Cactin, spliceosome C complex subunit

Overview
NameCactin, spliceosome C complex subunit
Smed IDSMED30013169
Length (bp)2034
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cactin, spliceosome C complex subunit (SMED30013169) t-SNE clustered cells

Violin plots show distribution of expression levels for Cactin, spliceosome C complex subunit (SMED30013169) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cactin, spliceosome C complex subunit (SMED30013169) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cactin, spliceosome C complex subunit (SMED30013169) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013169

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013169SMESG000061791.1 Contig2041newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013169SMESG000016407.1 Contig2041newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30013169SMESG000061791.1 SmedASXL_013553SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30013169SMESG000061791.1 SmedASXL_013553SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30013169SMESG000061791.1 dd_Smed_v4_8085_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013169SMESG000061791.1 dd_Smed_v4_8085_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013169SMESG000061791.1 dd_Smed_v4_8085_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013169SMESG000061791.1 dd_Smed_v4_8085_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Human
Match: CACTIN (cactin, spliceosome C complex subunit [Source:HGNC Symbol;Acc:HGNC:29938])

HSP 1 Score: 375.941 bits (964), Expect = 1.281e-119
Identity = 232/581 (39.93%), Postives = 329/581 (56.63%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVW-----------------KKKNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFP----------SAIKPEAQVDTKPTSSKKP-------------------------------------EQKLEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+ +NPF D NL   F+W                 K++N  +Q   ++ + EL+ V++   E ER +  R  E E++QR KEA++F+   + + NF ++QAK RSKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  D++DLL DI  Y   +E GKN  +W D+  ITEDE+ ++ K E  G     R EGV      D++ +    T ++   +    +  +  G   ++D+ Y+E      R  +A+ RL+ERH + LR KL +LK EQG+  EPLFP           +++PE    T P  S +                                      +Q L+  +YD  RYSP LL+  EL    ++  +   D+D ++L+  R++    G    + ED   +  +EG  + +  FS ++ +  +++LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDK  TP + L  C D+  +A++ F AGPPYEDIAFKIVNREWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:  192 MGYTNTDNPFGDNNLLGTFIWNKALEKKGISHLEEKELKERNKRIQ---EDNRLELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTWEEQEDNFHLQQAKLRSKIRIRDGRAKPIDLLAKYISAE----DDDLAVEMHEPYTFLNGLTVADMEDLLEDIQVYM-ELEQGKNADFWRDMTTITEDEISKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQGIEGKIRAGGP-NLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLYKLKQEQGVESEPLFPILKQEPQSPSRSLEPEDAAPTPPGPSSEGGPAEAEVDGATPTEGDGDGDGEGEGEGEAVLMEEDLIQQSLD--DYDAGRYSPRLLTAHEL---PLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTGKAYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACADNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR 758          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Human
Match: CACTIN (cactin, spliceosome C complex subunit [Source:HGNC Symbol;Acc:HGNC:29938])

HSP 1 Score: 375.941 bits (964), Expect = 1.281e-119
Identity = 232/581 (39.93%), Postives = 329/581 (56.63%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVW-----------------KKKNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFP----------SAIKPEAQVDTKPTSSKKP-------------------------------------EQKLEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+ +NPF D NL   F+W                 K++N  +Q   ++ + EL+ V++   E ER +  R  E E++QR KEA++F+   + + NF ++QAK RSKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  D++DLL DI  Y   +E GKN  +W D+  ITEDE+ ++ K E  G     R EGV      D++ +    T ++   +    +  +  G   ++D+ Y+E      R  +A+ RL+ERH + LR KL +LK EQG+  EPLFP           +++PE    T P  S +                                      +Q L+  +YD  RYSP LL+  EL    ++  +   D+D ++L+  R++    G    + ED   +  +EG  + +  FS ++ +  +++LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDK  TP + L  C D+  +A++ F AGPPYEDIAFKIVNREWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:  192 MGYTNTDNPFGDNNLLGTFIWNKALEKKGISHLEEKELKERNKRIQ---EDNRLELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTWEEQEDNFHLQQAKLRSKIRIRDGRAKPIDLLAKYISAE----DDDLAVEMHEPYTFLNGLTVADMEDLLEDIQVYM-ELEQGKNADFWRDMTTITEDEISKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQGIEGKIRAGGP-NLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLYKLKQEQGVESEPLFPILKQEPQSPSRSLEPEDAAPTPPGPSSEGGPAEAEVDGATPTEGDGDGDGEGEGEGEAVLMEEDLIQQSLD--DYDAGRYSPRLLTAHEL---PLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTGKAYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACADNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR 758          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Human
Match: CACTIN (cactin, spliceosome C complex subunit [Source:HGNC Symbol;Acc:HGNC:29938])

HSP 1 Score: 375.941 bits (964), Expect = 1.281e-119
Identity = 232/581 (39.93%), Postives = 329/581 (56.63%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVW-----------------KKKNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFP----------SAIKPEAQVDTKPTSSKKP-------------------------------------EQKLEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+ +NPF D NL   F+W                 K++N  +Q   ++ + EL+ V++   E ER +  R  E E++QR KEA++F+   + + NF ++QAK RSKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  D++DLL DI  Y   +E GKN  +W D+  ITEDE+ ++ K E  G     R EGV      D++ +    T ++   +    +  +  G   ++D+ Y+E      R  +A+ RL+ERH + LR KL +LK EQG+  EPLFP           +++PE    T P  S +                                      +Q L+  +YD  RYSP LL+  EL    ++  +   D+D ++L+  R++    G    + ED   +  +EG  + +  FS ++ +  +++LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDK  TP + L  C D+  +A++ F AGPPYEDIAFKIVNREWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:  192 MGYTNTDNPFGDNNLLGTFIWNKALEKKGISHLEEKELKERNKRIQ---EDNRLELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTWEEQEDNFHLQQAKLRSKIRIRDGRAKPIDLLAKYISAE----DDDLAVEMHEPYTFLNGLTVADMEDLLEDIQVYM-ELEQGKNADFWRDMTTITEDEISKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQGIEGKIRAGGP-NLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLYKLKQEQGVESEPLFPILKQEPQSPSRSLEPEDAAPTPPGPSSEGGPAEAEVDGATPTEGDGDGDGEGEGEGEAVLMEEDLIQQSLD--DYDAGRYSPRLLTAHEL---PLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTGKAYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACADNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR 758          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Human
Match: CACTIN (cactin, spliceosome C complex subunit [Source:HGNC Symbol;Acc:HGNC:29938])

HSP 1 Score: 375.941 bits (964), Expect = 1.281e-119
Identity = 232/581 (39.93%), Postives = 329/581 (56.63%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVW-----------------KKKNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFP----------SAIKPEAQVDTKPTSSKKP-------------------------------------EQKLEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+ +NPF D NL   F+W                 K++N  +Q   ++ + EL+ V++   E ER +  R  E E++QR KEA++F+   + + NF ++QAK RSKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  D++DLL DI  Y   +E GKN  +W D+  ITEDE+ ++ K E  G     R EGV      D++ +    T ++   +    +  +  G   ++D+ Y+E      R  +A+ RL+ERH + LR KL +LK EQG+  EPLFP           +++PE    T P  S +                                      +Q L+  +YD  RYSP LL+  EL    ++  +   D+D ++L+  R++    G    + ED   +  +EG  + +  FS ++ +  +++LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDK  TP + L  C D+  +A++ F AGPPYEDIAFKIVNREWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:  192 MGYTNTDNPFGDNNLLGTFIWNKALEKKGISHLEEKELKERNKRIQ---EDNRLELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTWEEQEDNFHLQQAKLRSKIRIRDGRAKPIDLLAKYISAE----DDDLAVEMHEPYTFLNGLTVADMEDLLEDIQVYM-ELEQGKNADFWRDMTTITEDEISKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQGIEGKIRAGGP-NLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLYKLKQEQGVESEPLFPILKQEPQSPSRSLEPEDAAPTPPGPSSEGGPAEAEVDGATPTEGDGDGDGEGEGEGEAVLMEEDLIQQSLD--DYDAGRYSPRLLTAHEL---PLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTGKAYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACADNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR 758          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Human
Match: CACTIN (cactin, spliceosome C complex subunit [Source:HGNC Symbol;Acc:HGNC:29938])

HSP 1 Score: 250.366 bits (638), Expect = 2.766e-77
Identity = 114/210 (54.29%), Postives = 150/210 (71.43%), Query Frame = 3
Query: 1116 EEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            ++YD  RYSP LL+  EL    ++  +   D+D ++L+  R++    G    + ED   +  +EG  + +  FS ++ +  +++LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDK  TP + L  C D+  +A++ F AGPPYEDIAFKIVNREWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:   85 DDYDAGRYSPRLLTAHEL---PLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTGKAYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACADNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR 291          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Celegans
Match: cacn-1 (Cactin [Source:UniProtKB/Swiss-Prot;Acc:G5EG14])

HSP 1 Score: 275.789 bits (704), Expect = 5.158e-83
Identity = 204/580 (35.17%), Postives = 286/580 (49.31%), Query Frame = 3
Query:  219 YTDDNNPFMDPNLTKEFVWKKKN--------NPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRGRKSDSN---FDIEQAKNRSKIRIAEGRAKPIDLLIQYVN--EEENTINDNADAIIHEPTQFLVGLSKXXX--XXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDEL-KRVIKTEDDGRTEGVTKECVDDMKQMILQGTIDESTELLN--DAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPI-----EPLFPSA-IKPEAQVDTKPTS-----------SKKPEQKLE------------------------------REEYDHSRYSPVLLS------GEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            YT+ NNPF D  LT+ FVW KK            ++  Q  Q   +N+    +           ++++    ++A    G+ SD+    F ++Q K R++IRI +GRAK IDLL +Y    +E        D  +  P ++L    K     +DL+ DI  Y       KN  +W D+  I EDE+ K+  +   D     V      +++ M    +IDE  +L +  DAK    +G++      Y++      +V IA+KRL+E H   LR++L  +K EQ   I     E L P A + P+ ++  +              SKK  +K++                              RE Y    YSP  +S      G E+ DE   +V  L +   +    +                +++ + +EG E  +  F  +  +  Q  LWSDKYRPRKP +LNRV TGFDWNKYNQTHYD DNPPPKIVQGYKFNI YPDL+D T  P F LT C D D +A+I FKAGPPYEDIAFK+VNREWET  ++GYKCQF   + QL+F FK+YRYR+
Sbjct:   90 YTNLNNPFNDTKLTQTFVWGKKLEREGKSGLTQDEITKQTSQRIRKNLHEAAEFKRIRDSRAAAKEDMEMMKRDADLRAGQISDTKEREFQMDQIKERTRIRIDQGRAKAIDLLSRYARFADENPHTAKIPDFELENPMEYLKASCKSVDDYEDLIEDIKTYREVDGWAKNETWWMDVTRIAEDEIQKKAAQNRGD-----VHASVQTEVQNMFKNKSIDELLKLEDQMDAKIRGNSGNK-----GYWQDLDDQLKVFIARKRLREHHGRVLRLQLAIIKEEQKKEIQQQESEELLPVAEVPPQVKIQKEEEEEEEEDEDDEKISKKVRRKIDVQTLDDPELDEPERERKWRALTGDQLDDVTRELYRIGCYSPTYISADDTMPGIEILDEQA-DVDNLTERRNRNRGTLPSSSAASSGAPQGASSKMMAIAREGMEADESIFGAEEQLAAQRHLWSDKYRPRKPTYLNRVQTGFDWNKYNQTHYDQDNPPPKIVQGYKFNIFYPDLLDMTVAPRFGLTSCEDPD-FAIIRFKAGPPYEDIAFKVVNREWETLHKNGYKCQFQNGVFQLWFMFKKYRYRR 657          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Celegans
Match: cacn-1 (Cactin [Source:UniProtKB/Swiss-Prot;Acc:G5EG14])

HSP 1 Score: 275.789 bits (704), Expect = 5.158e-83
Identity = 204/580 (35.17%), Postives = 286/580 (49.31%), Query Frame = 3
Query:  219 YTDDNNPFMDPNLTKEFVWKKKN--------NPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRGRKSDSN---FDIEQAKNRSKIRIAEGRAKPIDLLIQYVN--EEENTINDNADAIIHEPTQFLVGLSKXXX--XXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDEL-KRVIKTEDDGRTEGVTKECVDDMKQMILQGTIDESTELLN--DAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPI-----EPLFPSA-IKPEAQVDTKPTS-----------SKKPEQKLE------------------------------REEYDHSRYSPVLLS------GEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            YT+ NNPF D  LT+ FVW KK            ++  Q  Q   +N+    +           ++++    ++A    G+ SD+    F ++Q K R++IRI +GRAK IDLL +Y    +E        D  +  P ++L    K     +DL+ DI  Y       KN  +W D+  I EDE+ K+  +   D     V      +++ M    +IDE  +L +  DAK    +G++      Y++      +V IA+KRL+E H   LR++L  +K EQ   I     E L P A + P+ ++  +              SKK  +K++                              RE Y    YSP  +S      G E+ DE   +V  L +   +    +                +++ + +EG E  +  F  +  +  Q  LWSDKYRPRKP +LNRV TGFDWNKYNQTHYD DNPPPKIVQGYKFNI YPDL+D T  P F LT C D D +A+I FKAGPPYEDIAFK+VNREWET  ++GYKCQF   + QL+F FK+YRYR+
Sbjct:   90 YTNLNNPFNDTKLTQTFVWGKKLEREGKSGLTQDEITKQTSQRIRKNLHEAAEFKRIRDSRAAAKEDMEMMKRDADLRAGQISDTKEREFQMDQIKERTRIRIDQGRAKAIDLLSRYARFADENPHTAKIPDFELENPMEYLKASCKSVDDYEDLIEDIKTYREVDGWAKNETWWMDVTRIAEDEIQKKAAQNRGD-----VHASVQTEVQNMFKNKSIDELLKLEDQMDAKIRGNSGNK-----GYWQDLDDQLKVFIARKRLREHHGRVLRLQLAIIKEEQKKEIQQQESEELLPVAEVPPQVKIQKEEEEEEEEDEDDEKISKKVRRKIDVQTLDDPELDEPERERKWRALTGDQLDDVTRELYRIGCYSPTYISADDTMPGIEILDEQA-DVDNLTERRNRNRGTLPSSSAASSGAPQGASSKMMAIAREGMEADESIFGAEEQLAAQRHLWSDKYRPRKPTYLNRVQTGFDWNKYNQTHYDQDNPPPKIVQGYKFNIFYPDLLDMTVAPRFGLTSCEDPD-FAIIRFKAGPPYEDIAFKVVNREWETLHKNGYKCQFQNGVFQLWFMFKKYRYRR 657          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Celegans
Match: cacn-1 (Cactin [Source:UniProtKB/Swiss-Prot;Acc:G5EG14])

HSP 1 Score: 227.254 bits (578), Expect = 3.154e-68
Identity = 141/351 (40.17%), Postives = 185/351 (52.71%), Query Frame = 3
Query:  852 DAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPI-----EPLFPSA-IKPEAQVDTKPTS-----------SKKPEQKLE------------------------------REEYDHSRYSPVLLS------GEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            DAK    +G++      Y++      +V IA+KRL+E H   LR++L  +K EQ   I     E L P A + P+ ++  +              SKK  +K++                              RE Y    YSP  +S      G E+ DE   +V  L +   +    +                +++ + +EG E  +  F  +  +  Q  LWSDKYRPRKP +LNRV TGFDWNKYNQTHYD DNPPPKIVQGYKFNI YPDL+D T  P F LT C D D +A+I FKAGPPYEDIAFK+VNREWET  ++GYKCQF   + QL+F FK+YRYR+
Sbjct:    2 DAKIRGNSGNK-----GYWQDLDDQLKVFIARKRLREHHGRVLRLQLAIIKEEQKKEIQQQESEELLPVAEVPPQVKIQKEEEEEEEEDEDDEKISKKVRRKIDVQTLDDPELDEPERERKWRALTGDQLDDVTRELYRIGCYSPTYISADDTMPGIEILDEQA-DVDNLTERRNRNRGTLPSSSAASSGAPQGASSKMMAIAREGMEADESIFGAEEQLAAQRHLWSDKYRPRKPTYLNRVQTGFDWNKYNQTHYDQDNPPPKIVQGYKFNIFYPDLLDMTVAPRFGLTSCEDPD-FAIIRFKAGPPYEDIAFKVVNREWETLHKNGYKCQFQNGVFQLWFMFKKYRYRR 345          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Celegans
Match: cacn-1 (Cactin [Source:UniProtKB/Swiss-Prot;Acc:G5EG14])

HSP 1 Score: 216.468 bits (550), Expect = 3.662e-66
Identity = 99/154 (64.29%), Postives = 118/154 (76.62%), Query Frame = 3
Query: 1284 ELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            +++ + +EG E  +  F  +  +  Q  LWSDKYRPRKP +LNRV TGFDWNKYNQTHYD DNPPPKIVQGYKFNI YPDL+D T  P F LT C D D +A+I FKAGPPYEDIAFK+VNREWET  ++GYKCQF   + QL+F FK+YRYR+
Sbjct:   44 KMMAIAREGMEADESIFGAEEQLAAQRHLWSDKYRPRKPTYLNRVQTGFDWNKYNQTHYDQDNPPPKIVQGYKFNIFYPDLLDMTVAPRFGLTSCEDPD-FAIIRFKAGPPYEDIAFKVVNREWETLHKNGYKCQFQNGVFQLWFMFKKYRYRR 196          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Fly
Match: cactin (gene:FBgn0031114 transcript:FBtr0340400)

HSP 1 Score: 327.791 bits (839), Expect = 5.839e-102
Identity = 215/558 (38.53%), Postives = 319/558 (57.17%), Query Frame = 3
Query:  219 YTDDNNPFMDPNLTKEFVWKKK----------NNPVQLNCQEKQAE----LENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFR-GRKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPI--EPLFPSAIKPEAQV---------DTKPTSSKKPEQKLER--EEYDHSRYSPVLL----------SGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKIN------QEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            Y++++NPF D NLT  F W KK             V++   +KQ E    LE V++R +E E  R+ R  +  + QRAKEA  FR  ++ +  F +EQA+ RS+IRI +GRAKPIDLL QYV      + +  +  +HEP   L GL   +L+DLLVDI  Y   +E GK+  +W D+  I +DEL+R  K E +      R +G+ +  V D+   I +G   +  E +    +   +G    +D++Y+E   S  +  +A+ RL++RH   LR KL+ LK E       E + P   + E +          +  P   + P  +L +    Y    YSP  +            E++ +   E ++Y  +DDE++ +  R++ +     +++      QE  +    ++G +  + +FS +  ++    L +DKYRPRKPR+ NRV+TGF+WNKYNQTHYDMDNPPPKIVQGYKFNI YPDL+DK++TP + LTPC D+  +A++ F  GPPYEDIAFKIVNREWE S + G++CQF+ ++ QL+FHFKRYRYR+
Sbjct:  167 YSNEDNPFGDSNLTSTFHWGKKLEVEGLSNLSTKTVEVLSLQKQLENRRELEKVKKRRQERELERQVREDDLMMQQRAKEAVQFREWQRQEDQFHLEQARLRSEIRIRDGRAKPIDLLAQYVAAGNEPLEECLEMQMHEPYVLLNGLPVEELEDLLVDIKVYE-ELEQGKHIDFWNDMITIVQDELQRQQKLEAENSSLNQRRDGIHQAVVKDVAD-IFRGKNAQQLEEMRHRIEAKISGRADGVDISYWESLLSQLKAHMARARLRDRHQALLREKLSLLKRENDNETLQEKVAPQVKEEEMETQDAEDPEVEEGSPEDEEDPLNELRKTVRLYQAGNYSPRYIREEDFTGRRAQNEDVDEPEAEGLLYEEEDDERRTQ--RQRLLILHPERVDNNQLTPQELRMRNEAKQGMQGDEAEFSVETTLDAVPQLATDKYRPRKPRYFNRVHTGFEWNKYNQTHYDMDNPPPKIVQGYKFNIFYPDLMDKSQTPQYFLTPCADNGDFAVLRFHTGPPYEDIAFKIVNREWEFSYKRGFRCQFHNNIFQLWFHFKRYRYRR 720          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Zebrafish
Match: cactin (cactin [Source:NCBI gene;Acc:100126813])

HSP 1 Score: 351.288 bits (900), Expect = 1.551e-109
Identity = 231/597 (38.69%), Postives = 323/597 (54.10%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVWKK-----------------KNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFP---------SAIKPEAQVDTKPTSSKKPEQKLEREEYDHSRYSPVLLSGEEL-----------------------GDEAI---ENVIYLA----DDDEKKLEFMRKKFIKFGSHKINQEDELIKLV------------------------QEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+ +NPF D NL   F+W+K                 +N  +Q   +E + EL+ V++   E ER +  R  E E++QR KEA++F+   + + NF + QAK RSKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  D++DLL DI  Y   +E GKN  +W D+  ITEDE+ ++ K E  G     R EG+      D++ +    T  +   L  + +  ++ G   ++D+ Y+E      RV +A+ RL+ERH + LR KL +LK EQG+  EPLFP           I  EA    +   S   +   E +E   SR +     GEE                          EA+   E++I  +    D        ++   +   +H I +E++L +L+                        +EG    +  FS ++ +  + +LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDK  TP + L PC D+  + ++ F AGPPYEDIAFKIVNREWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:  252 MGYTNADNPFGDNNLLGTFIWQKALEKKGIGHLSEKNLKDRNKHIQ---EENRRELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTWAEQEDNFHLHQAKLRSKIRIRDGRAKPIDLLAKYISAE----DDDLSVEMHEPYTFLNGLTVTDMEDLLEDIKVYM-ELECGKNVDFWRDMTTITEDEISKLRKLEASGKGPGDRREGINTSVSTDVQSVFKGKTYSQLQALYMNIESKIQAGGS-NLDIGYWESLLQQVRVYMARARLRERHQDVLRQKLYKLKQEQGVESEPLFPIIKEEPEKEQPISREAGSGEEEAGSSSQQADREEDEDRRSRRT----GGEEAERSGRSSPEEEKKGEEEEGEKDEAPEAVLTEEDLIQQSQAEYDSGRYSPTLLQNSELPLDTHIIAEEEDLQRLLLARRQMQVTGDASESAEDLFVRRAKEGMGGDEAQFSVEMPLTGKMYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPQYFLEPCPDNKDFGILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR 835          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Zebrafish
Match: cactin (cactin [Source:NCBI gene;Acc:100126813])

HSP 1 Score: 83.5741 bits (205), Expect = 4.438e-18
Identity = 46/129 (35.66%), Postives = 71/129 (55.04%), Query Frame = 3
Query:  669 MEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFP 1040
            +E GKN  +W D+  ITEDE+ ++ K E  G     R EG+      D++ +    T  +   L  + +  ++ G   ++D+ Y+E      RV +A+ RL+ERH + LR KL +LK EQG+  EPLFP
Sbjct:   14 LECGKNVDFWRDMTTITEDEISKLRKLEASGKGPGDRREGINTSVSTDVQSVFKGKTYSQLQALYMNIESKIQAGGS-NLDIGYWESLLQQVRVYMARARLRERHQDVLRQKLYKLKQEQGVESEPLFP 141          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Xenopus
Match: CACTIN (cactin, spliceosome C complex subunit [Source:NCBI gene;Acc:100487223])

HSP 1 Score: 382.874 bits (982), Expect = 7.592e-122
Identity = 240/572 (41.96%), Postives = 335/572 (58.57%), Query Frame = 3
Query:  216 GYTDDNNPFMDPNLTKEFVW-----------------KKKNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFPSAIKPEAQV------DTKPTSSKKP----------EQKLEREE-----------------------YDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            GYT+ +NPF D NL   F+W                 K++N  +Q   ++ + EL+ V++   E ER +  R  E E++QR KEA++F+   + + NF ++QAK RSKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  DL+DLL DI  Y   +E GKN  +W D+ +ITEDE+ ++ K E  G     R EGV      D++ +    T ++   +    +  + TG   ++D+ Y+E      R  +A+ RL+ERH + LR KL +LK EQG+  EPLFP  IKPE +       + +P S + P          E  +E EE                       YD  RYSP LL+ +EL  +A  +V+   +D ++ +   R++    G    + ED  I+  +EG +  +  FS +I +  +++LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDK  TP + L  C D+  +A++ F AGPPYEDIAFKIVNREWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:  239 GYTNTDNPFGDNNLLGTFIWNKALEKKGIGHLTEKDLKERNKHIQ---EDNRLELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTWEEQEDNFHLQQAKLRSKIRIRDGRAKPIDLLAKYISAE----DDDLAVEMHEPYTFLNGLTVSDLEDLLEDIQIYM-ELEQGKNVDFWRDMTVITEDEISKLRKLEFSGKGPGERREGVNASVSTDVQTVFKGKTYNQLQAISQGIESRIRTGGP-NLDIGYWESLLQQLRAYMARARLRERHQDVLRQKLFKLKQEQGVESEPLFP-IIKPEPESPSNRESEVEPLSGQPPSSTSAAPEESESAIEGEEKNEAEGGESVLMEEDLIQQSLNDYDAGRYSPKLLTVQELPFDA--HVVDFEEDQQRTV-LCRQQLQVTGDASESPEDIFIRKAKEGMDGDEAQFSVEIPVTSKAYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACHDNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFSNGIFQLWFHFKRYRYRR 797          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Mouse
Match: Cactin (cactin, spliceosome C complex subunit [Source:MGI Symbol;Acc:MGI:1917562])

HSP 1 Score: 365.54 bits (937), Expect = 1.403e-115
Identity = 229/572 (40.03%), Postives = 324/572 (56.64%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVW-----------------KKKNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFPSAIKPEAQV---------DTKPTSSKKPEQKLEREE-----------------------------YDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+ +NPF D NL   F+W                 K++N  +Q   ++ + EL+ V++   E ER +  R  E E++QR KEA++F+   + + +F + QAK RSKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  D++DLL DI  Y   +E GKN  +W D+  ITEDE+ ++ K E  G     R EGV      D++ +    T ++   +    +  +  G   ++D+ Y+E      R  +A+ RL+ERH + LR KL +LK EQG+  EPLFP  +K E               P +S  P + +E EE                             YD  RYSP LL+  EL    ++  +    +D ++L+  R++    G    + ED   +  +EG  + +  FS ++ +  +++LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLI K  TP + L  C D+  +A++ F AGPPYEDIAFKIV+REWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:  214 MGYTNTDNPFGDNNLLGTFIWNKALEKKGISHLEEKELKERNKRIQ---EDNRLELQKVKQLRLEREREKAMREQELELLQREKEAEHFKTWEEQEDSFHLRQAKLRSKIRIRDGRAKPIDLLAKYISAE----DDDLAVEMHEPYTFLNGLTVADMEDLLEDIQVYM-ELEQGKNVDFWRDMTTITEDEIAKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQGIEGKIRAGGP-NLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLFKLKQEQGVESEPLFP-ILKSEPSAAHSPEPEERPPSPGTSVDPVEPVEPEEATAPGEAEGEAEGEAVLMEEDLIQQSLADYDAGRYSPRLLTAHEL---PLDAHVLEPHEDLQRLQLSRQQLQATGDASESAEDIFFRRAREGMGQDEAQFSVEMPLGGRAYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIRKRATPEYFLEACADNRDFAILRFHAGPPYEDIAFKIVSREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR 772          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Mouse
Match: Cactin (cactin, spliceosome C complex subunit [Source:MGI Symbol;Acc:MGI:1917562])

HSP 1 Score: 114.775 bits (286), Expect = 1.939e-28
Identity = 76/192 (39.58%), Postives = 110/192 (57.29%), Query Frame = 3
Query:  480 SKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFP 1040
            SKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  D++DLL DI  Y   +E GKN  +W D+  ITEDE+ ++ K E  G     R EGV      D++ +    T ++   +    +  +  G   ++D+ Y+E      R  +A+ RL+ERH + LR KL +LK EQG+  EPLFP
Sbjct:    4 SKIRIRDGRAKPIDLLAKYISAE----DDDLAVEMHEPYTFLNGLTVADMEDLLEDIQVYM-ELEQGKNVDFWRDMTTITEDEIAKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQGIEGKIRAGGP-NLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLFKLKQEQGVESEPLFP 189          
BLAST of Cactin, spliceosome C complex subunit vs. UniProt/SwissProt
Match: sp|Q8WUQ7|CATIN_HUMAN (Cactin OS=Homo sapiens OX=9606 GN=CACTIN PE=1 SV=3)

HSP 1 Score: 375.941 bits (964), Expect = 6.150e-119
Identity = 232/581 (39.93%), Postives = 329/581 (56.63%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVW-----------------KKKNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFP----------SAIKPEAQVDTKPTSSKKP-------------------------------------EQKLEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+ +NPF D NL   F+W                 K++N  +Q   ++ + EL+ V++   E ER +  R  E E++QR KEA++F+   + + NF ++QAK RSKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  D++DLL DI  Y   +E GKN  +W D+  ITEDE+ ++ K E  G     R EGV      D++ +    T ++   +    +  +  G   ++D+ Y+E      R  +A+ RL+ERH + LR KL +LK EQG+  EPLFP           +++PE    T P  S +                                      +Q L+  +YD  RYSP LL+  EL    ++  +   D+D ++L+  R++    G    + ED   +  +EG  + +  FS ++ +  +++LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDK  TP + L  C D+  +A++ F AGPPYEDIAFKIVNREWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:  192 MGYTNTDNPFGDNNLLGTFIWNKALEKKGISHLEEKELKERNKRIQ---EDNRLELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTWEEQEDNFHLQQAKLRSKIRIRDGRAKPIDLLAKYISAE----DDDLAVEMHEPYTFLNGLTVADMEDLLEDIQVYM-ELEQGKNADFWRDMTTITEDEISKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQGIEGKIRAGGP-NLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLYKLKQEQGVESEPLFPILKQEPQSPSRSLEPEDAAPTPPGPSSEGGPAEAEVDGATPTEGDGDGDGEGEGEGEAVLMEEDLIQQSLD--DYDAGRYSPRLLTAHEL---PLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTGKAYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACADNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR 758          
BLAST of Cactin, spliceosome C complex subunit vs. UniProt/SwissProt
Match: sp|Q9CS00|CATIN_MOUSE (Cactin OS=Mus musculus OX=10090 GN=Cactin PE=1 SV=2)

HSP 1 Score: 365.54 bits (937), Expect = 9.813e-115
Identity = 229/572 (40.03%), Postives = 324/572 (56.64%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVW-----------------KKKNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFPSAIKPEAQV---------DTKPTSSKKPEQKLEREE-----------------------------YDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+ +NPF D NL   F+W                 K++N  +Q   ++ + EL+ V++   E ER +  R  E E++QR KEA++F+   + + +F + QAK RSKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  D++DLL DI  Y   +E GKN  +W D+  ITEDE+ ++ K E  G     R EGV      D++ +    T ++   +    +  +  G   ++D+ Y+E      R  +A+ RL+ERH + LR KL +LK EQG+  EPLFP  +K E               P +S  P + +E EE                             YD  RYSP LL+  EL    ++  +    +D ++L+  R++    G    + ED   +  +EG  + +  FS ++ +  +++LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLI K  TP + L  C D+  +A++ F AGPPYEDIAFKIV+REWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:  214 MGYTNTDNPFGDNNLLGTFIWNKALEKKGISHLEEKELKERNKRIQ---EDNRLELQKVKQLRLEREREKAMREQELELLQREKEAEHFKTWEEQEDSFHLRQAKLRSKIRIRDGRAKPIDLLAKYISAE----DDDLAVEMHEPYTFLNGLTVADMEDLLEDIQVYM-ELEQGKNVDFWRDMTTITEDEIAKLRKLEASGKGPGERREGVNASVSSDVQSVFKGKTYNQLQVIFQGIEGKIRAGGP-NLDMGYWESLLQQLRAHMARARLRERHQDVLRQKLFKLKQEQGVESEPLFP-ILKSEPSAAHSPEPEERPPSPGTSVDPVEPVEPEEATAPGEAEGEAEGEAVLMEEDLIQQSLADYDAGRYSPRLLTAHEL---PLDAHVLEPHEDLQRLQLSRQQLQATGDASESAEDIFFRRAREGMGQDEAQFSVEMPLGGRAYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIRKRATPEYFLEACADNRDFAILRFHAGPPYEDIAFKIVSREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR 772          
BLAST of Cactin, spliceosome C complex subunit vs. UniProt/SwissProt
Match: sp|F1Q8W0|CATIN_DANRE (Cactin OS=Danio rerio OX=7955 GN=cactin PE=2 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 1.170e-108
Identity = 231/597 (38.69%), Postives = 323/597 (54.10%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVWKK-----------------KNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFP---------SAIKPEAQVDTKPTSSKKPEQKLEREEYDHSRYSPVLLSGEEL-----------------------GDEAI---ENVIYLA----DDDEKKLEFMRKKFIKFGSHKINQEDELIKLV------------------------QEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+ +NPF D NL   F+W+K                 +N  +Q   +E + EL+ V++   E ER +  R  E E++QR KEA++F+   + + NF + QAK RSKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  D++DLL DI  Y   +E GKN  +W D+  ITEDE+ ++ K E  G     R EG+      D++ +    T  +   L  + +  ++ G   ++D+ Y+E      RV +A+ RL+ERH + LR KL +LK EQG+  EPLFP           I  EA    +   S   +   E +E   SR +     GEE                          EA+   E++I  +    D        ++   +   +H I +E++L +L+                        +EG    +  FS ++ +  + +LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDK  TP + L PC D+  + ++ F AGPPYEDIAFKIVNREWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:  252 MGYTNADNPFGDNNLLGTFIWQKALEKKGIGHLSEKNLKDRNKHIQ---EENRRELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTWAEQEDNFHLHQAKLRSKIRIRDGRAKPIDLLAKYISAE----DDDLSVEMHEPYTFLNGLTVTDMEDLLEDIKVYM-ELECGKNVDFWRDMTTITEDEISKLRKLEASGKGPGDRREGINTSVSTDVQSVFKGKTYSQLQALYMNIESKIQAGGS-NLDIGYWESLLQQVRVYMARARLRERHQDVLRQKLYKLKQEQGVESEPLFPIIKEEPEKEQPISREAGSGEEEAGSSSQQADREEDEDRRSRRT----GGEEAERSGRSSPEEEKKGEEEEGEKDEAPEAVLTEEDLIQQSQAEYDSGRYSPTLLQNSELPLDTHIIAEEEDLQRLLLARRQMQVTGDASESAEDLFVRRAKEGMGGDEAQFSVEMPLTGKMYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPQYFLEPCPDNKDFGILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR 835          
BLAST of Cactin, spliceosome C complex subunit vs. UniProt/SwissProt
Match: sp|Q9VR99|CATIN_DROME (Cactin OS=Drosophila melanogaster OX=7227 GN=cactin PE=1 SV=3)

HSP 1 Score: 327.791 bits (839), Expect = 5.853e-101
Identity = 215/558 (38.53%), Postives = 319/558 (57.17%), Query Frame = 3
Query:  219 YTDDNNPFMDPNLTKEFVWKKK----------NNPVQLNCQEKQAE----LENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFR-GRKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPI--EPLFPSAIKPEAQV---------DTKPTSSKKPEQKLER--EEYDHSRYSPVLL----------SGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKIN------QEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            Y++++NPF D NLT  F W KK             V++   +KQ E    LE V++R +E E  R+ R  +  + QRAKEA  FR  ++ +  F +EQA+ RS+IRI +GRAKPIDLL QYV      + +  +  +HEP   L GL   +L+DLLVDI  Y   +E GK+  +W D+  I +DEL+R  K E +      R +G+ +  V D+   I +G   +  E +    +   +G    +D++Y+E   S  +  +A+ RL++RH   LR KL+ LK E       E + P   + E +          +  P   + P  +L +    Y    YSP  +            E++ +   E ++Y  +DDE++ +  R++ +     +++      QE  +    ++G +  + +FS +  ++    L +DKYRPRKPR+ NRV+TGF+WNKYNQTHYDMDNPPPKIVQGYKFNI YPDL+DK++TP + LTPC D+  +A++ F  GPPYEDIAFKIVNREWE S + G++CQF+ ++ QL+FHFKRYRYR+
Sbjct:  167 YSNEDNPFGDSNLTSTFHWGKKLEVEGLSNLSTKTVEVLSLQKQLENRRELEKVKKRRQERELERQVREDDLMMQQRAKEAVQFREWQRQEDQFHLEQARLRSEIRIRDGRAKPIDLLAQYVAAGNEPLEECLEMQMHEPYVLLNGLPVEELEDLLVDIKVYE-ELEQGKHIDFWNDMITIVQDELQRQQKLEAENSSLNQRRDGIHQAVVKDVAD-IFRGKNAQQLEEMRHRIEAKISGRADGVDISYWESLLSQLKAHMARARLRDRHQALLREKLSLLKRENDNETLQEKVAPQVKEEEMETQDAEDPEVEEGSPEDEEDPLNELRKTVRLYQAGNYSPRYIREEDFTGRRAQNEDVDEPEAEGLLYEEEDDERRTQ--RQRLLILHPERVDNNQLTPQELRMRNEAKQGMQGDEAEFSVETTLDAVPQLATDKYRPRKPRYFNRVHTGFEWNKYNQTHYDMDNPPPKIVQGYKFNIFYPDLMDKSQTPQYFLTPCADNGDFAVLRFHTGPPYEDIAFKIVNREWEFSYKRGFRCQFHNNIFQLWFHFKRYRYRR 720          
BLAST of Cactin, spliceosome C complex subunit vs. UniProt/SwissProt
Match: sp|G5EG14|CATIN_CAEEL (Cactin OS=Caenorhabditis elegans OX=6239 GN=cacn-1 PE=1 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 6.562e-82
Identity = 204/580 (35.17%), Postives = 286/580 (49.31%), Query Frame = 3
Query:  219 YTDDNNPFMDPNLTKEFVWKKKN--------NPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRGRKSDSN---FDIEQAKNRSKIRIAEGRAKPIDLLIQYVN--EEENTINDNADAIIHEPTQFLVGLSKXXX--XXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDEL-KRVIKTEDDGRTEGVTKECVDDMKQMILQGTIDESTELLN--DAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPI-----EPLFPSA-IKPEAQVDTKPTS-----------SKKPEQKLE------------------------------REEYDHSRYSPVLLS------GEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            YT+ NNPF D  LT+ FVW KK            ++  Q  Q   +N+    +           ++++    ++A    G+ SD+    F ++Q K R++IRI +GRAK IDLL +Y    +E        D  +  P ++L    K     +DL+ DI  Y       KN  +W D+  I EDE+ K+  +   D     V      +++ M    +IDE  +L +  DAK    +G++      Y++      +V IA+KRL+E H   LR++L  +K EQ   I     E L P A + P+ ++  +              SKK  +K++                              RE Y    YSP  +S      G E+ DE   +V  L +   +    +                +++ + +EG E  +  F  +  +  Q  LWSDKYRPRKP +LNRV TGFDWNKYNQTHYD DNPPPKIVQGYKFNI YPDL+D T  P F LT C D D +A+I FKAGPPYEDIAFK+VNREWET  ++GYKCQF   + QL+F FK+YRYR+
Sbjct:   90 YTNLNNPFNDTKLTQTFVWGKKLEREGKSGLTQDEITKQTSQRIRKNLHEAAEFKRIRDSRAAAKEDMEMMKRDADLRAGQISDTKEREFQMDQIKERTRIRIDQGRAKAIDLLSRYARFADENPHTAKIPDFELENPMEYLKASCKSVDDYEDLIEDIKTYREVDGWAKNETWWMDVTRIAEDEIQKKAAQNRGD-----VHASVQTEVQNMFKNKSIDELLKLEDQMDAKIRGNSGNK-----GYWQDLDDQLKVFIARKRLREHHGRVLRLQLAIIKEEQKKEIQQQESEELLPVAEVPPQVKIQKEEEEEEEEDEDDEKISKKVRRKIDVQTLDDPELDEPERERKWRALTGDQLDDVTRELYRIGCYSPTYISADDTMPGIEILDEQA-DVDNLTERRNRNRGTLPSSSAASSGAPQGASSKMMAIAREGMEADESIFGAEEQLAAQRHLWSDKYRPRKPTYLNRVQTGFDWNKYNQTHYDQDNPPPKIVQGYKFNIFYPDLLDMTVAPRFGLTSCEDPD-FAIIRFKAGPPYEDIAFKVVNREWETLHKNGYKCQFQNGVFQLWFMFKKYRYRR 657          
BLAST of Cactin, spliceosome C complex subunit vs. TrEMBL
Match: A0A4S2LMZ6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006385 PE=4 SV=1)

HSP 1 Score: 410.994 bits (1055), Expect = 8.646e-130
Identity = 259/592 (43.75%), Postives = 353/592 (59.63%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVWKKKNNPVQLN--------------CQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFR--GRKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNAD--AIIH--EPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDD-------------GRTEGVTKECVDDMKQMILQG-TIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFPSAI-----------------------------KPEAQVDTKP---------------TSSKKPEQKLEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKG-DLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQ--YAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+++NPF D  L++ FVWK+K     L                +E + ELE+V+RR  E ER REER  E E+MQR KEA+ +R  G++ D+ F +EQAK RS+IRIA+GRAKPIDLL +Y+ ++E     +A+   +I   EPTQFLVGLS  DL+DLL DI      +E G+N +YW DI  + EDEL ++ + E+D             GR+     + V       L+G T ++   L    +  L+ G+   +DV Y+E      R  +A+ RL++ H  NLR KL  L+  QG+  EPLFPS                               +PE   DT+P                +  +    +E E YD + YSP  +   E+   A++ VIY  +DD  K+++ RK  ++ G+ + ++E+EL++  +EG E G D  FS QI +E+QSFLWSDKYRPRKPRF NRV+TGF WNKYNQTHYD+DNPPPK+VQGYKFN+ YPDLIDK+KTPT+ LTPC D  Q  +A++ F AGPPYEDIAFKIVNREWE S +HG++CQF  ++ QL+FHFKR+RYR+
Sbjct:  181 LGYTNEDNPFGDHRLSESFVWKQKLEAEGLTHLSKEEIQELQKKKMEENKLELESVRRRRAEREREREEREKEMEMMQRDKEAEYYRSWGQQEDT-FHLEQAKLRSRIRIADGRAKPIDLLAKYIADQEEDAMASAEFTGVIELLEPTQFLVGLSVEDLEDLLEDIKVVYMQLEKGRNAEYWRDITTVAEDELNKLRRAENDSAGLAAAYGADSRGRSSASISQSVMQSVAETLKGKTYNQLAALERQIEPKLKGGE--GVDVTYWETLAQFVRAQMARTRLRDMHQENLRRKLECLRQSQGIVQEPLFPSGTDQPQPSTSQMVRSDTQLMPPPAIDKLRGEEPEEPEDTQPQIEDPHSAEAIRAARQAQLEAAAMVEEEMYDAACYSPPRVDPTEV---ALDAVIYNPEDDRAKIDYQRKDVLRTGAMRASEEEELMRRAREGMEDGEDAQFSVQIPLEDQSFLWSDKYRPRKPRFFNRVHTGFVWNKYNQTHYDLDNPPPKVVQGYKFNVFYPDLIDKSKTPTYTLTPCEDPSQRDFAILRFSAGPPYEDIAFKIVNREWEYSYKHGFRCQFQNNIFQLWFHFKRFRYRR 766          
BLAST of Cactin, spliceosome C complex subunit vs. TrEMBL
Match: A0A3R7ETC6 (Cactin OS=Clonorchis sinensis OX=79923 GN=CACTIN PE=4 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 8.633e-129
Identity = 261/592 (44.09%), Postives = 356/592 (60.14%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVWKKKNNPVQLN--------------CQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFR--GRKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNAD--AIIH--EPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDD-------------GRTEGVTKECVDDMKQMILQG-TIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFPSA-----------IKPEAQVDTKPTSSK-------KPEQK--------------------------LEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKG-DLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQ--YAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+++NPF D  L++ FVWK+K     L                +E + ELE+V+RR  E ER REER  E E+MQR KEA+ +R  G++ D+ F +EQAK RS+IRIA+GRAKPIDLL +Y+ ++E     +A+   +I   EPTQFLVGLS  DL+DLLVDI      +E G+N +YW DI  + EDEL ++ + E+D             GR+     + V       L+G T ++   L    +  L+ G+   +DV Y+E      R  +A+ RL++ H  NLR KL  L+  QG+  EPLFPS            I+ + Q+   P   K       +PE                            +E E YD + YSP  +   E+   A++ VIY  +DD  K+++ RK+ ++ G+ + ++E+EL++  +EG E G D  FS QI +E+QSFLWSDKYRPRKPRF NRV+TGF WNKYNQTHYD+DNPPPK+VQGYKFN+ YPDLIDK+KTPT+ LTPC D  Q  +A++ F AGPPYEDIAFKIVNREWE S +HG++CQF  ++ QL+FHFKR+RYR+
Sbjct:  350 LGYTNEDNPFGDHRLSESFVWKQKLEAEGLTHLSKEEIQELQKKKMEENKLELESVRRRRAEREREREEREKEMEMMQRDKEAEYYRSWGQQEDT-FHLEQAKLRSRIRIADGRAKPIDLLAKYIADQEEDAMASAEFTGVIELLEPTQFLVGLSVEDLEDLLVDIKVVYMQLEKGRNAEYWRDITTVAEDELNKLRRAENDSAGLAAAYGADSRGRSSASISQSVMQSVAETLKGKTYNQLAALERQIEPKLKGGE--GVDVTYWETLAQFVRAQMARTRLRDMHQENLRRKLECLRQSQGIVQEPLFPSGTDQPQPSTSQMIRSDTQLMPPPAVDKLRGEEPDEPEDTQPQIEDPHSAEAIRAARQAQLEAAAMVEEEMYDAACYSPPRVDATEV---ALDAVIYNPEDDRAKIDYQRKEVLRTGAMRASEEEELMRRAREGMEDGEDAQFSVQIPLEDQSFLWSDKYRPRKPRFFNRVHTGFVWNKYNQTHYDLDNPPPKVVQGYKFNVFYPDLIDKSKTPTYTLTPCEDPSQRDFAILRFSAGPPYEDIAFKIVNREWEYSYKHGFRCQFQNNIFQLWFHFKRFRYRR 935          
BLAST of Cactin, spliceosome C complex subunit vs. TrEMBL
Match: A0A1S8WZG4 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_04245 PE=4 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 1.492e-128
Identity = 261/591 (44.16%), Postives = 357/591 (60.41%), Query Frame = 3
Query:  216 GYTDDNNPFMDPNLTKEFVWKKKNNPVQLN--------------CQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFR--GRKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNAD--AIIH--EPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDD-------------GRTEGVTKECVDDMKQMILQG-TIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFPSA-----------IKPEAQVDTKPTSSK-------KPEQK--------------------------LEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKG-DLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQ--YAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            GYT+++NPF D  L++ FVWK+K     L                +E + ELE+V+RR  E ER REER  E E+MQR KEA+ +R  G++ D+ F +EQAK RS+IRIA+GRAKPIDLL +Y+ ++E     +A+   +I   EPTQFLVGLS  DL+DLLVDI      +E G+N +YW DI  + EDEL ++ + E+D             GR+     + V       L+G T ++   L    +  L+ G+   +DV Y+E      R  +A+ RL++ H  NLR KL  L+  QG+  EPLFPS            ++ +AQ+   P   K       +PE                            +E E YD + YSP  +   E+   A++ VIY  +DD  K+++ RK+ ++ G+ + ++E+EL++  +EG E G D  FS QI +E+QSFLWSDKYRPRKPRF NRV+TGF WNKYNQTHYD+DNPPPK+VQGYKFN+ YPDLIDK+KTPT+ LTPC D  Q  +A++ F AGPPYEDIAFKIVNREWE S +HG++CQF  ++ QL+FHFKR+RYR+
Sbjct:  354 GYTNEDNPFGDHRLSESFVWKQKLEAEGLTHLSKEEIQELQKKKMEENKLELESVRRRRAEREREREEREKEMEMMQRDKEAEYYRSWGQQEDT-FHLEQAKLRSRIRIADGRAKPIDLLAKYIADQEEDAMASAEFTGVIELLEPTQFLVGLSVEDLEDLLVDIKVVYMQLEKGRNAEYWRDITTVAEDELNKLRRAENDSAGLSAAYGADSRGRSSASISQSVMQSVAETLKGKTYNQLAALERQIEPKLKGGE--GVDVTYWETLAQFVRAQMARTRLRDMHQENLRRKLECLRQSQGIVQEPLFPSGTDQPKPSTSQVVRSDAQLMPPPAVDKLRGEEPDEPEDTQPQIEDPHSAEAIRAARQAQLEAAAMVEEEMYDAACYSPPRVDPTEV---ALDAVIYNPEDDRAKIDYQRKEVLRTGAMRASEEEELMRRAREGMEDGEDAQFSVQIPLEDQSFLWSDKYRPRKPRFFNRVHTGFVWNKYNQTHYDLDNPPPKVVQGYKFNVFYPDLIDKSKTPTYTLTPCEDPSQRDFAILRFSAGPPYEDIAFKIVNREWEYSYKHGFRCQFQNNIFQLWFHFKRFRYRR 938          
BLAST of Cactin, spliceosome C complex subunit vs. TrEMBL
Match: G7Y8W8 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_103019 PE=4 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 1.683e-128
Identity = 261/592 (44.09%), Postives = 356/592 (60.14%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVWKKKNNPVQLN--------------CQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFR--GRKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNAD--AIIH--EPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDD-------------GRTEGVTKECVDDMKQMILQG-TIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFPSA-----------IKPEAQVDTKPTSSK-------KPEQK--------------------------LEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKG-DLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQ--YAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+++NPF D  L++ FVWK+K     L                +E + ELE+V+RR  E ER REER  E E+MQR KEA+ +R  G++ D+ F +EQAK RS+IRIA+GRAKPIDLL +Y+ ++E     +A+   +I   EPTQFLVGLS  DL+DLLVDI      +E G+N +YW DI  + EDEL ++ + E+D             GR+     + V       L+G T ++   L    +  L+ G+   +DV Y+E      R  +A+ RL++ H  NLR KL  L+  QG+  EPLFPS            I+ + Q+   P   K       +PE                            +E E YD + YSP  +   E+   A++ VIY  +DD  K+++ RK+ ++ G+ + ++E+EL++  +EG E G D  FS QI +E+QSFLWSDKYRPRKPRF NRV+TGF WNKYNQTHYD+DNPPPK+VQGYKFN+ YPDLIDK+KTPT+ LTPC D  Q  +A++ F AGPPYEDIAFKIVNREWE S +HG++CQF  ++ QL+FHFKR+RYR+
Sbjct:  272 LGYTNEDNPFGDHRLSESFVWKQKLEAEGLTHLSKEEIQELQKKKMEENKLELESVRRRRAEREREREEREKEMEMMQRDKEAEYYRSWGQQEDT-FHLEQAKLRSRIRIADGRAKPIDLLAKYIADQEEDAMASAEFTGVIELLEPTQFLVGLSVEDLEDLLVDIKVVYMQLEKGRNAEYWRDITTVAEDELNKLRRAENDSAGLAAAYGADSRGRSSASISQSVMQSVAETLKGKTYNQLAALERQIEPKLKGGE--GVDVTYWETLAQFVRAQMARTRLRDMHQENLRRKLECLRQSQGIVQEPLFPSGTDQPQPSTSQMIRSDTQLMPPPAVDKLRGEEPDEPEDTQPQIEDPHSAEAIRAARQAQLEAAAMVEEEMYDAACYSPPRVDPTEV---ALDAVIYNPEDDRAKIDYQRKEVLRTGAMRASEEEELMRRAREGMEDGEDAQFSVQIPLEDQSFLWSDKYRPRKPRFFNRVHTGFVWNKYNQTHYDLDNPPPKVVQGYKFNVFYPDLIDKSKTPTYTLTPCEDPSQRDFAILRFSAGPPYEDIAFKIVNREWEYSYKHGFRCQFQNNIFQLWFHFKRFRYRR 857          
BLAST of Cactin, spliceosome C complex subunit vs. TrEMBL
Match: A0A0R3VYN0 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS2525 PE=4 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 1.515e-126
Identity = 257/591 (43.49%), Postives = 353/591 (59.73%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVWKKKNNPVQLN--------------CQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFR--GRKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYV-NEEENTIN-----DNADAI-IHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTED----DGRTEGV--TKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPI-----EPLFPSAI----------------------------------------KPEAQVDTKPT---SSKKPEQKL---EREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+++NPF D +L++ FVW+KK +   L+               +E + ELENV+RR  E ER +EE+  E E++QR +EA+ ++  G++ D+ F +EQAK RS+IRIA+GRAKPIDLL +Y+ +++E + N     D + AI + EPTQFLVGLS  DL+DLLVDI      +E G+N +YW D+ +I EDEL+R+ + ED     GR   V  +   +  +   +   T  +   L    +  L  G+   +DV Y+E         +A+ RL+ERH  +LR KL  L+  QG+        P+FPS                                           P +Q + +PT   SS +PE      + + YD S YSPVLL   +  D  I+ V+Y A DD  KLE+ RK  +  G+ +   E+EL+K  +EG E+GD +FS    +E+QSFLWSDKYRPRKPRF NRV+TGF WNKYNQTHYD+DNPPPK+VQGYKFNI YPDLID TKTPT+  TPC  +  + ++ F AGPPYEDIAFKIV+REWE S +HG++CQF+  + QL+FHFKR+RYR+
Sbjct:   43 LGYTNEDNPFGDRHLSETFVWRKKIDDKGLSHLDSARLQTLQAQKMEENRRELENVRRRRLEREREKEEKEKELEMLQREREAEYYKSWGQQEDT-FHLEQAKLRSRIRIADGRAKPIDLLSKYIADQDEGSQNMTSGGDISSAIEVMEPTQFLVGLSIDDLEDLLVDIKIVYMELEKGQNVEYWRDMTVIVEDELRRLKQDEDAEGGGGRHTSVNISNSVLKSVANTLKSKTYAQLAALERQIQPKLHGGE--GVDVGYWETLSQFVAAQMARTRLRERHQEHLRRKLAFLQQNQGISSTSTDSNPIFPSGSGSTCNMVERIRELQQQVAFKMQRDEVQQSEETRKVSEESPAPASQEEVEPTPGPSSAQPEVPTVLNQPDPYDSSLYSPVLL---DQSDVEIDAVLYDAQDDRAKLEYQRKDVMHTGALRKTAEEELMKRAREGVEEGDAEFSVLAPLEDQSFLWSDKYRPRKPRFFNRVHTGFVWNKYNQTHYDLDNPPPKVVQGYKFNIFYPDLIDMTKTPTYTRTPCDGEPDFEILRFIAGPPYEDIAFKIVSREWEYSYKHGFRCQFHNTIFQLWFHFKRFRYRR 627          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Cavefish
Match: cactin (cactin [Source:NCBI gene;Acc:100126813])

HSP 1 Score: 374.4 bits (960), Expect = 7.664e-120
Identity = 235/563 (41.74%), Postives = 324/563 (57.55%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVWKK-----------------KNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFPSAIKPEAQVDTKPTSSKK--------------------------PEQKL---EREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+ +NPF D NL   F W+K                 +N  +Q   +E + EL+ V++   E ER +  R  E E++QR KEA++F+   + + NF + QAK RSKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  D+DDLLVDI  Y + +E GKN  +W D+  ITEDE+ ++ K E  G     R EG+      D++ +    T  +   L  + +  ++ G   ++D+ Y+E      RV +A+ RL+ERH + LR KL +LK EQG+  EPLFP  IK E   +  P S +                            E+ L    + EYD  RYSP LL   EL    ++      ++D ++L   R++    G    + ED  ++  +EG    +  FS ++ +  + +LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDK  TP + L P  D+  + ++ F AGPPYEDIAFKIVNREWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:  159 MGYTNADNPFGDNNLLGTFKWQKALEKKGIGHLGEKELKERNKRIQ---EENRRELQKVKQLRLEREREKAMREQELEMLQREKEAEHFKTWAEQEDNFHLHQAKLRSKIRIRDGRAKPIDLLAKYISAE----DDDLAVEMHEPYTFLNGLTVTDMDDLLVDIKVYMQ-LEQGKNVDFWRDMTTITEDEISKLRKLEASGKGPGDRREGINTSVSTDVQSVFKGKTYSQLQALHMNIESKIQAGGS-NLDIGYWESLLQQVRVYMARARLRERHQDVLRQKLYKLKQEQGVESEPLFP-IIKEEP--EEHPASCRDGEEREENKEEEGEEDGEKSGGVEVVLTEEDLIQQSQAEYDSGRYSPTLLQSSEL---PLDTHTIDVEEDLQRLHLARRQLQVTGDASESAEDAFVRRAKEGMGGDEAQFSVELPLTGKMYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPQYFLEPSPDNKDFGILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR 706          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010480.1 (pep scaffold:Pmarinus_7.0:GL484446:794:2147:1 gene:ENSPMAG00000009491.1 transcript:ENSPMAT00000010480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 249.21 bits (635), Expect = 4.448e-78
Identity = 117/210 (55.71%), Postives = 149/210 (70.95%), Query Frame = 3
Query: 1116 EEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            EEY+  RYSP LL  +EL    +E  +  A++D ++L   RK+  + GS +   ED   +  +EG    +  FS ++ + ++ +LWSDKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDK  TP + L     D ++A + F AGPPYEDIAFKIV+REWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:   63 EEYEAGRYSPTLLPPDEL---PVEAHVMEAEEDNQRLYLARKQLQETGSAEDTAEDAFERRAREGMGTDEARFSVEVPLTDKLYLWSDKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKKSTPQYFLESSDGDREFATLRFHAGPPYEDIAFKIVSREWEYSHRHGFRCQFANSIFQLWFHFKRYRYRR 269          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Sea Lamprey
Match: CACTIN (cactin, spliceosome C complex subunit [Source:HGNC Symbol;Acc:HGNC:29938])

HSP 1 Score: 70.0922 bits (170), Expect = 4.312e-13
Identity = 66/180 (36.67%), Postives = 98/180 (54.44%), Query Frame = 3
Query:  129 ISKKEEIKNENYDATGFKRSSKVPKQAICGYTDDNNPFMDPNLTKEFVW---------------KKKNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAI-IHEPTQFLVGLS 617
            +SKKE  + +  +  G+        +   GYT+ +NPF D NL    +                K++N  +Q   +E + EL+ V++   E ER +  R  E E+MQR KEA++F+   + + NF ++QAK RSKIRI +GRAKPIDLL +YV  EE  +     A+ +HEP  FL GL+
Sbjct:  194 LSKKEAKERKRREKMGWG-------EEYMGYTNADNPFGDNNLLGTLIQALETKGISHLSDKDKKERNKGIQ---KENRIELQKVKQLRLEREREQALRDQELEMMQRDKEAEHFKQWEQQEDNFHLQQAKLRSKIRIKDGRAKPIDLLAKYVGMEEEDL-----AVEMHEPYTFLNGLT 358          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Nematostella
Match: EDO39568 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9T3])

HSP 1 Score: 172.94 bits (437), Expect = 1.932e-51
Identity = 75/106 (70.75%), Postives = 88/106 (83.02%), Query Frame = 3
Query: 1428 FDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            ++WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDKT  P + L PC D   +A++ F AGPPYEDIAFK+VNREWE S RHG++CQF  ++ QL+FHFKRYRYR+
Sbjct:    2 YEWNKYNQTHYDSDNPPPKIVQGYKFNIFYPDLIDKTVAPEYYLEPCSDTKDFAILRFHAGPPYEDIAFKVVNREWEYSHRHGFRCQFQNNIFQLWFHFKRYRYRR 107          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Nematostella
Match: EDO39569 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9T4])

HSP 1 Score: 101.293 bits (251), Expect = 3.309e-24
Identity = 82/194 (42.27%), Postives = 116/194 (59.79%), Query Frame = 3
Query:  210 ICGYTDDNNPFMDPNLTKEFVW---KKKNNPVQLNCQEKQA-----------ELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNF-RGRKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIK 746
            + GYT+ +NPF D +L   FVW   K+K+    L+  EK+            +LE V++R  E E     R  E+E +QR KEA+ F    K + NF + QA  RS+IRI +GRAK IDLL QY++ +    +DN D  +HEP   LVGL++ DL+DLL DI  Y   M+ GKN +YW+DI +I +DE+K++ K
Sbjct:   45 LLGYTNTDNPFGDAHLLDSFVWHKVKEKHGENHLSEAEKRLRDKTRQEETRRQLEQVRQRRTEREHEMLLREEEKERLQREKEAEYFSEWEKQEDNFHLNQAMLRSQIRIKDGRAKAIDLLAQYISPD----DDNLDIKMHEPYTMLVGLTQSDLEDLLEDIKVYL-EMDQGKNAEYWQDITIICKDEIKKLRK 233          
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Medaka
Match: cactin (cactin, spliceosome C complex subunit [Source:NCBI gene;Acc:101170546])

HSP 1 Score: 363.999 bits (933), Expect = 2.064e-114
Identity = 236/599 (39.40%), Postives = 329/599 (54.92%), Query Frame = 3
Query:  213 CGYTDDNNPFMDPNLTKEFVWKK-----------------KNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRG-RKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDG-----RTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGL---PIEPLF-------------------------PSA------IKPEAQVDTKPTSSK----------------KPEQKLE---------------REEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
             GYT+ +NPF D NL   F W+K                 +N  +Q   +E + EL+ V++   E ER +  R +E E++QR KEA++F+   + + NF ++QAK RSKIRI +GRAKPIDLL +Y++ E    +D+    +HEP  FL GL+  D+DDLL DI  Y   +E GKN  +W D+  ITEDE+ ++ K E  G     R EG+      D++ +    T  +   L  + +  +  G R ++D+ Y+E      +V +A+ RL+ERH + LR KL +LK EQG+   P+ P+                          PSA         EA+ + +P  S                 K E+K E               + EYD  RYSP LL+  EL    ++      ++D  +L+  R+     G    + ED  ++  +EG    +  FS ++ +  + +LW+DKYRPRKPRF NRV+TGF+WNKYNQTHYD DNPPPKIVQGYKFNI YPDLIDK  TP + L PC D+  + ++ F AGPPYEDIAFKIVNREWE S RHG++CQF   + QL+FHFKRYRYR+
Sbjct:  261 MGYTNADNPFGDNNLLGTFKWQKALVKKGIGHLGEKELKERNKLIQ---EENRRELQKVKQLRLEREREKAMREMELEMLQREKEAEHFKTWAEQEDNFHLQQAKLRSKIRIRDGRAKPIDLLAKYISAE----DDDLAVEMHEPYTFLNGLTVTDMDDLLEDIKVYM-ELEQGKNVDFWRDMTTITEDEISKLRKLEASGKGPGDRREGINTAVSTDVQTVFKGKTYSQLQALHLNIESKIRAG-RSNLDIGYWESLLQQVKVYMARARLRERHQDVLRQKLFKLKQEQGVESEPLFPIIKEEPRDERDGDSRGQSRGATTEDSGPSASSFGRVANREAEDEERPGPSTSAAGGQDEDKGEKGEGKDEEKGEAVEAVLTEEDLIQQSQAEYDSGRYSPTLLTQSEL---PLDTHTITPEEDASRLQLARRLLQVTGDANESAEDAFVRRAREGMGTDEAQFSVEVPVTGKMYLWADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPQYFLEPCPDNKDFGILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFHFKRYRYRR 847          
BLAST of Cactin, spliceosome C complex subunit vs. Planmine SMEST
Match: SMESG000061791.1 (SMESG000061791.1)

HSP 1 Score: 1053.89 bits (2724), Expect = 0.000e+0
Identity = 571/572 (99.83%), Postives = 572/572 (100.00%), Query Frame = 3
Query:   30 MNLEKNIXXXXXXXXXXXXXXXXXXXXXXXPEFISKKEEIKNENYDATGFKRSSKVPKQAICGYTDDNNPFMDPNLTKEFVWKKKNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRGRKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDGRTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFPSAIKPEAQVDTKPTSSKKPEQKLEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            MNLEKNISSEGSHKKSKKKHKKHLRRDSSSPEFISKKEEIKNENYDATGFKRSSKVPKQAICGYTDDNNPFMDPNLTKEFVWKKKNNPVQLNCQEKQAELENVQRRMKEHERLREERLLEQEIMQRAKEAQNFRGRKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKLDLDDLLVDIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDGRTEGVTKECVDDMKQMILQGTI+ESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFPSAIKPEAQVDTKPTSSKKPEQKLEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK
Sbjct:    1 MNLEKNISSEGSHKKSKKKHKKHLRRDSSSPEFISKKEEIKNENYDATGFKRSSKVPKQAICGYTDDNNPFMDPNLTKEFVWKKKNNPVQLNCQEKQAELENVQRRMKEHERLREERLLEQEIMQRAKEAQNFRGRKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKLDLDDLLVDIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDGRTEGVTKECVDDMKQMILQGTIEESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFPSAIKPEAQVDTKPTSSKKPEQKLEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 572          
BLAST of Cactin, spliceosome C complex subunit vs. Planmine SMEST
Match: SMESG000026741.1 (SMESG000026741.1)

HSP 1 Score: 642.884 bits (1657), Expect = 0.000e+0
Identity = 343/544 (63.05%), Postives = 428/544 (78.68%), Query Frame = 3
Query:  120 PEFISKKEEIKNENYDATGFKRSSKVPKQAICGYTDDNNPFMDPNLTKEFVWKKKNNPVQLNCQEKQAELENVQXXXXXXXXXXXXXXXXXXXXXXAKEAQNFRGRKSDSNFDIEQAKNRSKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKXXXXXXXXXIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDGRTEGVTKECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLARVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIE--PLFPSAIKPEAQVDTKPTSSKKPEQKLEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLEFMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLIDKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGYKCQFYRDMLQLYFHFKRYRYRK 1745
            PE +   E    E YDATG+KRS+ + K+ ICG+TDD NPFMDPNLT++F+WKK    ++++CQ K+AELE VQ+RM+EHERLREER +EQEI+QRAKE+QN+ GRK+DS FD++QA  RSKIRI   R +PID LIQY+NEE N  + + + I++EPTQ+L+ L K  L +LLVDI  YS NM PGKNTQYW D ++I EDEL ++ +TE+ GR E ++KE ++ MK M+L GTIDE+ EL ND+K+MLETGDRRHID++YYEYFC+ A++LIAK+RLQE H  NL+I+L +LK EQGL     P     IK E    TKP        K EREEY +  Y PVL+S  ELG+E I+ VIY A+DDE+KL  MRK+F+ FG     +ED+L+ L Q+GDEK D++F++Q+ +E+ SFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYD+DNPPPKIVQGYKFNILYPDLIDK+KTPTFEL+ C D+DQ A+I FKAGPPY+DIAFKIVN+EWETSER GYKCQFY +MLQ++FHFKRYRYRK
Sbjct:   41 PELVYHIENEYKEKYDATGYKRSN-IRKKDICGFTDDVNPFMDPNLTEQFIWKKNKRQIKMDCQTKEAELEKVQKRMREHERLREERQIEQEIIQRAKESQNYLGRKNDSTFDLDQAIVRSKIRINSDRGQPIDYLIQYINEE-NECSTDTNVIMNEPTQYLLMLDKQQLGNLLVDIDNYSCNMVPGKNTQYWADFKIIVEDELFKLNRTEN-GRDEALSKESIEAMKDMVLSGTIDEAIELYNDSKQMLETGDRRHIDISYYEYFCNFAKILIAKRRLQENHMRNLQIQLKKLKEEQGLDSSSLPTLKDNIKEEVN-KTKP--------KDEREEYIYKLYEPVLISEHELGEEVIDYVIYRAEDDERKLISMRKQFLTFGHLSSTKEDQLLLLAQKGDEKDDVNFNDQVIVEDNSFLWSDKYRPRKPRFLNRVNTGFDWNKYNQTHYDIDNPPPKIVQGYKFNILYPDLIDKSKTPTFELSVCPDNDQEAIINFKAGPPYQDIAFKIVNKEWETSERFGYKCQFYCNMLQVHFHFKRYRYRK 572          
The following BLAST results are available for this feature:
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACTIN1.281e-11939.93cactin, spliceosome C complex subunit [Source:HGNC... [more]
CACTIN1.281e-11939.93cactin, spliceosome C complex subunit [Source:HGNC... [more]
CACTIN1.281e-11939.93cactin, spliceosome C complex subunit [Source:HGNC... [more]
CACTIN1.281e-11939.93cactin, spliceosome C complex subunit [Source:HGNC... [more]
CACTIN2.766e-7754.29cactin, spliceosome C complex subunit [Source:HGNC... [more]
back to top
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cacn-15.158e-8335.17Cactin [Source:UniProtKB/Swiss-Prot;Acc:G5EG14][more]
cacn-15.158e-8335.17Cactin [Source:UniProtKB/Swiss-Prot;Acc:G5EG14][more]
cacn-13.154e-6840.17Cactin [Source:UniProtKB/Swiss-Prot;Acc:G5EG14][more]
cacn-13.662e-6664.29Cactin [Source:UniProtKB/Swiss-Prot;Acc:G5EG14][more]
back to top
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cactin5.839e-10238.53gene:FBgn0031114 transcript:FBtr0340400[more]
back to top
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cactin1.551e-10938.69cactin [Source:NCBI gene;Acc:100126813][more]
cactin4.438e-1835.66cactin [Source:NCBI gene;Acc:100126813][more]
back to top
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CACTIN7.592e-12241.96cactin, spliceosome C complex subunit [Source:NCBI... [more]
back to top
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cactin1.403e-11540.03cactin, spliceosome C complex subunit [Source:MGI ... [more]
Cactin1.939e-2839.58cactin, spliceosome C complex subunit [Source:MGI ... [more]
back to top
BLAST of Cactin, spliceosome C complex subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WUQ7|CATIN_HUMAN6.150e-11939.93Cactin OS=Homo sapiens OX=9606 GN=CACTIN PE=1 SV=3[more]
sp|Q9CS00|CATIN_MOUSE9.813e-11540.03Cactin OS=Mus musculus OX=10090 GN=Cactin PE=1 SV=... [more]
sp|F1Q8W0|CATIN_DANRE1.170e-10838.69Cactin OS=Danio rerio OX=7955 GN=cactin PE=2 SV=1[more]
sp|Q9VR99|CATIN_DROME5.853e-10138.53Cactin OS=Drosophila melanogaster OX=7227 GN=cacti... [more]
sp|G5EG14|CATIN_CAEEL6.562e-8235.17Cactin OS=Caenorhabditis elegans OX=6239 GN=cacn-1... [more]
back to top
BLAST of Cactin, spliceosome C complex subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LMZ68.646e-13043.75Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3R7ETC68.633e-12944.09Cactin OS=Clonorchis sinensis OX=79923 GN=CACTIN P... [more]
A0A1S8WZG41.492e-12844.16Uncharacterized protein OS=Opisthorchis viverrini ... [more]
G7Y8W81.683e-12844.09Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A0R3VYN01.515e-12643.49Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cactin7.664e-12041.74cactin [Source:NCBI gene;Acc:100126813][more]
back to top
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000010480.14.448e-7855.71pep scaffold:Pmarinus_7.0:GL484446:794:2147:1 gene... [more]
CACTIN4.312e-1336.67cactin, spliceosome C complex subunit [Source:HGNC... [more]
back to top
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO395681.932e-5170.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395693.309e-2442.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cactin, spliceosome C complex subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cactin2.064e-11439.40cactin, spliceosome C complex subunit [Source:NCBI... [more]
back to top
BLAST of Cactin, spliceosome C complex subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000061791.10.000e+099.83SMESG000061791.1[more]
SMESG000026741.10.000e+063.05SMESG000026741.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013169 ID=SMED30013169|Name=Cactin, spliceosome C complex subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=2034bp
AATCTATATAAATCTTATATGCACTAATTATGAATTTAGAGAAAAACATA
AGTTCAGAAGGTAGTCATAAAAAATCTAAAAAAAAACACAAAAAACACCT
TCGAAGAGATTCGTCTTCTCCAGAATTCATAAGTAAAAAGGAAGAAATTA
AAAATGAAAATTACGACGCGACTGGATTTAAACGAAGTTCAAAAGTTCCA
AAACAGGCTATTTGTGGATATACTGATGATAACAATCCATTTATGGATCC
TAATTTAACGAAGGAATTTGTTTGGAAAAAGAAAAATAATCCTGTTCAAT
TAAATTGCCAAGAAAAGCAAGCAGAATTGGAAAATGTTCAACGAAGAATG
AAAGAACATGAAAGGCTGCGCGAGGAACGATTACTCGAACAGGAAATAAT
GCAACGAGCAAAAGAAGCACAGAATTTCCGTGGCCGAAAATCTGATTCCA
ATTTTGATATAGAGCAAGCTAAAAATCGATCTAAAATTAGAATAGCTGAA
GGTCGAGCAAAACCGATAGATTTACTAATTCAATACGTAAATGAAGAAGA
AAATACGATTAATGATAATGCTGATGCGATTATCCACGAACCGACACAAT
TTTTGGTTGGATTATCAAAATTAGATTTGGATGATTTGTTAGTGGATATC
CACGAATACTCACGAAACATGGAACCGGGCAAAAACACCCAATATTGGGA
AGATATCCGTTTAATAACCGAAGATGAGTTGAAAAGAGTCATCAAAACGG
AAGACGATGGTCGAACTGAAGGAGTAACAAAGGAATGCGTTGACGACATG
AAACAAATGATTCTTCAAGGAACTATCGACGAGTCAACGGAATTATTAAA
TGACGCTAAAAAGATGCTGGAAACAGGCGATCGCCGACATATCGATGTTG
CTTATTACGAATATTTTTGCAGTCTCGCCCGAGTTTTAATTGCTAAAAAA
CGGTTACAAGAGCGCCATTCCAACAATTTACGAATAAAATTGAACCGATT
AAAACACGAGCAAGGATTACCGATTGAGCCGCTTTTCCCCAGTGCGATAA
AACCGGAAGCACAAGTTGACACGAAACCGACAAGTTCCAAGAAACCCGAA
CAGAAGTTGGAACGAGAAGAATATGATCATAGTCGATACAGTCCGGTGTT
GTTGTCAGGTGAAGAGTTGGGCGACGAGGCAATTGAAAATGTAATTTATC
TCGCCGACGACGACGAGAAAAAACTAGAATTCATGAGAAAAAAATTCATC
AAGTTCGGCAGTCATAAAATCAATCAGGAAGACGAATTGATAAAATTGGT
GCAGGAAGGTGACGAGAAAGGTGATTTGGATTTCAGTGAGCAGATCGCAA
TTGAGGAGCAATCGTTTCTCTGGTCGGACAAATATCGACCGAGGAAGCCT
CGATTTCTCAACCGGGTCAATACGGGATTCGACTGGAACAAATACAATCA
AACCCATTATGACATGGACAACCCACCACCGAAAATCGTCCAGGGATACA
AATTCAATATTCTCTATCCGGATTTGATCGATAAAACAAAAACTCCCACA
TTCGAGTTGACTCCGTGCATCGATGACGATCAATACGCGATGATCACGTT
CAAGGCCGGGCCGCCATATGAGGACATCGCTTTCAAAATTGTGAACCGTG
AATGGGAGACCAGTGAAAGGCATGGTTACAAGTGCCAGTTCTATCGTGAT
ATGCTGCAGTTATATTTTCACTTCAAGCGATATCGATATAGAAAATAAAT
TTGTTCTTGTTATTTTAAATTTGATTTTAATCCATTTATTTAGATTGCTG
CCAGATTTTGACCAATGAAGACTGAGGCGGGTTCTGAAATCAGCTGGTAC
TACGTCGGATACATCCTCCAAAGCCTTTTTAACTGATAAAATTGATCTGA
AAGTATCATTAATTTAAAATATTCGGTCTGAGATCCATTATTGTAAAATC
CAAAATAATTTATACTAACACTTTGTTTAAGCCATGACCCCTCTGTTGTG
GTCTCGATTTTGGTGAGTCTCAACTTGCACTGGT
back to top

protein sequence of SMED30013169-orf-1

>SMED30013169-orf-1 ID=SMED30013169-orf-1|Name=SMED30013169-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=573bp
MNLEKNISSEGSHKKSKKKHKKHLRRDSSSPEFISKKEEIKNENYDATGF
KRSSKVPKQAICGYTDDNNPFMDPNLTKEFVWKKKNNPVQLNCQEKQAEL
ENVQRRMKEHERLREERLLEQEIMQRAKEAQNFRGRKSDSNFDIEQAKNR
SKIRIAEGRAKPIDLLIQYVNEEENTINDNADAIIHEPTQFLVGLSKLDL
DDLLVDIHEYSRNMEPGKNTQYWEDIRLITEDELKRVIKTEDDGRTEGVT
KECVDDMKQMILQGTIDESTELLNDAKKMLETGDRRHIDVAYYEYFCSLA
RVLIAKKRLQERHSNNLRIKLNRLKHEQGLPIEPLFPSAIKPEAQVDTKP
TSSKKPEQKLEREEYDHSRYSPVLLSGEELGDEAIENVIYLADDDEKKLE
FMRKKFIKFGSHKINQEDELIKLVQEGDEKGDLDFSEQIAIEEQSFLWSD
KYRPRKPRFLNRVNTGFDWNKYNQTHYDMDNPPPKIVQGYKFNILYPDLI
DKTKTPTFELTPCIDDDQYAMITFKAGPPYEDIAFKIVNREWETSERHGY
KCQFYRDMLQLYFHFKRYRYRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0043124negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0000398mRNA splicing, via spliceosome
GO:0001933negative regulation of protein phosphorylation
GO:0002376immune system process
GO:0006397mRNA processing
GO:0007275multicellular organism development
GO:0008380RNA splicing
GO:0031665negative regulation of lipopolysaccharide-mediated signaling pathway
GO:0032088negative regulation of NF-kappaB transcription factor activity
GO:0032688negative regulation of interferon-beta production
GO:0032717negative regulation of interleukin-8 production
GO:0032720negative regulation of tumor necrosis factor production
GO:0034122negative regulation of toll-like receptor signaling pathway
GO:0045087innate immune response
GO:0060339negative regulation of type I interferon-mediated signaling pathway
GO:0071222cellular response to lipopolysaccharide
GO:0071347cellular response to interleukin-1
GO:0071356cellular response to tumor necrosis factor
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR019134Cactin_C
IPR018816Cactin_central
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005681spliceosomal complex
GO:0005829cytosol
GO:0016607nuclear speck
GO:0070062extracellular exosome
GO:0071013catalytic step 2 spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 96..133
NoneNo IPR availableSMARTSM01050CactinC_cactus_3coord: 451..575
e-value: 1.1E-76
score: 270.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 339..369
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 351..369
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..40
NoneNo IPR availablePANTHERPTHR21737POLYGLUTAMINE BINDING PROTEIN 1/MARVEL MEMBRANE-ASSOCIATING DOMAIN CONTAINING 3coord: 38..575
NoneNo IPR availablePANTHERPTHR21737:SF4CACTINcoord: 38..575
IPR018816Cactin, central domainPFAMPF10312Cactin_midcoord: 139..316
e-value: 8.4E-31
score: 107.2
IPR019134Cactin, C-terminalPFAMPF09732CactinC_cactuscoord: 451..575
e-value: 1.3E-55
score: 186.6