kinase, mitochondrial 1A [Source:HGNC Sym... [more]
CKMT1A1.358e-4545.56creatine kinase, mitochondrial 1A [Source:HGNC Sym... [more]
CKMT1B1.358e-4545.56creatine kinase, mitochondrial 1B [Source:HGNC Sym... [more]
CKMT1B1.358e-4545.56creatine kinase, mitochondrial 1B [Source:HGNC Sym... [more]
CKB1.775e-4544.38creatine kinase B [Source:HGNC Symbol;Acc:HGNC:199... [more]
back to top
BLAST of Arginine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F46H5.35.034e-6356.71Probable arginine kinase F46H5.3 [Source:UniProtK... [more]
F46H5.35.034e-6356.71Probable arginine kinase F46H5.3 [Source:UniProtK... [more]
F46H5.35.034e-6356.71Probable arginine kinase F46H5.3 [Source:UniProtK... [more]
F46H5.35.034e-6356.71Probable arginine kinase F46H5.3 [Source:UniProtK... [more]
F46H5.31.534e-6256.71Probable arginine kinase F46H5.3 [Source:UniProtK... [more]
back to top
BLAST of Arginine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Argk5.699e-6958.79gene:FBgn0000116 transcript:FBtr0331550[more]
Argk5.699e-6958.79gene:FBgn0000116 transcript:FBtr0076545[more]
Argk5.699e-6958.79gene:FBgn0000116 transcript:FBtr0345030[more]
Argk9.736e-6958.79gene:FBgn0000116 transcript:FBtr0112791[more]
Argk1.375e-6858.79gene:FBgn0000116 transcript:FBtr0076544[more]
back to top
BLAST of Arginine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ckmb3.790e-4847.34creatine kinase, muscle b [Source:ZFIN;Acc:ZDB-GEN... [more]
ckmb3.790e-4847.34creatine kinase, muscle b [Source:ZFIN;Acc:ZDB-GEN... [more]
ckbb1.123e-4745.56creatine kinase, brain b [Source:ZFIN;Acc:ZDB-GENE... [more]
ckma1.937e-4746.75creatine kinase, muscle a [Source:ZFIN;Acc:ZDB-GEN... [more]
ckma1.937e-4746.75creatine kinase, muscle a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Arginine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ckb7.680e-4745.56creatine kinase, brain [Source:NCBI gene;Acc:73354... [more]
ckb8.599e-4745.56creatine kinase, brain [Source:NCBI gene;Acc:73354... [more]
ckb8.812e-4745.56creatine kinase, brain [Source:NCBI gene;Acc:73354... [more]
ckb9.483e-4745.56creatine kinase, brain [Source:NCBI gene;Acc:73354... [more]
rsf11.469e-4646.75remodeling and spacing factor 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of Arginine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ckb2.234e-4543.79creatine kinase, brain [Source:MGI Symbol;Acc:MGI:... [more]
Ckmt17.634e-4544.97creatine kinase, mitochondrial 1, ubiquitous [Sour... [more]
Ckmt17.634e-4544.97creatine kinase, mitochondrial 1, ubiquitous [Sour... [more]
Ckmt21.579e-4444.97creatine kinase, mitochondrial 2 [Source:MGI Symbo... [more]
Ckm3.113e-4443.79creatine kinase, muscle [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Arginine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16641|KTRC_SCHMA4.800e-7870.91Taurocyamine kinase OS=Schistosoma mansoni OX=6183... [more]
sp|O15990|KARG_LIOJA2.266e-7264.63Arginine kinase OS=Liolophura japonica OX=13599 PE... [more]
sp|Q95PM9|KARG_PLOIN2.242e-7060.61Arginine kinase OS=Plodia interpunctella OX=58824 ... [more]
sp|P48610|KARG_DROME5.713e-6858.79Arginine kinase OS=Drosophila melanogaster OX=7227... [more]
sp|P51541|KARG_LIMPO6.689e-6861.73Arginine kinase OS=Limulus polyphemus OX=6850 PE=1... [more]
back to top
BLAST of Arginine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S4VGM45.915e-10187.88Taurocyamine kinase OS=Dugesia sp. BJR-2013 OX=135... [more]
A0A3S5AIW11.509e-9075.46Phosphagen kinase C-terminal domain-containing pro... [more]
Q5C1011.798e-8169.70SJCHGC06211 protein (Fragment) OS=Schistosoma japo... [more]
C7BCG01.319e-8073.94Taurocyamine kinase OS=Paragonimus westermani OX=3... [more]
A0A4S2LJT52.495e-8072.12Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Arginine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ckma1.155e-4847.93creatine kinase M-type [Source:NCBI gene;Acc:10304... [more]
ckma1.155e-4847.93creatine kinase M-type [Source:NCBI gene;Acc:10304... [more]
ckmb7.421e-4847.34creatine kinase, muscle b [Source:ZFIN;Acc:ZDB-GEN... [more]
ckba2.120e-4747.34creatine kinase B-type [Source:NCBI gene;Acc:10302... [more]
ckbb1.167e-4646.75creatine kinase, brain b [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Arginine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005045.14.716e-2243.69pep scaffold:Pmarinus_7.0:GL495569:1868:3379:-1 ge... [more]
back to top
BLAST of Arginine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Arginine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492621.223e-6156.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342361.680e-6054.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342377.793e-5955.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462314.870e-4747.34Cytoplasmic creatine kinase protein; Predicted pro... [more]
EDO469756.449e-4747.93Mitochondrial creatine kinase; Predicted protein ... [more]
back to top
BLAST of Arginine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CKM8.584e-4948.52creatine kinase M-type [Source:NCBI gene;Acc:10116... [more]
CKM1.250e-4848.52creatine kinase M-type [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000025242.29.657e-4746.15creatine kinase B-type [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000001794.24.869e-4646.15creatine kinase U-type, mitochondrial [Source:NCBI... [more]
CKB6.865e-4544.38creatine kinase B [Source:NCBI gene;Acc:101174062][more]
back to top
BLAST of Arginine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063979.17.131e-117100.00SMESG000063979.1[more]
SMESG000063979.12.586e-116100.00SMESG000063979.1[more]
SMESG000069023.14.312e-8976.36SMESG000069023.1[more]
SMESG000069023.14.925e-8976.36SMESG000069023.1[more]
SMESG000022010.12.012e-1530.77SMESG000022010.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013170 ID=SMED30013170|Name=Arginine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=644bp
TGATCCAGTTCTTCGAGATGCTGGTGGTTACAGAGATTGGCCAAGTGGAA
GAGGAATTTTTCACAATACAAAGAAAACCTTCCTGGTCTGGGTTTGTGAG
GAAGACCATATTCGAATTATTTCAATGCAAATGGGTGGAGATCTTGTACA
AGTTTATCAAAGATTAGTTTTGGGTATAAAAGCTATAGAAGAAAAACTTT
CATTCTCTCACATGAAGAAATACGGGTATTTAACATGCTGTCCGAGTAAT
TTGGGGACAACAATGAGAGCCAGTGTTCATGTAAAGATCCCAAAACTGAG
TTCCGATAAGACAACATTCACAGATATATGTGACAAATATCATTTACAAG
CAAGAGGATTTTATGGAGAGCATACTGAATCCGCCGGGGGCATTTACGAC
ATCAGCAATAAGCATCGCCTCGGTCTTACGGAGCTTGACGCAGTCACTGA
AATGGCAAATGGAGTTAAAGCTATCATAGATATTGAAATGTCTTTATAAT
CCTTTTAGTGTTTTAAATTTACCCTCCAGTGATCTCATTTATGATTTCAA
ACGAATTTTTTTTAATATTTATTTTTTATTTCTCTCTAGCCTAACTTTTG
GATTTTTATTTTAAAAACAAGTTCAGTAATTAAAAAAATTGTTG
back to top

protein sequence of SMED30013170-orf-1

>SMED30013170-orf-1 ID=SMED30013170-orf-1|Name=SMED30013170-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=166bp
DPVLRDAGGYRDWPSGRGIFHNTKKTFLVWVCEEDHIRIISMQMGGDLVQ
VYQRLVLGIKAIEEKLSFSHMKKYGYLTCCPSNLGTTMRASVHVKIPKLS
SDKTTFTDICDKYHLQARGFYGEHTESAGGIYDISNKHRLGLTELDAVTE
MANGVKAIIDIEMSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004111creatine kinase activity
GO:0016301kinase activity
GO:0016772transferase activity, transferring phosphorus-containing groups
GO:0003824catalytic activity
GO:0000166nucleotide binding
GO:0004054arginine kinase activity
GO:0005524ATP binding
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0046314phosphocreatine biosynthetic process
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000749ATP-guanido_PTrfase
IPR022414ATP-guanido_PTrfase_cat
IPR014746Gln_synth/guanido_kin_cat_dom
IPR022415ATP-guanido_PTrfase_AS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.590.10coord: 1..162
e-value: 8.6E-69
score: 233.6
NoneNo IPR availablePANTHERPTHR11547:SF55coord: 3..162
IPR022414ATP:guanido phosphotransferase, catalytic domainPFAMPF00217ATP-gua_Ptranscoord: 2..162
e-value: 1.0E-66
score: 224.4
IPR022414ATP:guanido phosphotransferase, catalytic domainPROSITEPS51510PHOSPHAGEN_KINASE_Ccoord: 1..163
score: 59.575
IPR000749ATP:guanido phosphotransferasePANTHERPTHR11547ARGININE OR CREATINE KINASEcoord: 3..162
IPR022415ATP:guanido phosphotransferase active sitePROSITEPS00112PHOSPHAGEN_KINASEcoord: 78..84
IPR014746Glutamine synthetase/guanido kinase, catalytic domainSUPERFAMILYSSF55931Glutamine synthetase/guanido kinasecoord: 2..163