Calpain

Overview
NameCalpain
Smed IDSMED30013168
Length (bp)2391
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calpain (SMED30013168) t-SNE clustered cells

Violin plots show distribution of expression levels for Calpain (SMED30013168) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calpain (SMED30013168) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calpain (SMED30013168) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013168

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30013168SMESG000062904.1 SMESG000062902.1 Contig42066uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013168SMESG000062904.1 SMESG000062902.1 Contig42066newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30013168SMESG000062904.1 SMESG000062902.1 dd_Smed_v6_1971_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30013168SMESG000062904.1 SMESG000062902.1 dd_Smed_v6_1971_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013168SMESG000062904.1 SMESG000062902.1 dd_Smed_v6_1971_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30013168SMESG000062904.1 SMESG000062902.1 dd_Smed_v6_1971_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calpain vs. Ensembl Human
Match: CAPN9 (calpain 9 [Source:HGNC Symbol;Acc:HGNC:1486])

HSP 1 Score: 535.798 bits (1379), Expect = 1.045e-180
Identity = 294/679 (43.30%), Postives = 414/679 (60.97%), Query Frame = 2
Query:  206 QLKPTPMKKRDLDKQ-TLYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLK-KDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNA 2218
            Q  P P   R        +  + ++    G L+ED DFPA  SS+F S+  +    FVWKRP +I KNP+    G +R D+ QG LGDCWLLA +ASL+L +     V+P DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD+NEFWSALLEKAYAK+ G YE+L GGS IEAMEDFTGG+ ET +   KE P   Y  + K  K+ +L+GC I++   A+ E     GLI GHAYS+T + +V    G  +EL+R+RNPWG + EW G WSDSSPEW ++  +E++RLC    +DGEFWM F DF  +F K+EIC+L P++L ED     +WE+ +  GSW +   AGGCRNF+D+F TNPQ +  +   + ++ +   + ++ LMQKD R+ +  G   L IGY IY+  D +   LNK FF++  + A+S  FIN REV  R KLP G Y++IPSTF P++EA+F LRIFSEK+  ++++D   G  +I       D+ +  +    + + +       E+    LF+ +AG    + A +L  +LNAVL+ K    FK   L  C+++I+L D    GK+EF EF + W  L+ W   F  FDAD++G    YE R AL   G  +S+ L ++I  RY D E   + F+DF+  ++RL NA
Sbjct:   11 QAHPVPKDARITHSSGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSERPQ--IPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETFQT--KEAPENFYEILEKALKRGSLLGCFIDTRSAAESEARTPFGLIKGHAYSVTGIDQVS-FRGQRIELIRIRNPWG-QVEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDALEED--AIHKWEVTVHQGSWVRGSTAGGCRNFLDTFWTNPQIK--LSLTEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDKD-EHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMD---GNVDI-------DLPEPPKPTPPDQETEE------EQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYAD-EELQLDFDDFLNCLVRLENA 661          
BLAST of Calpain vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 520.776 bits (1340), Expect = 2.558e-174
Identity = 284/676 (42.01%), Postives = 414/676 (61.24%), Query Frame = 2
Query:  245 KQTLYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETME 2233
            K+  +  + K+      L+ DP+FP D +S+F S+  K   +FVWKRP +IC+NP+   DG +R D+ QG LGDCW LA +A L+L + +   V+P DQ F +NY G F F+FWR+G+WV+VV+DD LPTY  +LVF  S   NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  ++ P  +Y  M K  ++ +LMGC+I++    + E  MA GL+ GHAYS+T + +V    G  V+LVR+RNPWG + EW G WSD   +W  + K EK RL      DGEFWM+++DF  +FTK+EIC+L  ++L  D    + W + + +G W +  +AGGCRNF D+F TNPQ+R+++++ DD+  ++    + ++ LMQK+ R+ R LG     IG+ IY++     G    L K FF ++ + A+S  +IN REV  R +LP   YVI+PST+ P++E  F+LR+FSEK+N S+E++             NT  VD      G    ++E+    ++    +FK +AG    I A +L+ +LN V+   KD+K   GF LE CRSMIAL D D +GK+   EF  LW  ++ W+  FK +D D++G  ++YE RNA+N+ G  ++N L+ +I  RY D     I F+ FI   +RL   F    
Sbjct:   57 KEKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYSQ--KFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI--RDAPSDMYKIMKKAIERGSLMGCSIDTIIPVQYETRMACGLVRGHAYSVTGLDEVP-FKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSD--KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVE-------------NTISVDRPVPQPGSSDQESEE----QQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKT-HGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMN-IDFDSFICCFVRLEGMFRAFH 705          
BLAST of Calpain vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 513.842 bits (1322), Expect = 5.228e-171
Identity = 287/703 (40.83%), Postives = 424/703 (60.31%), Query Frame = 2
Query:  245 KQTLYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNT--GTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELD--------VENGKTEIA----------KHLRNTDMVDDGRAVTGEVKVK---------NEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETME 2233
            K+  +  + K+      L+ DP+FP D +S+F S+  K   +FVWKRP +IC+NP+   DG +R D+ QG LGDCW LA +A L+L + +   V+P DQ F +NY G F F+FWR+G+WV+VV+DD LPTY  +LVF  S   NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  ++ P  +Y  M K  ++ +LMGC+I++    + E  MA GL+ GHAYS+T + +V    G  V+LVR+RNPWG + EW G WSD   +W  + K EK RL      DGEFWM+++DF  +FTK+EIC+L  ++L  D    + W + + +G W +  +AGGCRNF D+F TNPQ+R+++++ DD+  ++    + ++ LMQK+ R+ R LG     IG+ IY++     G    L K FF ++ + A+S  +IN REV  R +LP   YVI+PST+ P++E  F+LR+FSEK+N S+E++        V+  KT+            K L      ++G+  T   K K         +++    ++    +FK +AG    I A +L+ +LN V+   KD+K   GF LE CRSMIAL D D +GK+   EF  LW  ++ W+  FK +D D++G  ++YE RNA+N+ G  ++N L+ +I  RY D ++  I F+ FI   +RL   F    
Sbjct:   57 KEKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYSQ--KFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI--RDAPSDMYKIMKKAIERGSLMGCSIDTIIPVQYETRMACGLVRGHAYSVTGLDEVP-FKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSD--KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTKPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKT-HGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYAD-KHMNIDFDSFICCFVRLEGMFRAFH 749          
BLAST of Calpain vs. Ensembl Human
Match: CAPN2 (calpain 2 [Source:HGNC Symbol;Acc:HGNC:1479])

HSP 1 Score: 495.738 bits (1275), Expect = 5.492e-165
Identity = 274/682 (40.18%), Postives = 419/682 (61.44%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQF--RXXXXXXXXXXXXNTGTVIIGLMQKD-MRQRNLG--FLVIGYVIYKLKDPNCGL----LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKK--DMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETM-ELQPQD 2248
            Y  +  +    G L++DP FPA  S++    +   S   R   WKRP +IC +PQ    G +R D+ QGALGDCWLLA +ASL+L E I   VVP +Q F +NY G F F+FW++G+WVEVVVDDRLPT  G+L+F+HSA+ +EFWSALLEKAYAK+ G YE+LSGG+  E  EDFTGG+ E  +L  K+ P  L+  + K  ++ +L+GC+I+   +A  E +    L+ GHAYS+T  ++V +++G++ +L+R+RNPWG E EW G+W+D+ P W TI   E+ERL      DGEFWM+F DF ++++++EIC+L P++L  D    ++W++   DG+W +   AGGCRN+ ++F  NPQ+  ++E  D D+ED E+  T ++GL+QK   RQR +G     IG+ IY++ +   G     L+K+FF  +    +S  FIN REV  R KLP G Y+++PSTF PN++ +F +R+FSEK+   + +D      EI  +L   D+ +D                 ++     LF  +AG    I+A +L+ IL  VL K  D+K+  GF +E C+ M+ + D D +GK+   EF +LWT ++ ++  +++ D D +G  ++YE R AL   G  +   L +VI  R+ D +  +I F++F+  ++RL   F+   +L P++
Sbjct:   32 YEALRNECLEAGTLFQDPSFPAIPSALGFKELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYEL--KKPPPNLFKIIQKALQKGSLLGCSIDITSAADSEAITFQKLVKGHAYSVTGAEEV-ESNGSLQKLIRIRNPWG-EVEWTGRWNDNCPSWNTIDPEERERLTRRH-EDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTY--KKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPGEYILVPSTFEPNKDGDFCIRVFSEKKADYQAVD-----DEIEANLEEFDISEDD----------------IDDGFRRLFAQLAGEDAEISAFELQTILRRVLAKRQDIKS-DGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFAD-DQLIIDFDNFVRCLVRLETLFKIFKQLDPEN 683          
BLAST of Calpain vs. Ensembl Human
Match: CAPN3 (calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480])

HSP 1 Score: 495.352 bits (1274), Expect = 2.398e-163
Identity = 284/745 (38.12%), Postives = 420/745 (56.38%), Query Frame = 2
Query:  245 KQTLYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESA---------------------------------------------------KIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNT--GTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELD------------VENGKTEIAKHLRNTDMVDDGRAVTGEVKVK---------NEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETME 2233
            K+  +  + K+      L+ DP+FP D +S+F S+  K   +FVWKRP +IC+NP+   DG +R D+ QG LGDCW LA +A L+L + +   V+P DQ F +NY G F F+FWR+G+WV+VV+DD LPTY  +LVF  S   NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  ++ P  +Y  M K  ++ +LMGC+I+                                                     + E  MA GL+ GHAYS+T + +V    G  V+LVR+RNPWG + EW G WSD   +W  + K EK RL      DGEFWM+++DF  +FTK+EIC+L  ++L  D    + W + + +G W +  +AGGCRNF D+F TNPQ+R+++++ DD+  ++    + ++ LMQK+ R+ R LG     IG+ IY++     G    L K FF ++ + A+S  +IN REV  R +LP   YVI+PST+ P++E  F+LR+FSEK+N S+E++              + +    K L      ++G+  T   K K         +++    ++    +FK +AG    I A +L+ +LN V+   KD+K   GF LE CRSMIAL D D +GK+   EF  LW  ++ W+  FK +D D++G  ++YE RNA+N+ G  ++N L+ +I  RY D ++  I F+ FI   +RL   F    
Sbjct:   57 KEKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYSQ--KFPIQFVWKRPPEICENPRFIIDGANRTDICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEI--RDAPSDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLQDSDLDPRGSDERPTRTIIPVQYETRMACGLVRGHAYSVTGLDEVP-FKGEKVKLVRLRNPWG-QVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADALQSD--KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSFLVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVPIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQIAGDDMEICADELKKVLNTVVNKHKDLKT-HGFTLESCRSMIALMDTDGSGKLNLQEFHHLWNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYAD-KHMNIDFDSFICCFVRLEGMFRAFH 791          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 438.343 bits (1126), Expect = 9.279e-143
Identity = 233/486 (47.94%), Postives = 325/486 (66.87%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNE--DLSGKRR----WEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQK---DMRQRNLGFLVIGYVIYKLKDP--NCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKEL 1675
            + ++  Q   + +L+EDP F A+ SS+F SK      E  W RP +I + PQL  +G SRFDV QG LGDCWLLA  A+L+L + +F  VVP DQ F +NY G F F+FW++GKWV+VV+DDRLPT  G+L++MHSA NNEFWSALLEKAYAK+ G YE+L GG+  EA+ED TGGL E I L  K  P  L   M++  +  +L GC+IE+     E  M+NGL+ GHAYSIT  + V   +G    ++R+RNPWGNE+EW G WSD+S EW ++  S K+ +   F +DGEFWM+FDDF +NF K+EIC+LGP+ ++E   ++G +     W     DG+W +N  AGGCRN+I++F  NPQFRV++ D D +D +   TVI  ++QK   +++Q  L  + IG+ +Y + +   N G L+K FF  + +  +S  FIN RE+ GR ++P G+YV++PSTF PNEEA FMLR+++    +S+EL
Sbjct:  257 FYELRDQCLESKRLFEDPQFLANDSSLFFSKRPPKRVE--WLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL--KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTC-ILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDMNNAGNNRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 737          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 438.343 bits (1126), Expect = 9.279e-143
Identity = 233/486 (47.94%), Postives = 325/486 (66.87%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNE--DLSGKRR----WEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQK---DMRQRNLGFLVIGYVIYKLKDP--NCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKEL 1675
            + ++  Q   + +L+EDP F A+ SS+F SK      E  W RP +I + PQL  +G SRFDV QG LGDCWLLA  A+L+L + +F  VVP DQ F +NY G F F+FW++GKWV+VV+DDRLPT  G+L++MHSA NNEFWSALLEKAYAK+ G YE+L GG+  EA+ED TGGL E I L  K  P  L   M++  +  +L GC+IE+     E  M+NGL+ GHAYSIT  + V   +G    ++R+RNPWGNE+EW G WSD+S EW ++  S K+ +   F +DGEFWM+FDDF +NF K+EIC+LGP+ ++E   ++G +     W     DG+W +N  AGGCRN+I++F  NPQFRV++ D D +D +   TVI  ++QK   +++Q  L  + IG+ +Y + +   N G L+K FF  + +  +S  FIN RE+ GR ++P G+YV++PSTF PNEEA FMLR+++    +S+EL
Sbjct:  257 FYELRDQCLESKRLFEDPQFLANDSSLFFSKRPPKRVE--WLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL--KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTC-ILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDMNNAGNNRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 737          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 438.343 bits (1126), Expect = 9.279e-143
Identity = 233/486 (47.94%), Postives = 325/486 (66.87%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNE--DLSGKRR----WEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQK---DMRQRNLGFLVIGYVIYKLKDP--NCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKEL 1675
            + ++  Q   + +L+EDP F A+ SS+F SK      E  W RP +I + PQL  +G SRFDV QG LGDCWLLA  A+L+L + +F  VVP DQ F +NY G F F+FW++GKWV+VV+DDRLPT  G+L++MHSA NNEFWSALLEKAYAK+ G YE+L GG+  EA+ED TGGL E I L  K  P  L   M++  +  +L GC+IE+     E  M+NGL+ GHAYSIT  + V   +G    ++R+RNPWGNE+EW G WSD+S EW ++  S K+ +   F +DGEFWM+FDDF +NF K+EIC+LGP+ ++E   ++G +     W     DG+W +N  AGGCRN+I++F  NPQFRV++ D D +D +   TVI  ++QK   +++Q  L  + IG+ +Y + +   N G L+K FF  + +  +S  FIN RE+ GR ++P G+YV++PSTF PNEEA FMLR+++    +S+EL
Sbjct:  257 FYELRDQCLESKRLFEDPQFLANDSSLFFSKRPPKRVE--WLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL--KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTC-ILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDMNNAGNNRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 737          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 437.573 bits (1124), Expect = 3.430e-142
Identity = 233/484 (48.14%), Postives = 324/484 (66.94%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNE--DLSGKRR----WEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQK---DMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKEL 1675
            + ++  Q   + +L+EDP F A+ SS+F SK      E  W RP +I + PQL  +G SRFDV QG LGDCWLLA  A+L+L + +F  VVP DQ F +NY G F F+FW++GKWV+VV+DDRLPT  G+L++MHSA NNEFWSALLEKAYAK+ G YE+L GG+  EA+ED TGGL E I L  K  P  L   M++  +  +L GC+IE+     E  M+NGL+ GHAYSIT  + V   +G    ++R+RNPWGNE+EW G WSD+S EW ++  S K+ +   F +DGEFWM+FDDF +NF K+EIC+LGP+ ++E   ++G +     W     DG+W +N  AGGCRN+I++F  NPQFRV++ D D +D +   TVI  ++QK   +++Q  L  + IG+ +Y   + N G L+K FF  + +  +S  FIN RE+ GR ++P G+YV++PSTF PNEEA FMLR+++    +S+EL
Sbjct:  282 FYELRDQCLESKRLFEDPQFLANDSSLFFSKRPPKRVE--WLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL--KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTC-ILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDAGN-NRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 759          
BLAST of Calpain vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 437.187 bits (1123), Expect = 9.052e-142
Identity = 232/484 (47.93%), Postives = 324/484 (66.94%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNE--DLSGKRR----WEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQK---DMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKEL 1675
            + ++  Q   + +L+EDP F A+ SS+F SK     +   W RP +I + PQL  +G SRFDV QG LGDCWLLA  A+L+L + +F  VVP DQ F +NY G F F+FW++GKWV+VV+DDRLPT  G+L++MHSA NNEFWSALLEKAYAK+ G YE+L GG+  EA+ED TGGL E I L  K  P  L   M++  +  +L GC+IE+     E  M+NGL+ GHAYSIT  + V   +G    ++R+RNPWGNE+EW G WSD+S EW ++  S K+ +   F +DGEFWM+FDDF +NF K+EIC+LGP+ ++E   ++G +     W     DG+W +N  AGGCRN+I++F  NPQFRV++ D D +D +   TVI  ++QK   +++Q  L  + IG+ +Y   + N G L+K FF  + +  +S  FIN RE+ GR ++P G+YV++PSTF PNEEA FMLR+++    +S+EL
Sbjct:  303 FYELRDQCLESKRLFEDPQFLANDSSLFFSKRPP--KRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVPPDQSFTENYAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFIDL--KNPPRNLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGCRIVDGPNGQTC-ILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDAGN-NRGRLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEFMLRVYTNGFIESEEL 780          
BLAST of Calpain vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0076343)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 303/679 (44.62%), Postives = 421/679 (62.00%), Query Frame = 2
Query:  290 GKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTV---VELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNED--LSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGF--LVIGYVIYKLKDPNCGLLNK--SFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFME 2290
            G ++EDPDFPA  +S+  S+    Y E  W RP DI  +PQ F +G SRFDVQQG LGDCWLLA  A+L+    +F  V+P DQDF +NY G F F+FW++GKWVEVV+DDRLPTY G+L++MHS + NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E   +  KE P  L++ M+K A++ ++MGC++E     +E     GLI GHAYSIT V  +  +       + ++R+RNPWGN+ EW G WSDSSPEW  I +  KE +  NF  DGEFWM+F DF  +F ++EIC+L P+SL ED   S +R+WEM + +G W   + AGGCRNF+++F  NPQ+ + + DPDDED +   T I+ LMQK+ R +RN+G   L IG+ IY L D +  +  +  +FFK+  ++A+SP FIN REVC R KLP GHY+I+PSTF+PNEE  F++R+FSE +N  +E D E G  E           DD  A +       E+       L  LF  +AG  E ++  +L+ IL+  ++  M    GF  +  RSM+A+ D D +G++ F EF  L T++  W+  FK +D    G  D +  R ALN+ G  ++N L   + +RY   E G I F+DF+M  I++    E    +  D      F  ++++E
Sbjct:  257 GTMFEDPDFPATNASLMYSRRPDRYYE--WLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQENYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDI--KEAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEENDDEVGFGE----------TDDRIAPSLPPPTPKEEDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGSDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSRE-GQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLE 920          
BLAST of Calpain vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0304675)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 303/679 (44.62%), Postives = 421/679 (62.00%), Query Frame = 2
Query:  290 GKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTV---VELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNED--LSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGF--LVIGYVIYKLKDPNCGLLNK--SFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFME 2290
            G ++EDPDFPA  +S+  S+    Y E  W RP DI  +PQ F +G SRFDVQQG LGDCWLLA  A+L+    +F  V+P DQDF +NY G F F+FW++GKWVEVV+DDRLPTY G+L++MHS + NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E   +  KE P  L++ M+K A++ ++MGC++E     +E     GLI GHAYSIT V  +  +       + ++R+RNPWGN+ EW G WSDSSPEW  I +  KE +  NF  DGEFWM+F DF  +F ++EIC+L P+SL ED   S +R+WEM + +G W   + AGGCRNF+++F  NPQ+ + + DPDDED +   T I+ LMQK+ R +RN+G   L IG+ IY L D +  +  +  +FFK+  ++A+SP FIN REVC R KLP GHY+I+PSTF+PNEE  F++R+FSE +N  +E D E G  E           DD  A +       E+       L  LF  +AG  E ++  +L+ IL+  ++  M    GF  +  RSM+A+ D D +G++ F EF  L T++  W+  FK +D    G  D +  R ALN+ G  ++N L   + +RY   E G I F+DF+M  I++    E    +  D      F  ++++E
Sbjct:  257 GTMFEDPDFPATNASLMYSRRPDRYYE--WLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQENYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDI--KEAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEENDDEVGFGE----------TDDRIAPSLPPPTPKEEDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGSDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSRE-GQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLE 920          
BLAST of Calpain vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0086530)

HSP 1 Score: 492.656 bits (1267), Expect = 4.679e-166
Identity = 252/491 (51.32%), Postives = 331/491 (67.41%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDV---QKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDL--SGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGF--LVIGYVIYKLKDPNCGLLNK----SFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVEN 1687
            Y  IL     +G L+EDP FPA   S+  S+     R   W RP +I +NPQ F +G SRFDVQQG LGDCWLLA  A+L+    +F  V+P +Q F++NY G F FRFW++GKWV+V++DDRLPTY G+L++MHS + NEFWSALLEKAYAK+ G YE+L GGS  EAMEDFTGG+ E   L  KE P  L+  + K A+++++MGC+IE      E     GLI GHAYSIT V     V       + ++R+RNPWGNE EW G WSDSSPEW  I + +K  +   F  DGEFWM+F DF  +F ++EIC+L P+SL ED   SGKR+WEM + +G W   + AGGCRNF+D+F  NPQ+ + +VDPD+ED E   TVI+ LMQK+ R +RN+G   L IG+ IY L D    L N+    +FF++ +++ +SP FIN REVC R KLP GHY+I+PSTF+PNEE  F++R+FSE QN  + + V+N
Sbjct:   75 YETILNSCLASGSLFEDPLFPASNESLQFSRRPD--RHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL--KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRE--LENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMECVQVDN 559          
BLAST of Calpain vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0112869)

HSP 1 Score: 496.893 bits (1278), Expect = 3.975e-164
Identity = 267/562 (47.51%), Postives = 357/562 (63.52%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDV---QKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDL--SGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGF--LVIGYVIYKLKDPNCGLLNK----SFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKD-LEELFKVMAGPMEVINACQLRDILNAVLKKDM 1897
            Y  IL     +G L+EDP FPA   S+  S+     R   W RP +I +NPQ F +G SRFDVQQG LGDCWLLA  A+L+    +F  V+P +Q F++NY G F FRFW++GKWV+V++DDRLPTY G+L++MHS + NEFWSALLEKAYAK+ G YE+L GGS  EAMEDFTGG+ E   L  KE P  L+  + K A+++++MGC+IE      E     GLI GHAYSIT V     V       + ++R+RNPWGNE EW G WSDSSPEW  I + +K  +   F  DGEFWM+F DF  +F ++EIC+L P+SL ED   SGKR+WEM + +G W   + AGGCRNF+D+F  NPQ+ + +VDPD+ED E   TVI+ LMQK+ R +RN+G   L IG+ IY L D    L N+    +FF++ +++ +SP FIN REVC R KLP GHY+I+PSTF+PNEE  F++R+FSE QN  +E D   G                G+A T        K +  +K+ L  LF  +AG    ++  +L+ IL+  ++ D+
Sbjct:   75 YETILNSCLASGSLFEDPLFPASNESLQFSRRPD--RHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL--KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRE--LENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEENDDHVGYG--------------GKADTITPGFPTPKPIDPQKEGLRRLFDSIAGKDMEVDWMELKRILDHSMRDDL 616          

HSP 2 Score: 91.2781 bits (225), Expect = 1.548e-18
Identity = 44/127 (34.65%), Postives = 74/127 (58.27%), Query Frame = 2
Query: 1910 GFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFME 2290
            GF  +VCRSM+A+ D D +GK+ F EF  L + +  WK  FK +D +  G    ++ R ALN+ G  ++N +  V+G+RY    +G I F+DFIM  +++    +  + +  ++ +   FT EE++E
Sbjct:  698 GFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGS-RDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIE 823          
BLAST of Calpain vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0086529)

HSP 1 Score: 496.893 bits (1278), Expect = 3.975e-164
Identity = 267/562 (47.51%), Postives = 357/562 (63.52%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDV---QKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDL--SGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGF--LVIGYVIYKLKDPNCGLLNK----SFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKD-LEELFKVMAGPMEVINACQLRDILNAVLKKDM 1897
            Y  IL     +G L+EDP FPA   S+  S+     R   W RP +I +NPQ F +G SRFDVQQG LGDCWLLA  A+L+    +F  V+P +Q F++NY G F FRFW++GKWV+V++DDRLPTY G+L++MHS + NEFWSALLEKAYAK+ G YE+L GGS  EAMEDFTGG+ E   L  KE P  L+  + K A+++++MGC+IE      E     GLI GHAYSIT V     V       + ++R+RNPWGNE EW G WSDSSPEW  I + +K  +   F  DGEFWM+F DF  +F ++EIC+L P+SL ED   SGKR+WEM + +G W   + AGGCRNF+D+F  NPQ+ + +VDPD+ED E   TVI+ LMQK+ R +RN+G   L IG+ IY L D    L N+    +FF++ +++ +SP FIN REVC R KLP GHY+I+PSTF+PNEE  F++R+FSE QN  +E D   G                G+A T        K +  +K+ L  LF  +AG    ++  +L+ IL+  ++ D+
Sbjct:   75 YETILNSCLASGSLFEDPLFPASNESLQFSRRPD--RHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDL--KEAPGNLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSLNDRE--LENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETQNNMEENDDHVGYG--------------GKADTITPGFPTPKPIDPQKEGLRRLFDSIAGKDMEVDWMELKRILDHSMRDDL 616          

HSP 2 Score: 91.2781 bits (225), Expect = 1.548e-18
Identity = 44/127 (34.65%), Postives = 74/127 (58.27%), Query Frame = 2
Query: 1910 GFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFME 2290
            GF  +VCRSM+A+ D D +GK+ F EF  L + +  WK  FK +D +  G    ++ R ALN+ G  ++N +  V+G+RY    +G I F+DFIM  +++    +  + +  ++ +   FT EE++E
Sbjct:  698 GFSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGYHLNNRVLNVLGHRYGS-RDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEWIE 823          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn9 (calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2])

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 295/667 (44.23%), Postives = 423/667 (63.42%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKD---MRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETME 2233
            Y  + ++    GKL+EDPDFPA   S+F S+  +    F WKRP +ICK PQ    G +R D+ QG LGDCWLLA +ASL+L E     VVP DQ FD+ Y G F F+FW+  KW++VVVDDRLP    KLVF+HSADNNEFWSALLEKAYAK+ G YE+L GGS +EAMEDFTGG+ E  +   K  P  L+  + K  ++ +++GC+I+   SA+ E   + GL+ GHAYS+T V++V    G  V+L+RVRNPWG + EW G WSD+S EW  I  SEK+RL  N  +DGEFWM F DF  N+ K+EIC+L P++L++D+S  ++W + + +GSW +   AGGCRN+ID+F TNPQF+  +   + +D +   +VI+ LMQK+   +R+  L    IG+ IY+  D +     K FF+++ + A+S  +IN REV  R +LP G+Y+++P+TF P++EA+F++R+FSEK  K+  ++V N   +I   L      +     T E           EK L +LF+ +AGP  VI+A +L+ +LN VL  +K++K F G  L  C S+I L D D +G MEF EF + W  L+ W   F  +D D +G   +YE R+ALN  G+ ++N + +++G R+ D E   I F+D++  ++RL N F   +
Sbjct:   27 YEQLRRECLEKGKLFEDPDFPAVDGSLFYSQ--RVPVNFEWKRPGEICKEPQFITGGATRTDICQGQLGDCWLLAAIASLTLKEETLNRVVPNDQTFDRGYAGIFHFQFWQHNKWMDVVVDDRLPCVRDKLVFLHSADNNEFWSALLEKAYAKLNGSYEALKGGSTMEAMEDFTGGVGEMYE--TKNGPNNLFLILKKAIERGSMLGCSIDITSSAESEAQTSTGLVKGHAYSVTGVEEVNYR-GAKVQLIRVRNPWG-QVEWNGPWSDNSREWTVIDSSEKKRLLQNSLDDGEFWMEFGDFKSNYDKVEICNLSPDALSDDVS--KQWAVNLFEGSWIRGSTAGGCRNYIDTFWTNPQFK--LHLENPDDGDKLCSVIVALMQKNRRRLRKEGLDLETIGFAIYEAPD-DQDHQGKDFFRYNPSKARSRTYINVREVSERFRLPPGNYLLVPTTFQPHKEADFLIRLFSEK--KAGAIEVGN---KIEADLPEPPKPNPPEEETDE-----------EKGLRKLFEQVAGPDNVISARELQHVLNNVLGRRKEVK-FDGLSLNTCISIINLMDVDGSGMMEFSEFKVFWDKLKKWIMLFLSYDVDRSGTMSSYELRSALNAAGMKLNNRILQLLGLRFAD-EKLEIDFDDYLTCIVRLENMFRIFQ 664          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 517.694 bits (1332), Expect = 1.617e-173
Identity = 290/651 (44.55%), Postives = 404/651 (62.06%), Query Frame = 2
Query:  296 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGT--VVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGFLV--IGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMK-NFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAF 2221
            L+EDP FPA  SS+F S+  K   +  WKRP +ICKNPQ    G +R D+ QG LGDCWLLA +A L+L + I K VVP DQ F +NY G F F+FWR+G+WV+VV+DDRLPTY  KLVF  S  NNEFWSAL+EKAYAK+ G YE+L GG+ +EAMEDFTGG+ E  ++ E   P  LYN M K  K+ +LMGCAI++          A+GL+ GHAYS+T V++ K+ DG   ++ LVRVR+PWG       K +D    W  ++K+E+++        GEFWM F++F KNFTK+EIC+L P++L +D   K  W + + +G W K  +AGGCRNF D++ TNPQFR  +V  + +  E T TV++ LMQK  R +R  G  +  IG+ IY++K      L+K FF ++ + A+S  ++N REV  R  L  G YVIIPSTF+P++E+ F+LR+FSE ++ SK +D E     +         VD+   V  ++K   E+    EK    +F+ +AG    INA +LR +LN V+ K  +   +GF LE CRSMIAL D D TG +   EF  LW  ++ WK  F  FD D++    ++E RNAL   G  ++N L+ +I  RY + E+  + F+ +I  ++RL   F
Sbjct:   65 LFEDPLFPAQDSSLFYSE--KFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDCWLLAAIACLTLNDVILKRVVPHDQSFTENYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKLVFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEITEA--PKELYNIMRKALKRGSLMGCAIDTLVPTAQRTKTASGLVRGHAYSVTGVEQGKRKDGKDLMIRLVRVRDPWGVAPPPACKSND----WVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLTPDTLEDDQMFK--WNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFR--LVLLEADAKEKTCTVVVALMQKGRRVERCSGATLHNIGFAIYEMKGNQQQQLSKDFFLYNASTARSKSYVNIREVTERFCLKPGEYVIIPSTFDPHKESEFLLRVFSENRSTSKVIDAEIEAEPM--------QVDN---VKKKIKPFEEEETEEEKQFRAIFQQIAGDDMEINANELRTVLNRVVAKHKELKTEGFSLESCRSMIALLDTDGTGHLNLQEFKHLWNKIKQWKLVFTRFDTDKSSTISSFEMRNALTEAGFQLNNQLYDIICMRYAN-EHMELDFDSYISCLVRLEGMF 691          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn3a (calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912-97])

HSP 1 Score: 518.079 bits (1333), Expect = 1.623e-173
Identity = 292/669 (43.65%), Postives = 416/669 (62.18%), Query Frame = 2
Query:  296 LWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDG--TVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMR-QRNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLE------ELFKVMAGPMEVINACQLRDILNAVLKKDMK-NFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETME 2233
            L+ED  FPA   S+    +   S   +  VWKRPK+IC NPQ    G SR D+ QG LGDCWLLA +A L+L + +   V+P +Q F + Y G F F+FWR+G WV+VVVDDR+PT+  +LVF  SA+ NEFWSALLEKAYAK+ G YE+L GG+  E MEDFTGG+ E  ++  KE P  LY  M K  ++ +LMGC+I+S   A+ E   A GL+ GHAYS+T V++ KQ+    + V LVR+RNPWG + EW G WSD+S EWE++SK+EKE+L    A DGEFWM+F+DF KN+TKIEIC+L P++L +D   K  W + + +G W +  +AGGCRN+ D+F TNPQ+R+ +++ DD+  ++    T ++ LMQK+ R +R LG   L IG+ IY++     G    + K FF  +T  A+S  +IN REV  R +L  G YVIIPS++ P++E  F+LR+FSEK+N S+E++          +    D      A TGE   ++++ L++ + +       E        MEV +A +L+D+LN V+ K    + + F  E CRSMIAL D D TG++   EF  LW  ++ W+  FK +D D N    +YE RNA+N+ G  ++N L+ +I  RY + E+  + FE FI  ++RL   F   +
Sbjct:   50 LFEDETFPATVDSLGYKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNDKLLYRVIPQEQSFSEQYAGIFHFQFWRYGDWVDVVVDDRIPTFNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTAEGMEDFTGGVTEFYEM--KEAPKELYKIMQKALERGSLMGCSIDSLVPARFETRTATGLVKGHAYSVTAVEECKQSQQKESRVRLVRLRNPWG-QVEWNGPWSDNSKEWESLSKAEKEKLQQQNAEDGEFWMSFEDFKKNYTKIEICNLTPDALEDDKLHK--WTVSVNEGRWVRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPEDDEVACTFVVALMQKNRRKERKLGANLLTIGFSIYEVPKEMHGNKQHMQKEFFMSTTAKARSRAYINLREVTQRFRLSPGEYVIIPSSYEPHQEGEFILRVFSEKRNTSEEIE----------NRIEADHPVPSPASTGEESEEDQQFLSIFQHIAGDVSTGEAVSAWGSNMEV-SANELKDVLNKVVSKHKDIHTESFSRECCRSMIALMDMDGTGRLNLQEFRQLWNKIKQWQEIFKRYDFDHNDTISSYEMRNAINDAGFRLNNQLYDIITMRYAN-ESMNVDFESFISCLVRLEGMFRAFQ 701          
BLAST of Calpain vs. Ensembl Zebrafish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 512.686 bits (1319), Expect = 2.095e-171
Identity = 290/655 (44.27%), Postives = 404/655 (61.68%), Query Frame = 2
Query:  296 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGT--VVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGFLV--IGYVIY----KLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMK-NFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAF 2221
            L+EDP FPA  SS+F S+  K   +  WKRP +ICKNPQ    G +R D+ QG LGDCWLLA +A L+L + I K VVP DQ F +NY G F F+FWR+G+WV+VV+DDRLPTY  KLVF  S  NNEFWSAL+EKAYAK+ G YE+L GG+ +EAMEDFTGG+ E  ++ E   P  LYN M K  K+ +LMGCAI++          A+GL+ GHAYS+T V++ K+ DG   ++ LVRVR+PWG       K +D    W  ++K+E+++        GEFWM F++F KNFTK+EIC+L P++L +D   K  W + + +G W K  +AGGCRNF D++ TNPQFR  +V  + +  E T TV++ LMQK  R +R  G  +  IG+ IY    ++K      L+K FF ++ + A+S  ++N REV  R  L  G YVIIPSTF+P++E+ F+LR+FSE ++ SK +D E     +         VD+   V  ++K   E+    EK    +F+ +AG    INA +LR +LN V+ K  +   +GF LE CRSMIAL D D TG +   EF  LW  ++ WK  F  FD D++    ++E RNAL   G  ++N L+ +I  RY + E+  + F+ +I  ++RL   F
Sbjct:   65 LFEDPLFPAQDSSLFYSE--KFPLKLEWKRPMEICKNPQFILGGANRTDICQGDLGDCWLLAAIACLTLNDVILKRVVPHDQSFTENYAGIFHFQFWRYGEWVDVVIDDRLPTYKNKLVFTRSGQNNEFWSALMEKAYAKLHGSYEALKGGNSLEAMEDFTGGVTEFYEITEA--PKELYNIMRKALKRGSLMGCAIDTLVPTAQRTKTASGLVRGHAYSVTGVEQGKRKDGKDLMIRLVRVRDPWGVAPPPACKSND----WVELAKTEQDKQRLQPGEQGEFWMCFEEFQKNFTKLEICNLTPDTLEDDQMFK--WNVTVHEGRWVKGCSAGGCRNFPDTYWTNPQFR--LVLLEADAKEKTCTVVVALMQKGRRVERCSGATLHNIGFAIYEVPKEMKGNQQQQLSKDFFLYNASTARSKSYVNIREVTERFCLKPGEYVIIPSTFDPHKESEFLLRVFSENRSTSKVIDAEIEAEPM--------QVDN---VKKKIKPFEEEETEEEKQFRAIFQQIAGDDMEINANELRTVLNRVVAKHKELKTEGFSLESCRSMIALLDTDGTGHLNLQEFKHLWNKIKQWKLVFTRFDTDKSSTISSFEMRNALTEAGFQLNNQLYDIICMRYAN-EHMELDFDSYISCLVRLEGMF 695          
BLAST of Calpain vs. Ensembl Zebrafish
Match: zgc:55262 (zgc:55262 [Source:ZFIN;Acc:ZDB-GENE-040426-2814])

HSP 1 Score: 499.975 bits (1286), Expect = 8.854e-167
Identity = 280/678 (41.30%), Postives = 406/678 (59.88%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFV------SKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK---IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRNL---GFLVIGYVIYKLKDPNCGL----LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLR-NTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETME 2233
            Y  +  Q + + +L+EDP F A +SS+        S  ++G R   W RPK++C  PQ   DG +R D+ QGALGDCWLLA +ASL+L + +   VVP  QDFD  Y G F F+FW+FG+WV+VV+DDRLPT  GKL+F+HSA+  EFWSALLEKAYAK+ G YE+LSGGS  E  EDFTGG+ E  +L  K+ P  L++ + +  ++ +L+GC+I+      +E V    L+ GHAYS+T  ++V    G + +LVR+RNPWG E EW G WSD+S EW+ + +S + RL  N + DGEFWM+F DF + FT++EIC+L  ++L    S  ++W     +G W +   AGGCRN+  +F  NPQF+V +  PD        + ++ LMQKD R++         IG+ IY++     G     L + FF    + A+S  FIN REV  R +LP G Y+I+PSTF PN+EA+F+LR+FSEK   S+E+D +    EI +  R +   +D G                     + LF+ +AG    I+  +L+ ILN ++   KD+K   GF  E CRSMI L D D +GK+   EF +LW  ++ +   F+D D D++G   +YE R AL   G  ++N LF++I  RYT+ E+  + F++F+  ++RL   F+T +
Sbjct:   37 YETLRAQSQQSRRLFEDPMFTASSSSLGFNELGPRSSKTQGVR---WMRPKEMCARPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQDFDSRYAGIFHFQFWQFGEWVDVVIDDRLPTKDGKLLFVHSAEGGEFWSALLEKAYAKLNGCYEALSGGSTCEGFEDFTGGVTEMYEL--KKAPADLFSIIGRAIERGSLLGCSIDITSKFDMEAVTFKKLVKGHAYSVTGAEEVVYR-GNMTKLVRIRNPWG-EVEWTGAWSDNSREWDNVDRSVRGRL-QNRSEDGEFWMSFSDFLREFTRLEICNLTADALQA--SQVKKWSTANYNGEWRRGSTAGGCRNYPATFWINPQFKVALKHPDSPGQSEC-SFLVALMQKDRRKKRREGQDMETIGFAIYEVPREFLGQSGVHLKRDFFLTHASSARSELFINLREVSSRFRLPAGEYIIVPSTFEPNKEADFVLRVFSEKPANSEEMD-DKVMAEIPEEQRLDESQIDAG--------------------FKSLFRQLAGADMEISVTELQTILNRIIAKHKDLKT-DGFGKESCRSMINLMDTDGSGKLGLVEFHVLWEKIKRYLQIFRDHDVDKSGTMSSYEMRKALETAGFKLNNHLFQLIILRYTE-EDLSVDFDNFVSCLVRLETMFKTFK 680          
BLAST of Calpain vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 526.554 bits (1355), Expect = 2.821e-176
Identity = 291/674 (43.18%), Postives = 416/674 (61.72%), Query Frame = 2
Query:  299 WEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHL----------RNTDMVDDGRAVTGEVKVKNEKI----------LALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFK--GFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAF 2221
            ++D +FP D SS+F S++     +F WKRP +IC+NPQ    G +R D+ QG LGDCW LA +A L+L E +   V+P DQ+F  NY G F F+FWR+G WV+V++DD LPTY  +LVF  S+  NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  +L  KE P  +YN M K  ++ +L+GC+I++    ++E  MANGL+ GHAYS+T V++ K   G  ++LVR+RNPWG + EW G W D++ EW  + KSEK RL      DGEFWM++DDF KNFTK EIC+L P++L+ D    + W + + +G W +  +AGGCRN+ D++ TNPQ+R+++++ DD+ ++N    + ++ LMQK+ R+ R  G     IG+ IY++     G    L K FF ++ + AK   +IN REVC R +LP   YVIIPST+ P++E  F+LR+FSEK+N S+E  VEN K E  K +           N ++  DG     + K+  EK              EK    +F+ +AG    I+A +L+ +LN V+ K  K  K  GF LE CRSMIAL D D  G++   EF  LW  ++ W+  F  FD+D++G   ++E RNA+N  G  ++N L+ +I  RY +     + F+ FI   +RL   F
Sbjct:   66 FQDREFPPDESSLFYSQSFP--IKFEWKRPPEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTDNYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL--KEAPKDMYNIMKKAFERGSLIGCSIDTLVPVQLETRMANGLVKGHAYSVTGVEETK-LKGKPIKLVRLRNPWG-QVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSD--SLQVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEVPKEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEE--VEN-KIEAEKPIPIIFVSDRSNSNKELNVDGATDEDQKKMDAEKKDKTSASTDTETEEEKQFRNIFQQIAGDDMEISADELQSVLNNVVNKH-KTLKSSGFTLESCRSMIALMDTDGCGRLNLQEFYHLWQKIKQWQKIFLRFDSDQSGTISSFEMRNAINEAGFHLNNQLYDIITMRYANKRMD-LDFDSFICCFVRLEGMF 726          
BLAST of Calpain vs. Ensembl Xenopus
Match: tgfbrap1 (transforming growth factor beta receptor associated protein 1 [Source:Xenbase;Acc:XB-GENE-1009020])

HSP 1 Score: 523.857 bits (1348), Expect = 4.805e-176
Identity = 292/703 (41.54%), Postives = 424/703 (60.31%), Query Frame = 2
Query:  206 QLKPTPMKKRDLDKQTLYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKD---MRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKN--FKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETM-ELQPQDEEKNYVFTAEEFM 2287
            Q  P  +       + L +D L++    G L+ED DFPA+ SS+F S+  K    FVWKRPK++  +P+    G SR DV QG LGDCWLLA +ASL+L + I   VVP DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD NEFWSALLEKAYAK+ G YE+L GGS +EAMEDFTGG+ ET ++  +  P  L++ + K  K+ +++GC+I+   SA+ E     GL+ GHAYSIT    V    G  V+L+R+RNPWG + EW G WSD+S EW  I  +EK RL     +DGEFWM F+DF ++F K+EIC+L P+SL++D   K +WE+ + +GSW +   AGGCRNF+++F +NPQ +  +   + +D +   T I  LMQK+   +R+     L IGY IY+       +L+K FFKF+ + A+S  ++N RE+  R KLP G Y+ IP+TF P++EA+F LRIFSEK+   KE+D E           N D+ D         + +       E+    LF+ ++G    ++A +L+ +LNAVL++  KN  FK   L  C ++I+L D    GK+ F EF + W  L+ W   F  +D D++G   +YE R AL + G  ++N + ++I  RY D +   I+F+DF+  ++RL N++    +L   D  +       EF+
Sbjct:   16 QQTPRSIHSSGKTYEQLKNDCLRK----GVLFEDVDFPANDSSLFYSE--KPSVPFVWKRPKEMVADPEFILGGASRTDVCQGDLGDCWLLAAIASLTLNDKILYRVVPPDQSFSTGYAGIFHFQFWQHNEWLDVVIDDRLPTFRNRLVFVHSADLNEFWSALLEKAYAKLNGSYEALKGGSTLEAMEDFTGGVTETYEI--RSAPANLFDILDKAIKKGSMLGCSIDITSSAETEAKTPQGLVKGHAYSITGAD-VVNFKGQKVKLIRIRNPWG-QVEWNGAWSDNSSEWNIIGAAEKNRLSQASLDDGEFWMDFEDFKRHFDKLEICNLTPDSLDDD--AKHKWEVTVHEGSWIRGSTAGGCRNFLETFWSNPQIK--LSLTEQDDGQKECTFIAALMQKNRRKLRKTGADLLTIGYTIYQCPGSE-SILSKDFFKFNPSKARSKTYVNLREISQRFKLPPGDYMFIPTTFEPHQEADFCLRIFSEKKADIKEMDGE----------VNIDLPDPPAPTPPHKETEE------ERQFRTLFEQISGQDLEVSAEELQYVLNAVLRR-TKNIKFKEMSLLSCNNIISLMDASGNGKLGFDEFKIFWDKLKTWIGIFMQYDLDKSGTMSSYELRLALKSAGFHLNNIVLQLIVLRYAD-DQFQIEFDDFLNCLVRLENSYRVFKQLNRSDTTETIQLNQAEFI 685          
BLAST of Calpain vs. Ensembl Xenopus
Match: tgfbrap1 (transforming growth factor beta receptor associated protein 1 [Source:Xenbase;Acc:XB-GENE-1009020])

HSP 1 Score: 521.161 bits (1341), Expect = 4.973e-174
Identity = 288/684 (42.11%), Postives = 418/684 (61.11%), Query Frame = 2
Query:  206 QLKPTPMKKRDLDKQTLYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKD---MRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKN--FKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETME 2233
            Q  P  +       + L +D L++    G L+ED DFPA+ SS+F S+  K    FVWKRPK++  +P+    G SR DV QG LGDCWLLA +ASL+L + I   VVP DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD NEFWSALLEKAYAK+ G YE+L GGS +EAMEDFTGG+ ET ++  +  P  L++ + K  K+ +++GC+I+   SA+ E     GL+ GHAYSIT    V    G  V+L+R+RNPWG + EW G WSD+S EW  I  +EK RL     +DGEFWM F+DF ++F K+EIC+L P+SL++D   K +WE+ + +GSW +   AGGCRNF+++F +NPQ +  +   + +D +   T I  LMQK+   +R+     L IGY IY+       +L+K FFKF+ + A+S  ++N RE+  R KLP G Y+ IP+TF P++EA+F LRIFSEK+   KE+D E           N D+ D         + +       E+    LF+ ++G    ++A +L+ +LNAVL++  KN  FK   L  C ++I+L D    GK+ F EF + W  L+ W   F  +D D++G   +YE R AL + G  ++N + ++I  RY D +   I+F+DF+  ++RL N++   +
Sbjct:   16 QQTPRSIHSSGKTYEQLKNDCLRK----GVLFEDVDFPANDSSLFYSE--KPSVPFVWKRPKEMVADPEFILGGASRTDVCQGDLGDCWLLAAIASLTLNDKILYRVVPPDQSFSTGYAGIFHFQFWQHNEWLDVVIDDRLPTFRNRLVFVHSADLNEFWSALLEKAYAKLNGSYEALKGGSTLEAMEDFTGGVTETYEI--RSAPANLFDILDKAIKKGSMLGCSIDITSSAETEAKTPQGLVKGHAYSITGAD-VVNFKGQKVKLIRIRNPWG-QVEWNGAWSDNSSEWNIIGAAEKNRLSQASLDDGEFWMDFEDFKRHFDKLEICNLTPDSLDDD--AKHKWEVTVHEGSWIRGSTAGGCRNFLETFWSNPQIK--LSLTEQDDGQKECTFIAALMQKNRRKLRKTGADLLTIGYTIYQCPGSE-SILSKDFFKFNPSKARSKTYVNLREISQRFKLPPGDYMFIPTTFEPHQEADFCLRIFSEKKADIKEMDGE----------VNIDLPDPPAPTPPHKETEE------ERQFRTLFEQISGQDLEVSAEELQYVLNAVLRR-TKNIKFKEMSLLSCNNIISLMDASGNGKLGFDEFKIFWDKLKTWIGIFMQYDLDKSGTMSSYELRLALKSAGFHLNNIVLQLIVLRYAD-DQFQIEFDDFLNCLVRLENSYRVFK 666          
BLAST of Calpain vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 512.686 bits (1319), Expect = 1.562e-170
Identity = 300/748 (40.11%), Postives = 427/748 (57.09%), Query Frame = 2
Query:  221 PMKKRDLDKQTLYSDILKQLKGTGKLWEDPDFPADTSSV----FVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES-----------------------------------------------AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHL----------RNTDMVDDGRAVTGEVKVKNEKI----------LALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFK--GFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAF 2221
            P+K  + D  TL S+ +    G  KL+EDP F     S+    F  K++K  +  +WKRPK+IC+NPQ    G +R D+ QG LGDCW LA +A L+L E +   V+P DQ+F  NY G F F+FWR+G WV+V++DD LPTY  +LVF  S+  NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  +L  KE P  +YN M K  ++ +L+GC+I+                                                 ++E  MANGL+ GHAYS+T V++ K   G  ++LVR+RNPWG + EW G W D++ EW  + KSEK RL      DGEFWM++DDF KNFTK EIC+L P++L+ D    + W + + +G W +  +AGGCRN+ D++ TNPQ+R+++++ DD+ ++N    + ++ LMQK+ R+ R  G     IG+ IY++     G    L K FF ++ + AK   +IN REVC R +LP   YVIIPST+ P++E  F+LR+FSEK+N S+E  VEN K E  K +           N ++  DG     + K+  EK              EK    +F+ +AG    I+A +L+ +LN V+ K  K  K  GF LE CRSMIAL D D  G++   EF  LW  ++ W+  F  FD+D++G   ++E RNA+N  G  ++N L+ +I  RY +     + F+ FI   +RL   F
Sbjct:   29 PVKFENQDFATLKSEFV----GKKKLFEDPIFLPAVQSLGQKEFAQKSTK-LKNIIWKRPKEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTDNYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL--KEAPKDMYNIMKKAFERGSLIGCSIDDKYGSSCGFAPPSNMEDAIMKMIESVGDTRPDTNGRGQPPKPVATLVPVQLETRMANGLVKGHAYSVTGVEETK-LKGKPIKLVRLRNPWG-QVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSD--SLQVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEVPKEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEE--VEN-KIEAEKPIPIIFVSDRSNSNKELNVDGATDEDQKKMDAEKKDKTSASTDTETEEEKQFRNIFQQIAGDDMEISADELQSVLNNVVNK-HKTLKSSGFTLESCRSMIALMDTDGCGRLNLQEFYHLWQKIKQWQKIFLRFDSDQSGTISSFEMRNAINEAGFHLNNQLYDIITMRYANKRMD-LDFDSFICCFVRLEGMF 760          
BLAST of Calpain vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 508.449 bits (1308), Expect = 1.158e-168
Identity = 291/718 (40.53%), Postives = 415/718 (57.80%), Query Frame = 2
Query:  299 WEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES-----------------------------------------------AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHL----------RNTDMVDDGRAVTGEVKVKNEKI----------LALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFK--GFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAF 2221
            ++D +FP D SS+F S++     +F WKRP +IC+NPQ    G +R D+ QG LGDCW LA +A L+L E +   V+P DQ+F  NY G F F+FWR+G WV+V++DD LPTY  +LVF  S+  NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  +L  KE P  +YN M K  ++ +L+GC+I+                                                 ++E  MANGL+ GHAYS+T V++ K   G  ++LVR+RNPWG + EW G W D++ EW  + KSEK RL      DGEFWM++DDF KNFTK EIC+L P++L+ D    + W + + +G W +  +AGGCRN+ D++ TNPQ+R+++++ DD+ ++N    + ++ LMQK+ R+ R  G     IG+ IY++     G    L K FF ++ + AK   +IN REVC R +LP   YVIIPST+ P++E  F+LR+FSEK+N S+E  VEN K E  K +           N ++  DG     + K+  EK              EK    +F+ +AG    I+A +L+ +LN V+ K  K  K  GF LE CRSMIAL D D  G++   EF  LW  ++ W+  F  FD+D++G   ++E RNA+N  G  ++N L+ +I  RY +     + F+ FI   +RL   F
Sbjct:   66 FQDREFPPDESSLFYSQSFP--IKFEWKRPPEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIPPDQNFTDNYAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEL--KEAPKDMYNIMKKAFERGSLIGCSIDDKYGSSCGFAPPSNMEDAIMKMIESVGDTRPDTNGRGQPPKPVATLVPVQLETRMANGLVKGHAYSVTGVEETK-LKGKPIKLVRLRNPWG-QVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSD--SLQVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEVPKEMHGNNQHLQKDFFLYNASKAKCKSYINMREVCQRFRLPPSEYVIIPSTYEPHQEGEFILRVFSEKRNISEE--VEN-KIEAEKPIPIIFVSDRSNSNKELNVDGATDEDQKKMDAEKKDKTSASTDTETEEEKQFRNIFQQIAGDDMEISADELQSVLNNVVNK-HKTLKSSGFTLESCRSMIALMDTDGCGRLNLQEFYHLWQKIKQWQKIFLRFDSDQSGTISSFEMRNAINEAGFHLNNQLYDIITMRYANKRMD-LDFDSFICCFVRLEGMF 770          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn9 (calpain 9 [Source:MGI Symbol;Acc:MGI:1920897])

HSP 1 Score: 526.554 bits (1355), Expect = 2.917e-177
Identity = 291/692 (42.05%), Postives = 423/692 (61.13%), Query Frame = 2
Query:  206 QLKPTPMKKRDLDKQTLYSDILKQ-LKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL-KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNA---FETMELQPQD 2248
            Q +P P   R +       + L+Q    +G L+ED DFPA   S+F S+  +    FVWKRP +I + P+    G +R D+ QG LGDCWLLA +ASL+L +     VVP DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD+NEFWSALLEKAYAK+ G YE+L GGS IEAMEDFTGG+ E  ++  +E P   +  + K  K+ +L+GC+I++   ++ E   + GLI GHAY++T + +V    G  ++L+RVRNPWG + EW G WSDSSPEW ++   E++RL     +DGEFWM F DF  +F K+EIC+L P++L +  S   RWE+ I  GSW +   AGGCRNF+D+F TNPQ +  +   + ++ +   T +  LMQKD R+ +  G   L IGY IY+  D + G L++ FF++  ++A+S  FIN REV  R +LP G Y++IPSTF P++EA+F LRIFSEK+  +++LD EN   ++ +  + T                 E+    E+    LF+ +AG    ++A +L  +LNAVL KK    FK   L  CR++I+L D    GK+EF EF + W  L+ W   F  FD D++G   +YE R AL   G  +   L ++I  RY D E+  + F+D++  ++RL NA   F+++ ++ +D
Sbjct:   11 QPQPVPGDARTIHSSGQSFEQLRQGCLQSGTLFEDADFPASNVSLFYSERPQ--VPFVWKRPGEIVEKPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALTRVVPQDQGFGSGYAGIFHFQFWQHSEWLDVVIDDRLPTFKDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENFQI--REAPEDFFEILEKALKRGSLLGCSIDTLNASESEARTSLGLIKGHAYTVTGLDQVN-FHGQRIKLIRVRNPWG-QVEWNGPWSDSSPEWRSVDLEEQKRLGHTALDDGEFWMAFKDFKIHFDKVEICNLTPDALED--SALHRWEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQIK--LSLTERDEGQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQCPDKD-GHLSRDFFRYHASLARSKTFINLREVSERFQLPPGDYILIPSTFEPHQEADFCLRIFSEKRAVTRDLD-ENIDIDLPELPKPT---------------PQEEETEEEQQFRALFQRVAGEDMEVSAEELEYVLNAVLQKKTALKFKRLSLLSCRNIISLMDTSGNGKLEFEEFRVFWDKLKHWMDLFLQFDVDKSGTMSSYELRTALKAAGFQLGGHLLQLIVLRYAD-EDLQLDFDDYLNCLVRLENASRVFQSLSVKNKD 674          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn3 (calpain 3 [Source:MGI Symbol;Acc:MGI:107437])

HSP 1 Score: 516.153 bits (1328), Expect = 1.224e-172
Identity = 280/655 (42.75%), Postives = 408/655 (62.29%), Query Frame = 2
Query:  296 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAF 2221
            L+ DP+FP D +S+F S+  K   +FVWKRP +IC+NP+    G +R D+ QG LGDCW LA +A L+L E +   V+P DQ F +NY G F F+FWR+G WV+VV+DD LPTY  +LVF  S   NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  K+ P  +Y  M K  ++ +LMGC+I++    + E  MA GL+ GHAYS+T +++     G  V+LVR+RNPWG + EW G WSD   +W  + K EK RL      DGEFWM++DDF  +FTK+EIC+L  ++L  D    + W + + +G W +  +AGGCRNF D+F TNPQ+R+++++ DD+  ++    + ++ LMQK+ R+ R LG     IG+ IY++     G    L K FF ++ + A+S  +IN REV  R +LP   YVI+PST+ P++E  F+LR+FSEK+N S+E +             NT  VD      G    ++E+    ++    +F+ +AG    I A +L+++LN V+   KD+K  +GF LE CRSMIAL D D +G++   EF  LW  ++ W+  FK +D D +G  ++YE RNA+N+ G  +++ L+ +I  RY D ++  I F+ FI   +RL   F
Sbjct:   74 LYLDPEFPPDETSLFYSQ--KFPIQFVWKRPPEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEI--KDAPSDMYKIMRKAIERGSLMGCSIDTIVPVQYETRMACGLVKGHAYSVTGLEEA-LFKGEKVKLVRLRNPWG-QVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADALESD--KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAE-------------NTISVDRPVPRPGHTDQESEE----QQQFRNIFRQIAGDDMEICADELKNVLNTVVNKHKDLKT-QGFTLESCRSMIALMDTDGSGRLNLQEFHHLWKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYAD-KHMNIDFDSFICCFVRLEGMF 701          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn3 (calpain 3 [Source:MGI Symbol;Acc:MGI:107437])

HSP 1 Score: 505.753 bits (1301), Expect = 6.157e-169
Identity = 276/659 (41.88%), Postives = 402/659 (61.00%), Query Frame = 2
Query:  296 LWEDPDFPADTSSVFVSKASKG--YREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFET 2227
            L+ED  FPA   ++   + S+    +   WKRPK+IC+NP+    G +R D+ QG LGDCW LA +A L+L E +   V+P DQ F +NY G F F+FWR+G WV+VV+DD LPTY  +LVF  S   NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  K+ P  +Y  M K  ++ +LMGC+I++    + E  MA GL+ GHAYS+T +++     G  V+LVR+RNPWG + EW G WSD   +W  + K EK RL      DGEFWM++DDF  +FTK+EIC+L  ++L  D    + W + + +G W +  +AGGCRNF D+F TNPQ+R+++++ DD+  ++    + ++ LMQK+ R+ R LG     IG+ IY++     G    L K FF ++ + A+S  +IN REV  R +LP   YVI+PST+ P++E  F+LR+FSEK+N S+E +             NT  VD      G    ++E+    ++    +F+ +AG    I A +L+++LN V+   KD+K  +GF LE CRSMIAL D D +G++   EF  LW  ++ W+  FK +D D +G  ++YE RNA+N+ G  +++ L+ +I  RY D     I F+ FI   +RL   F  
Sbjct:   50 LFEDRVFPAGVQALGSHELSQKAKMKAITWKRPKEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEI--KDAPSDMYKIMRKAIERGSLMGCSIDTIVPVQYETRMACGLVKGHAYSVTGLEEA-LFKGEKVKLVRLRNPWG-QVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADALESD--KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAE-------------NTISVDRPVPRPGHTDQESEE----QQQFRNIFRQIAGDDMEICADELKNVLNTVVNKHKDLKT-QGFTLESCRSMIALMDTDGSGRLNLQEFHHLWKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMN-IDFDSFICCFVRLEGMFRA 683          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn3 (calpain 3 [Source:MGI Symbol;Acc:MGI:107437])

HSP 1 Score: 494.582 bits (1272), Expect = 2.676e-164
Identity = 276/687 (40.17%), Postives = 402/687 (58.52%), Query Frame = 2
Query:  296 LWEDPDFPADTSSVFVSKASKG--YREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLK------------------------------KDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFET 2227
            L+ED  FPA   ++   + S+    +   WKRPK+IC+NP+    G +R D+ QG LGDCW LA +A L+L E +   V+P DQ F +NY G F F+FWR+G WV+VV+DD LPTY  +LVF  S   NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  K+ P  +Y  M K  ++ +LMGC+I++    + E  MA GL+ GHAYS+T +++     G  V+LVR+RNPWG + EW G WSD   +W  + K EK RL      DGEFWM++DDF  +FTK+EIC+L  ++L  D    + W + + +G W +  +AGGCRNF D+F TNPQ+R+++++ DD+  ++    + ++ LMQK+ R+ R LG     IG+ IY++     G    L K FF ++ + A+S  +IN REV  R +LP   YVI+PST+ P++E  F+LR+FSEK+N S+E +             NT  VD      G    ++E+    ++    +F+ +AG    I A +L+++LN V+                               KD+K  +GF LE CRSMIAL D D +G++   EF  LW  ++ W+  FK +D D +G  ++YE RNA+N+ G  +++ L+ +I  RY D     I F+ FI   +RL   F  
Sbjct:   50 LFEDRVFPAGVQALGSHELSQKAKMKAITWKRPKEICENPRFIIGGANRTDICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDDCLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFEI--KDAPSDMYKIMRKAIERGSLMGCSIDTIVPVQYETRMACGLVKGHAYSVTGLEEA-LFKGEKVKLVRLRNPWG-QVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADALESD--KLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPEDSEVICSFLVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINMREVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAE-------------NTISVDRPVPRPGHTDQESEE----QQQFRNIFRQIAGDDMEICADELKNVLNTVVNKRERPTPDVGDGQGPQLSESSSSPFSIPPDKDLKT-QGFTLESCRSMIALMDTDGSGRLNLQEFHHLWKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMN-IDFDSFICCFVRLEGMFRA 711          
BLAST of Calpain vs. Ensembl Mouse
Match: Capn2 (calpain 2 [Source:MGI Symbol;Acc:MGI:88264])

HSP 1 Score: 491.5 bits (1264), Expect = 1.356e-163
Identity = 280/697 (40.17%), Postives = 426/697 (61.12%), Query Frame = 2
Query:  224 MKKRDLDKQTLYSDILKQLKGTGKLWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQF--RXXXXXXXXXXXXNTGTVIIGLMQKD-MRQRNLG--FLVIGYVIYKLKDPNCGLLN----KSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEE----LFKVMAGPMEVINACQLRDILNAVLKK--DMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETM-ELQPQD 2248
            +K  + D +TL ++ L+     G L++DP FPA  SS+    +   S   R   WKRP +IC +PQ    G +R D+ QGALGDCWLLA +ASL+L E I   VVP DQ F +NY G F F+FW++G+WVEVVVDDRLPT  G+L+F+HSA+ +EFWSALLEKAYAK+ G YE+LSGG+  E  EDFTGG+ E  +L  ++ P  L+  + K  ++ +L+GC+I+   +A  E V    L+ GHAYS+T  ++V ++ G++ +L+R+RNPWG + EW GKW+D+ P W T+    +  L      DGEFWM+F DF ++++++EIC+L P++L  D    ++W++   DG+W +   AGGCRN+ ++F  NPQ+  ++E  D D+ED E   T ++GL+QK   RQR +G     IG+ IY++ +   G  N    K+FF  +    +S  FIN REV  R KLP G YV++PSTF P+++ +F +R+FSEK+                          D +AV  E++   E+I A E+D+++    LF  +AG    I+A +L+ IL  VL K  D+K+  GF +E C+ M+ + D+D +GK+   EF +LWT ++ ++  +++ D D +G  ++YE R AL   G  +   L +VI  R+ D E  +I F++F+  ++RL   F+   +L P++
Sbjct:   25 IKYLNQDYETLRNECLE----AGALFQDPSFPALPSSLGYKELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEILARVVPPDQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSALLEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYEL--RKPPPNLFKIIQKALEKGSLLGCSIDITSAADSEAVTYQKLVKGHAYSVTGAEEV-ESSGSLQKLIRIRNPWG-QVEWTGKWNDNCPSWNTVDPEVRANLTER-QEDGEFWMSFSDFLRHYSRLEICNLTPDTLTCD--SYKKWKLTKMDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGERGCTFLVGLIQKHRRRQRKMGEDMHTIGFGIYEVPEELTGQTNIHLGKNFFLTTRARERSDTFINLREVLNRFKLPPGEYVLVPSTFEPHKDGDFCIRVFSEKKA-------------------------DYQAVDDEIEANIEEIDANEEDIDDGFRRLFVQLAGEDAEISAFELQTILRRVLAKRQDIKS-DGFSIETCKIMVDMLDEDGSGKLGLKEFYILWTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKLPCQLHQVIVARFADDEL-IIDFDNFVRCLVRLETLFKIFKQLDPEN 683          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|P27730|CAN_SCHMA (Calpain OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 325/685 (47.45%), Postives = 449/685 (65.55%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFV-WKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFD-KNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGK--LVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESL--NEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQR-NLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGP-MEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFM 2287
            Y  ++K+LK    LWEDPDFPA+  ++        +RE + WKRP +I  N + FA G SRFD++QGALGDCWLLAVVAS+S Y  +F  VVP DQ+     Y+G  RFRFWRFG WVEV++DDRLP   G+  LVFMHS D  EFWSALLEKAYAK+ G Y  LSGGSQ EAMED TGG+C +++LN+KERP  L +Q+  +A++  LMGC+I+S+ +E  M NGLI  HAYS+T V  V    G    L+R+RNPWG+  EWKG W D SP+W  IS+ EK+ +  +F  DGEFWM+++DF   F+++E+CHLG ESL  N++  GKRR +  I  G W +N+NAGGC N   ++ T+PQFR+ V DPD +D +N  +V+IGLMQ D+R++    F  IG+++Y   D    LL+++     + IAKS  FIN REV  + ++P G YV+IPSTF+PN E NF+LR+FS+     +ELD +N          N  + DD   V   +K++ + +L  ++++E+ F  +  P    INA +L ++LN    +D+ NF+GF+ E+CRSM+A  D++ TG +E  EF+ LW   + WK  F   D D++G F AYEFR ALN+ G  VSN L   I NRY DP    I FEDF++ ++RL  AFET+E  P++ E   +F+AE+++
Sbjct:   86 YETLVKRLKTERTLWEDPDFPANDKAI---GNLPDFRERIEWKRPHEINPNAKFFAGGASRFDIEQGALGDCWLLAVVASISGYPQLFDQVVPKDQELKGPEYVGVVRFRFWRFGHWVEVLIDDRLPVRQGRNTLVFMHSNDPTEFWSALLEKAYAKLNGCYAHLSGGSQSEAMEDLTGGICLSLELNQKERPSDLIDQLKIYAQRCCLMGCSIDSSVMEQKMDNGLIGSHAYSLTGVYPVNYR-GRTQWLMRLRNPWGDSHEWKGAWCDGSPQWREISEQEKKNINLSFTADGEFWMSYEDFVTCFSRVEVCHLGLESLEYNQNFHGKRRLDEAIFSGQWQRNVNAGGCINNRTTYWTSPQFRITVEDPDPDDDDNKCSVLIGLMQTDIRKKVGADFQPIGFMVYNAPDDLNTLLSRAQLLTRSPIAKS-QFINTREVTAQFRVPPGSYVVIPSTFDPNIEVNFILRVFSQTSITEQELDEDN---------TNQGLPDD---VIEALKLE-DTLLDEDQEIEQKFLAIRDPKTNAINAVKLGELLNNSTLQDIPNFQGFNKELCRSMVASVDNNLTGHVELNEFMDLWIQAKGWKHIFIKHDVDQSGYFSAYEFREALNDAGYHVSNRLINAIINRYQDPGTDKISFEDFMLCMVRLKTAFETIEAHPKNIEGTSLFSAEDYL 752          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|Q9VT65|CANB_DROME (Calpain-B OS=Drosophila melanogaster OX=7227 GN=CalpB PE=1 SV=2)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 303/679 (44.62%), Postives = 421/679 (62.00%), Query Frame = 2
Query:  290 GKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK--IEGVMANGLISGHAYSITDVQKVKQTDGTV---VELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNED--LSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR-QRNLGF--LVIGYVIYKLKDPNCGLLNK--SFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFME 2290
            G ++EDPDFPA  +S+  S+    Y E  W RP DI  +PQ F +G SRFDVQQG LGDCWLLA  A+L+    +F  V+P DQDF +NY G F F+FW++GKWVEVV+DDRLPTY G+L++MHS + NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E   +  KE P  L++ M+K A++ ++MGC++E     +E     GLI GHAYSIT V  +  +       + ++R+RNPWGN+ EW G WSDSSPEW  I +  KE +  NF  DGEFWM+F DF  +F ++EIC+L P+SL ED   S +R+WEM + +G W   + AGGCRNF+++F  NPQ+ + + DPDDED +   T I+ LMQK+ R +RN+G   L IG+ IY L D +  +  +  +FFK+  ++A+SP FIN REVC R KLP GHY+I+PSTF+PNEE  F++R+FSE +N  +E D E G  E           DD  A +       E+       L  LF  +AG  E ++  +L+ IL+  ++  M    GF  +  RSM+A+ D D +G++ F EF  L T++  W+  FK +D    G  D +  R ALN+ G  ++N L   + +RY   E G I F+DF+M  I++    E    +  D      F  ++++E
Sbjct:  257 GTMFEDPDFPATNASLMYSRRPDRYYE--WLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIPPDQDFQENYAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTEWYDI--KEAPPNLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDISTPNRQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRRSKRNVGIDCLTIGFAIYHLTDRDMQVKPQGLNFFKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEFIIRVFSETRNNMEENDDEVGFGE----------TDDRIAPSLPPPTPKEEDDPQRIALRRLFDSVAGSDEEVDWQELKRILDHSMRDVMVGSDGFSKDAVRSMVAMLDKDRSGRLGFEEFEALLTDIAKWRAVFKLYDTRRTGSIDGFHLRGALNSAGYHLNNRLLNALAHRYGSRE-GQIPFDDFLMCAIKVRTFIEMFRERDTDNSDTAFFNLDDWLE 920          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|O35920|CAN9_RAT (Calpain-9 OS=Rattus norvegicus OX=10116 GN=Capn9 PE=2 SV=2)

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 298/692 (43.06%), Postives = 427/692 (61.71%), Query Frame = 2
Query:  206 QLKPTPMKKRDLDKQTLYSDILKQ-LKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL-KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNA---FETMELQPQD 2248
            Q +P P   R +       + L+Q    +G L+ED DFPA  SS+F S+  +    FVWKRP +I +NP+    G +R D+ QG LGDCWLLA +ASL+L +     VVP DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD+NEFWSALLEKAYAK+ G YE+L GGS IEAMEDFTGG+ E  ++  +E P   Y  + K  ++ +L+GC+I++   ++ E     GLI GHAY++T + +V    G  ++L+RVRNPWG + EW G WSDSSPEW ++S  E++RL     +DGEFWM F+DF  +F K+EIC+L P++L ++   K  WE+ I  GSW +   AGGCRNF+D+F TNPQ +  +   + ++ +   T +  LMQKD R+ +  G   L IGY IY+  D + G LN+ FF++  ++A+S  FIN REV GR +LP G Y++IPSTF P++EA+F LRIFSEK+  +++LD EN   ++ +  + T                 E+    E+    LF+ +AG    ++A +L  +LNAVL KK    FK   L  CR++I+L D    GKMEF EF + W  LR W   F  FD D++G   +YE R AL   G  + + L ++I  RY D EN  + F+D++  ++RL NA   F+ + ++ +D
Sbjct:   11 QPQPVPRDARTVHSSGHSFEQLRQSCLQSGTLFEDADFPASNSSLFYSERPQ--VPFVWKRPGEIVENPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVVPQDQGFGSGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENFQI--REAPEDFYEILEKALRRGSLLGCSIDTLNASESEARTPLGLIKGHAYTVTGLDQVN-FHGQRIKLIRVRNPWG-QVEWNGPWSDSSPEWRSMSLEEQKRLGHTALDDGEFWMAFEDFKTHFDKVEICNLTPDALEDNTLHK--WEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQIK--LSLTERDEGQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQCPDKD-GHLNRDFFRYHASLARSKTFINLREVSGRFQLPPGDYILIPSTFEPHQEADFCLRIFSEKKAVTQDLD-ENIDIDLPELPKPT---------------PQEEETEEERQFRALFRRIAGEDMEVSAEELEYVLNAVLQKKTALKFKRLSLLSCRNIISLMDTSGNGKMEFEEFRVFWDKLRYWMDLFLQFDVDKSGTMSSYELRTALKAAGFQLGSHLLQLIVLRYAD-ENLQLDFDDYLNCLVRLENASRVFQCLSVKNKD 674          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|O14815|CAN9_HUMAN (Calpain-9 OS=Homo sapiens OX=9606 GN=CAPN9 PE=1 SV=1)

HSP 1 Score: 535.798 bits (1379), Expect = 5.017e-180
Identity = 294/679 (43.30%), Postives = 414/679 (60.97%), Query Frame = 2
Query:  206 QLKPTPMKKRDLDKQ-TLYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLK-KDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNA 2218
            Q  P P   R        +  + ++    G L+ED DFPA  SS+F S+  +    FVWKRP +I KNP+    G +R D+ QG LGDCWLLA +ASL+L +     V+P DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD+NEFWSALLEKAYAK+ G YE+L GGS IEAMEDFTGG+ ET +   KE P   Y  + K  K+ +L+GC I++   A+ E     GLI GHAYS+T + +V    G  +EL+R+RNPWG + EW G WSDSSPEW ++  +E++RLC    +DGEFWM F DF  +F K+EIC+L P++L ED     +WE+ +  GSW +   AGGCRNF+D+F TNPQ +  +   + ++ +   + ++ LMQKD R+ +  G   L IGY IY+  D +   LNK FF++  + A+S  FIN REV  R KLP G Y++IPSTF P++EA+F LRIFSEK+  ++++D   G  +I       D+ +  +    + + +       E+    LF+ +AG    + A +L  +LNAVL+ K    FK   L  C+++I+L D    GK+EF EF + W  L+ W   F  FDAD++G    YE R AL   G  +S+ L ++I  RY D E   + F+DF+  ++RL NA
Sbjct:   11 QAHPVPKDARITHSSGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSERPQ--IPFVWKRPGEIVKNPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGPGYAGIFHFQFWQHSEWLDVVIDDRLPTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETFQT--KEAPENFYEILEKALKRGSLLGCFIDTRSAAESEARTPFGLIKGHAYSVTGIDQVS-FRGQRIELIRIRNPWG-QVEWNGSWSDSSPEWRSVGPAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDALEED--AIHKWEVTVHQGSWVRGSTAGGCRNFLDTFWTNPQIK--LSLTEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDKD-EHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMD---GNVDI-------DLPEPPKPTPPDQETEE------EQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYAD-EELQLDFDDFLNCLVRLENA 661          
BLAST of Calpain vs. UniProt/SwissProt
Match: sp|Q9D805|CAN9_MOUSE (Calpain-9 OS=Mus musculus OX=10090 GN=Capn9 PE=2 SV=2)

HSP 1 Score: 526.554 bits (1355), Expect = 2.040e-176
Identity = 291/692 (42.05%), Postives = 423/692 (61.13%), Query Frame = 2
Query:  206 QLKPTPMKKRDLDKQTLYSDILKQ-LKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL-KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNA---FETMELQPQD 2248
            Q +P P   R +       + L+Q    +G L+ED DFPA   S+F S+  +    FVWKRP +I + P+    G +R D+ QG LGDCWLLA +ASL+L +     VVP DQ F   Y G F F+FW+  +W++VV+DDRLPT+  +LVF+HSAD+NEFWSALLEKAYAK+ G YE+L GGS IEAMEDFTGG+ E  ++  +E P   +  + K  K+ +L+GC+I++   ++ E   + GLI GHAY++T + +V    G  ++L+RVRNPWG + EW G WSDSSPEW ++   E++RL     +DGEFWM F DF  +F K+EIC+L P++L +  S   RWE+ I  GSW +   AGGCRNF+D+F TNPQ +  +   + ++ +   T +  LMQKD R+ +  G   L IGY IY+  D + G L++ FF++  ++A+S  FIN REV  R +LP G Y++IPSTF P++EA+F LRIFSEK+  +++LD EN   ++ +  + T                 E+    E+    LF+ +AG    ++A +L  +LNAVL KK    FK   L  CR++I+L D    GK+EF EF + W  L+ W   F  FD D++G   +YE R AL   G  +   L ++I  RY D E+  + F+D++  ++RL NA   F+++ ++ +D
Sbjct:   11 QPQPVPGDARTIHSSGQSFEQLRQGCLQSGTLFEDADFPASNVSLFYSERPQ--VPFVWKRPGEIVEKPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALTRVVPQDQGFGSGYAGIFHFQFWQHSEWLDVVIDDRLPTFKDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAENFQI--REAPEDFFEILEKALKRGSLLGCSIDTLNASESEARTSLGLIKGHAYTVTGLDQVN-FHGQRIKLIRVRNPWG-QVEWNGPWSDSSPEWRSVDLEEQKRLGHTALDDGEFWMAFKDFKIHFDKVEICNLTPDALED--SALHRWEVTIHQGSWVRGSTAGGCRNFLDTFWTNPQIK--LSLTERDEGQEGCTFLAALMQKDRRRLKRFGANMLTIGYAIYQCPDKD-GHLSRDFFRYHASLARSKTFINLREVSERFQLPPGDYILIPSTFEPHQEADFCLRIFSEKRAVTRDLD-ENIDIDLPELPKPT---------------PQEEETEEEQQFRALFQRVAGEDMEVSAEELEYVLNAVLQKKTALKFKRLSLLSCRNIISLMDTSGNGKLEFEEFRVFWDKLKHWMDLFLQFDVDKSGTMSSYELRTALKAAGFQLGGHLLQLIVLRYAD-EDLQLDFDDYLNCLVRLENASRVFQSLSVKNKD 674          
BLAST of Calpain vs. TrEMBL
Match: A0A267GW14 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013791g1 PE=3 SV=1)

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 371/675 (54.96%), Postives = 477/675 (70.67%), Query Frame = 2
Query:  281 KGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSG----KRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ--RNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFM 2287
            K +G+L+EDPDFPAD  S++ S++   Y  F WKRPK+IC +P   +DGVSRFDV+QG LGDCWLLA VASLS+++ +F  VV  DQDF  NY G FRFRFW+FG+W +V +DDRLPT  GKL FM S D NEFWSALLEKAYAK+ G YE+LSGG+Q EAM DFTGGLCET  +  +  P  LYN M++     +LMGCAIES ++EG ++NGLI+GHAYS+TDV+KV+  +G    LVRVRNPWGNE EWKG WSD S +W ++S+ EK++L  +  +DGEFWM++ DF+ +F KIEICHLGPES++  + G    KRRWEMC+E G W +N++AGGCRN IDSF  N QFR+E+VDPD++D EN GT+I+GLMQKD+R+  +   FL IGY IY +KDPN   L++ FF+F+  + KSP F+NQREVCGRHKLP GHYVIIPSTF+PNEEA F+LRIFSEK N+S  LD  N            D V DG  V G  +  +  ++  E+ L++ F   AG M  I+A QL+ ILN    +++K F+GF LE CRSM+AL D + +G MEF EF  LW  +R+ KT FK++DAD NG FD++E R AL   G  + N +F+ +  RY DPE G + FEDFI+  IRL  AFET +  P+  E   V   + F+
Sbjct:  100 KLSGRLFEDPDFPADNRSIYPSRS---YSRFEWKRPKEICSDPLFISDGVSRFDVKQGELGDCWLLAAVASLSMHKKLFDQVVVPDQDFGANYCGMFRFRFWQFGEWKDVEIDDRLPTKYGKLCFMRSEDRNEFWSALLEKAYAKLNGSYEALSGGNQAEAMVDFTGGLCETFDM--RRAPPNLYNIMVQANNACSLMGCAIESEQLEGHLSNGLITGHAYSVTDVKKVRLNNGMEESLVRVRNPWGNECEWKGDWSDHSHKWSSVSQGEKDKLGMDQRDDGEFWMSYKDFSSHFNKIEICHLGPESMSSSVKGEAAKKRRWEMCLESGQWKRNVSAGGCRNNIDSFHMNEQFRIEIVDPDEDDDENMGTIIVGLMQKDIRKILKGADFLTIGYAIYSIKDPNIPPLDQKFFRFTRQVDKSPSFVNQREVCGRHKLPPGHYVIIPSTFSPNEEAEFILRIFSEKPNESGVLDTPN----------RMDNVVDG--VYG--RKHHNTVMENEEPLKKAFMEFAGSMAKIHAKQLQQILNRSFGREIKEFQGFSLEACRSMLALVDANMSGFMEFDEFKHLWNEIRLLKTIFKEYDADGNGYFDSFELRGALRVAGYNLCNKVFESVAMRYMDPEQGRVCFEDFILLSIRLKTAFETYKAMPKTNEGFGVVKQDHFL 755          
BLAST of Calpain vs. TrEMBL
Match: A0A1I8GXB3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 371/675 (54.96%), Postives = 477/675 (70.67%), Query Frame = 2
Query:  281 KGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSG----KRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ--RNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFM 2287
            K +G+L+EDPDFPAD  S++ S++   Y  F WKRPK+IC +P   +DGVSRFDV+QG LGDCWLLA VASLS+++ +F  VV  DQDF  NY G FRFRFW+FG+W +V +DDRLPT  GKL FM S D NEFWSALLEKAYAK+ G YE+LSGG+Q EAM DFTGGLCET  +  +  P  LYN M++     +LMGCAIES ++EG ++NGLI+GHAYS+TDV+KV+  +G    LVRVRNPWGNE EWKG WSD S +W ++S+ EK++L  +  +DGEFWM++ DF+ +F KIEICHLGPES++  + G    KRRWEMC+E G W +N++AGGCRN IDSF  N QFR+E+VDPD++D EN GT+I+GLMQKD+R+  +   FL IGY IY +KDPN   L++ FF+F+  + KSP F+NQREVCGRHKLP GHYVIIPSTF+PNEEA F+LRIFSEK N+S  LD  N            D V DG  V G  +  +  ++  E+ L++ F   AG M  I+A QL+ ILN    +++K F+GF LE CRSM+AL D + +G MEF EF  LW  +R+ KT FK++DAD NG FD++E R AL   G  + N +F+ +  RY DPE G + FEDFI+  IRL  AFET +  P+  E   V   + F+
Sbjct:   95 KLSGRLFEDPDFPADNRSIYPSRS---YSRFEWKRPKEICSDPLFISDGVSRFDVKQGELGDCWLLAAVASLSMHKKLFDQVVVPDQDFGANYCGMFRFRFWQFGEWKDVEIDDRLPTKYGKLCFMRSEDRNEFWSALLEKAYAKLNGSYEALSGGNQAEAMVDFTGGLCETFDM--RRAPPNLYNIMVQANNACSLMGCAIESEQLEGHLSNGLITGHAYSVTDVKKVRLNNGMEESLVRVRNPWGNECEWKGDWSDHSHKWSSVSQGEKDKLGMDQRDDGEFWMSYKDFSSHFNKIEICHLGPESMSSSVKGEAAKKRRWEMCLESGQWKRNVSAGGCRNNIDSFHMNEQFRIEIVDPDEDDDENMGTIIVGLMQKDIRKILKGADFLTIGYAIYSIKDPNIPPLDQKFFRFTRQVDKSPSFVNQREVCGRHKLPPGHYVIIPSTFSPNEEAEFILRIFSEKPNESGVLDTPN----------RMDNVVDG--VYG--RKHHNTVMENEEPLKKAFMEFAGSMAKIHAKQLQQILNRSFGREIKEFQGFSLEACRSMLALVDANMSGFMEFDEFKHLWNEIRLLKTIFKEYDADGNGYFDSFELRGALRVAGYNLCNKVFESVAMRYMDPEQGRVCFEDFILLSIRLKTAFETYKAMPKTNEGFGVVKQDHFL 750          
BLAST of Calpain vs. TrEMBL
Match: A0A267DE36 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013791g4 PE=3 SV=1)

HSP 1 Score: 728.783 bits (1880), Expect = 0.000e+0
Identity = 370/675 (54.81%), Postives = 475/675 (70.37%), Query Frame = 2
Query:  281 KGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSG----KRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ--RNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFM 2287
            K +G+L+EDPDFPAD  S++ S++   Y  F WKRPK+IC +P   +DGVSRFDV+QG LGDCWLLA VASLS+++ +F  VV  DQDF  NY G FRFRFW+FG+W +V +DDRLPT  GKL FM S D NEFWSALLEKAYAK+ G YE+LSGG+Q EAM DFTGGLCET  +  +  P  LYN M++     +LMGCAIES ++EG ++NGLI+GHAYS+TDV+KV+  +G    LVRVRNPWGNE EWKG WSD S +W ++S+ EK++L  +  +DGEFWM++ DF+  F KIEICHLGPES++  + G    KRRWEMC+E G W +N++AGGCRN IDSF  N QFR+E+VDPD++D EN GT+I+GLMQKD+R+  +   FL IGY IY +KDPN   L++ FF+F+  + KSP F+NQREVCGRHKLP GHYVIIPSTF+PNEEA F+LRIFSEK N+S  LD  N            D V DG  V G  +  +  ++  E+ L++ F   AG    I+A QL+ ILN    +++K F+GF LE CRSM+AL D + +G MEF EF  LW  +R+ KT FK++DAD NG FD++E R AL   G  + N +F+ +  RY DPE G + FEDFI+  IRL  AFET +  P+  E   V   + F+
Sbjct:  100 KLSGRLFEDPDFPADNRSIYPSRS---YSRFEWKRPKEICSDPLFISDGVSRFDVKQGELGDCWLLAAVASLSMHKKLFDQVVVPDQDFGANYCGMFRFRFWQFGEWKDVEIDDRLPTKYGKLCFMRSEDRNEFWSALLEKAYAKLNGSYEALSGGNQAEAMVDFTGGLCETFDM--RRAPPNLYNIMVQANNACSLMGCAIESEQLEGHLSNGLITGHAYSVTDVKKVRLNNGMEESLVRVRNPWGNECEWKGDWSDHSHKWSSVSQGEKDKLGMDQRDDGEFWMSYKDFSSQFNKIEICHLGPESMSSSVKGEAAKKRRWEMCLESGQWKRNVSAGGCRNNIDSFHMNEQFRIEIVDPDEDDDENMGTIIVGLMQKDIRKILKGADFLTIGYAIYSIKDPNIPPLDQKFFRFNRQVDKSPSFVNQREVCGRHKLPPGHYVIIPSTFSPNEEAEFILRIFSEKPNESGVLDTPN----------TMDNVVDG--VYG--RKHHSTVMENEEPLKKAFMEFAGSTAKIHAKQLQQILNRSFGREIKEFQGFSLEACRSMLALVDANMSGFMEFDEFKHLWNEIRLLKTIFKEYDADGNGYFDSFELRGALRVAGYNLCNKVFESVAMRYMDPEQGRVCFEDFILLSIRLKTAFETYKAMPKTNEGFGVVKQDHFL 755          
BLAST of Calpain vs. TrEMBL
Match: A0A267EIH1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019924g1 PE=3 SV=1)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 357/688 (51.89%), Postives = 477/688 (69.33%), Query Frame = 2
Query:  272 KQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDF-DKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES--AKIEGVMANGLISGHAYSITDVQKVK---QTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSG-----KRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRN---LGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMES 2293
            K+L    +L+EDPDFPA   S+F S+     R F WKRP ++C NP+ F  G SRFDV+QG LGDCWLLA VASLS++  +F  VVP DQDF D +Y G  RFRFW+FG+W +V+VDDRLPTY  +LVFMHS D+NEFWSALLEKAYAKM G YE+L GGS  EAMEDFTGG+ E   L +   P  L+  M+K  K+S+LMGC+IE+   +IE  ++NGLI GHAYSITDVQ V+   +     V+L+R+RNPWGNE EWKG W DSSPEW  +S+ EK+++  +F +DGEFWM+F DF  NF K+EICHLGP+SLNE+  G     KRRWE    + +W K ++AGGCRN++D+F TNPQFRV+V+DPD++D EN G++I+GLMQK+MR++    L    IGY IY++KD +   L+  FFK + ++AK+P FIN REVCGRHKL  G YVI+PSTF PN+EA F+LRI+SE +N+S E+D           +   + V   R  T + K       A EK L+E F+ +AG    ++A +LRDI+N   +K+ K F GF +E CRSM+AL D D +GK+ F EF  LW +LR+WKT FK +D+D++G F++YE R ALN VG  V+N +F  +  RY   E G+I+F+D+++  +RL   FET + QP+D +    F+ EEF+++
Sbjct:   43 KELSSKKQLYEDPDFPAQPKSIFYSRQPP--RPFEWKRPHELCDNPRFFVGGASRFDVRQGELGDCWLLAAVASLSMHPQLFDLVVPQDQDFTDADYCGVVRFRFWQFGEWTDVLVDDRLPTYNNRLVFMHSTDSNEFWSALLEKAYAKMMGSYEALKGGSASEAMEDFTGGITEFYDLRQNT-PPSLFQTMVKANKRSSLMGCSIEADPNQIEAQLSNGLIMGHAYSITDVQTVEVNLRGKKGAVQLLRIRNPWGNEAEWKGAWGDSSPEWSILSEDEKKKMGLSFDDDGEFWMSFQDFCSNFQKLEICHLGPDSLNEEQLGAPDKNKRRWEALTHNSAWRKRVSAGGCRNYLDTFWTNPQFRVKVIDPDEDDDENKGSIIVGLMQKNMRKKRSEGLDLHTIGYAIYRIKDGDDRPLDLKFFKCTASVAKAPAFINLREVCGRHKLDPGTYVIVPSTFEPNQEAEFLLRIYSETKNESGEMD----------DVTTVEEVQPDREPTAQEK-------AQEKALKEAFQKIAGEDMEVDAYELRDIVNTAFQKEFK-FDGFSVETCRSMVALMDVDQSGKLGFDEFKTLWNDLRLWKTVFKKYDSDKSGNFNSYELRQALNAVGFRVNNKIFSCLVMRYATRE-GIIEFDDYVLCCVRLKTVFETFKAQPKDGQGKATFSQEEFLQT 708          
BLAST of Calpain vs. TrEMBL
Match: A0A1I8HRD3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 701.819 bits (1810), Expect = 0.000e+0
Identity = 356/688 (51.74%), Postives = 477/688 (69.33%), Query Frame = 2
Query:  272 KQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDF-DKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES--AKIEGVMANGLISGHAYSITDVQKVK---QTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSG-----KRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRN---LGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMES 2293
            K+L    +L+EDPDFPA   S+F S+     R F WKRP ++C NP+ F  G SRFDV+QG LGDCWLLA VASLS++  +F  VVP DQDF D +Y G  RFRFW+FG+W +V+VDDRLPTY  +LVFMHS D+NEFWSALLEKAYAKM G YE+L GGS  EAMEDFTGG+ E   L +   P  L+  M+K  K+S+LMGC+IE+   +IE  ++NGLI GHAYSITDV+ V+   +     V+L+R+RNPWGNE EWKG W DSSPEW  +S+ EK+++  +F +DGEFWM+F DF  NF K+EICHLGP+SLNE+  G     KRRWE    + +W K ++AGGCRN++D+F TNPQFRV+V+DPD++D EN G++I+GLMQK+MR++    L    IGY IY++KD +   L+  FFK + ++AK+P FIN REVCGRHKL  G YVI+PSTF PN+EA F+LRI+SE +N+S E+D           +   + V   R  T + K       A EK L+E F+ +AG    ++A +LRDI+N   +K+ K F GF +E CRSM+AL D D +GK+ F EF  LW +LR+WKT FK +D+D++G F++YE R ALN VG  V+N +F  +  RY   E G+I+F+D+++  +RL   FET + QP+D +    F+ EEF+++
Sbjct:   43 KELSSKKQLYEDPDFPAQPKSIFYSRQPP--RPFEWKRPHELCDNPRFFVGGASRFDVRQGELGDCWLLAAVASLSMHPQLFDLVVPQDQDFTDADYCGVVRFRFWQFGEWTDVLVDDRLPTYNNRLVFMHSTDSNEFWSALLEKAYAKMMGSYEALKGGSASEAMEDFTGGITEFYDLRQST-PPSLFQTMVKANKRSSLMGCSIEADPNQIEAQLSNGLIMGHAYSITDVRTVEVNLRGKKGAVQLLRIRNPWGNEAEWKGAWGDSSPEWSILSEDEKKKMGLSFDDDGEFWMSFQDFCSNFQKLEICHLGPDSLNEEQLGAPDKNKRRWEALTHNSAWRKRVSAGGCRNYLDTFWTNPQFRVKVIDPDEDDDENKGSIIVGLMQKNMRKKRSEGLDLHTIGYAIYRIKDGDDRPLDLKFFKCTASVAKAPAFINLREVCGRHKLDPGTYVIVPSTFEPNQEAEFLLRIYSETKNESGEMD----------DVTTVEEVQPDREPTAQEK-------AQEKALKEAFQKIAGEDMEVDAYELRDIVNTAFQKEFK-FDGFSVETCRSMVALMDVDQSGKLGFDEFKTLWNDLRLWKTVFKKYDSDKSGNFNSYELRQALNAVGFRVNNKIFSCLVMRYATRE-GIIEFDDYVLCCVRLKTVFETFKAQPKDGQGKATFSQEEFLQT 708          
BLAST of Calpain vs. Ensembl Cavefish
Match: zgc:55262 (calpain-1 catalytic subunit-like [Source:NCBI gene;Acc:103042634])

HSP 1 Score: 499.975 bits (1286), Expect = 6.811e-167
Identity = 275/668 (41.17%), Postives = 401/668 (60.03%), Query Frame = 2
Query:  296 LWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK---IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQR---NLGFLVIGYVIYKLKDPNCGL----LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLK--KDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEE 2254
            L+ED  FPA +SS+    +   S   +   WKRP +IC  PQ   DG +R D+ QGALGDCWLLA +ASL+L + +   VVP  Q F   Y G F F+FW+FG+W++VV+DDRLP   GKL+F+HSA+  EFWSAL+EKAYAK+ G YE+LSGGS  E  EDFTGG+ E  +L  K+ P  LYN + +   + +L+GC+I+      +E V    L+ GHAYS+T V +V    GT  +LVR+RNPWG E EW G WSD+S EW+++  S + RL    + DGEFWM+F DF + F+++EIC+L  ++L  +    ++W  C+ +G W +   AGGCRNF  +F  NPQF+V +  PD   S +  + ++ LMQKD R++         IG+ IY++     G     L + FF  + + A+S  FIN REV  R +LP G Y+I+PSTF P +EA+F+LR+FSEK   ++ELD      ++   L + + +D+ +   G                + LF+ +AG    I+  +L+ ILN ++   KD+K   GF  E CRSMI L D D +GK+   EF +LW  ++ + T F+ FD D++G   +YE R AL   G  ++N LF++I  RYT+ E+  + F++F+  ++RL   F+T +    D +
Sbjct:   50 LFEDSLFPASSSSLGFNELGPRSSKTQGVQWKRPPEICSRPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDNLLHRVVPHGQSFGSGYAGIFHFQFWQFGEWMDVVIDDRLPVKDGKLLFVHSAEGGEFWSALVEKAYAKLNGCYEALSGGSTSEGFEDFTGGVTEMYEL--KKAPSDLYNIIQRAVDRGSLLGCSIDITSKFDMEAVTFKKLVKGHAYSVTAVHEVVYR-GTPTKLVRIRNPWG-EVEWTGAWSDNSREWDSVDSSSRARLQVR-SEDGEFWMSFRDFLQEFSRLEICNLTADAL--EAGQVKKWSTCLYNGEWRRGSTAGGCRNFPATFWLNPQFKVNLTHPDKAGSSDC-SFLVALMQKDRRKKRKEGKDMETIGFAIYEVPGQYVGQSGVHLKRDFFLTNASSARSELFINLREVSSRFRLPAGEYIIVPSTFEPQKEADFVLRVFSEKPASAEELD-----DDVTAELPSENQLDESQIDAG---------------FKSLFRQLAGSDMEISVTELQTILNRIISKHKDLKT-DGFGPEACRSMINLMDTDGSGKLGLTEFHVLWEKIKRYLTVFRQFDLDKSGTMSSYEMRMALEAAGFKLTNHLFQLIILRYTE-EDLTVDFDNFVTCLVRLETMFKTFKTLDTDAD 687          
BLAST of Calpain vs. Ensembl Cavefish
Match: capn1a (calpain-1 catalytic subunit-like [Source:NCBI gene;Acc:103024720])

HSP 1 Score: 479.945 bits (1234), Expect = 4.022e-159
Identity = 264/665 (39.70%), Postives = 404/665 (60.75%), Query Frame = 2
Query:  290 GKLWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGL----LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETME 2233
            G L+EDP FPA+  S+    +   S       W RP ++C +PQ    G +R D+ QGALGDCWLLA +ASL+L E +   VVP  Q F  +Y G F F+FW+FG+WV++V+DDRLP   G+L+F+HSA+ NEFWSAL+EKAYAK+ G YE+LSGGS  E  EDFTGG+ E  +L  ++ P  LY  + K  +  +L+GC+I+   +  +E V    L+ GHAYS+T +++V    G +  L+R+RNPWG + EW G WSD+S EW+ I  +E+E LC     DGEFWM+F++F + F+++EIC+L P++L++D  G   W      GSW +   AGGCRN  ++F  NPQ+++ +++ DD+  ++    + ++ L+QKD R+ R  G     IG+ +Y++ +   G     L K+FF   ++ A+S  FIN REV  R +LP G Y+I+PSTF P++EA+F+LR+F+EKQ++++ELD      EI+  L                  +      ++   + +F  +AG    I+  +LR ILN V+   KD+K   GF +E CR+M+ L D D + ++   EF +LW  +R W   ++ FD D++G   +YE R A+ + G  ++N L +++  RY   EN VI F++FI  +++L   F + +
Sbjct:   46 GFLFEDPCFPAEPPSLGFKELGPHSSKTSGVEWMRPTELCDDPQFILGGATRTDICQGALGDCWLLAAIASLTLNEKLLHRVVPHGQSFQDDYAGIFHFQFWQFGEWVDIVIDDRLPVKDGELMFVHSAEGNEFWSALIEKAYAKLNGSYEALSGGSTTEGFEDFTGGVSEMYEL--RKPPRDLYRIISKALELGSLLGCSIDITSTFDMEAVTFKKLVKGHAYSVTGLRQVN-FRGDLQRLIRIRNPWG-QVEWTGAWSDNSSEWDEIDPTEREDLCLQM-EDGEFWMSFNEFLRQFSRLEICNLTPDALSDD--GLSHWNTIQFHGSWRRGSTAGGCRNHPNTFWINPQYKITLLEEDDDPEDDEVACSFLVALLQKDRRRYRRQGQDMHTIGFAVYEIPEEFRGCQNVHLKKNFFLSHSSCARSETFINLREVSARLRLPPGEYLIVPSTFEPSKEADFVLRVFTEKQSETEELD-----DEISADL---------------EDEEEITEDDIDDSFKSMFAQLAGEDMEISVHELRTILNRVVLRHKDLKT-DGFSMESCRTMVNLMDKDGSARLGLVEFQILWNKIRKWLVIYRQFDLDKSGTMSSYEMRLAVESAGFKLNNRLNQILVARYA--ENEVIDFDNFICCLVKLEAMFRSFQ 680          
BLAST of Calpain vs. Ensembl Cavefish
Match: capn3b (calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149])

HSP 1 Score: 480.715 bits (1236), Expect = 4.029e-159
Identity = 273/659 (41.43%), Postives = 398/659 (60.39%), Query Frame = 2
Query:  296 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDG--TVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN---TGTVIIGLMQKD-MRQRNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFK--GFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETME 2233
            L++DP FPAD SS++ ++  K   + VWKRP +ICKNPQ    G +R D+ QG LGDCWLLA +A L+L E +   VVP DQ F +NY G F F+FWR+G+WV+VVVDDRLPT    LVF  S + NEFWSALLEKAYAK+ G YE+L GG+ +EAMEDFTGG+ E  ++++  R +  YN M K   + +LMGC+I+S   +  E     GL+ GHAYS+T V++ KQ DG  T + LVR+R+PWG         S  S +W +++ SE+++        GEFWM F++F + FTK+EIC+L P++L +D   K  W++ + +G W +  +AGGCRN+ D+F TNPQ+R+ + + DD++ ++     TV++ LMQK   R+R  G   L IG+ IY++   N   L K FF ++ + A+   +IN REV  R  L  G YVI+PSTF+PN E++F+LR+FSEK + S          E++  +   D           +    ++    EK    +F+ +AG    INA +LR + N +L K  K  K  GF L+ CRSMIAL D D TG++   EF  LW+ ++ WK  F  +D D++    ++E RNA+ + G  ++  L  +I  RY   E+  + F+ +I  ++RL   F   +
Sbjct:   79 LFKDPLFPADDSSLYYNQ--KFPLKLVWKRPSEICKNPQFIVGGANRTDICQGDLGDCWLLAAIACLTLSETLLYRVVPADQSFSENYAGIFHFQFWRYGEWVDVVVDDRLPTSNNHLVFTRSGNKNEFWSALLEKAYAKLHGTYEALKGGNTLEAMEDFTGGVTEFYEISDAPREI--YNIMKKALNRGSLMGCSIDSLVPSASETKTDTGLVRGHAYSVTAVEQGKQEDGSDTRIRLVRLRDPWGVAP----PPSRMSCDWSSLATSEQDQQRLKPVEAGEFWMGFEEFQQTFTKLEICNLTPDALQDDELLK--WDVSVNEGRWVRGCSAGGCRNYPDTFWTNPQYRLRLTEEDDDEPDHGEKGCTVVVALMQKGRRRERCTGGTLLTIGFAIYEMHG-NKQHLPKDFFLYTASKARCKSYINLREVTERFCLSPGEYVIVPSTFDPNNESDFILRVFSEKTSTS----------ELSGAVIEADPC--------VLPKSEDEESDEEKQFRAMFQQIAGDDMQINAKELRSVFNKLLTK-YKGLKTEGFSLDSCRSMIALMDTDGTGRLNLEEFKHLWSKIQQWKLIFSRYDRDKSSSISSFEMRNAVADAGFQLNPQLHDIIAMRYAS-EHLYLDFDSYICCLVRLEGMFRAFK 706          
BLAST of Calpain vs. Ensembl Cavefish
Match: si:dkeyp-50d11.2 (si:dkeyp-50d11.2 [Source:ZFIN;Acc:ZDB-GENE-091113-22])

HSP 1 Score: 476.863 bits (1226), Expect = 7.081e-158
Identity = 271/674 (40.21%), Postives = 395/674 (58.61%), Query Frame = 2
Query:  293 KLWEDPDFPADTSSVFVSKASKG---YREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAK---IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGL----LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVF 2269
            +L+ED  FPA  SS+   + + G    R   W RP + C +P    DG +R D+ QGALGDCWLLA +A L+L EP+   VVP  Q F   Y G F F+FW+FG WV+VV+DDRLP   GKL+F+HS +  EFWSAL+EKAYAK+ G YE+LSGG   E  EDFTGG+ E  +L  ++ P  L++ + +  ++ +L+GC+I+      +E V    L+ GHAYS+T V +V +  G + +L+R+RNPWG E EW G WSD S EW  I+ + + RL  N A DGEFWM+F DF K F+++EIC+L  ++L    S  ++W   +  G W +   AGGCRN+  +F  NPQ+++ + DPD E  +   + ++ LMQK+ RQ R  G     IG+ IY++     G+    L + FF  +T+ A+S  FIN REV  R  LP G Y+I+PSTF P +E +F+LR+FSEK   S+ELD      E+   L   D + +                 +++  + LF  +AG    I+  +L+ ILN V+   KD+K   GF  E CR MI+L D    G++   +F +LW  ++ + T F++FD D++G   +YE R AL + G  ++N LF++I  RY  P+  V  F++F+  +IRL + F+T      D +    F
Sbjct:   49 RLFEDETFPAQPSSLGFKELAPGSAKTRGVRWMRPTEFCDDPHFIVDGATRTDICQGALGDCWLLAAIACLTLNEPLLHRVVPHGQSFHYQYAGIFHFQFWQFGDWVDVVIDDRLPVRDGKLLFVHSDEGAEFWSALVEKAYAKLNGCYEALSGGCTSEGFEDFTGGVTEMYEL--RKAPPNLFSIIRRAVERGSLLGCSIDITSFFDMEAVTFKKLVKGHAYSVTGVDEV-EFRGNLTKLIRIRNPWG-EVEWTGAWSDESREWSGINPALRSRL-HNRAEDGEFWMSFSDFLKEFSRLEICNLTADALQS--SELKKWNSSLYTGEWRRGSTAGGCRNYPATFWINPQYKIMLKDPDTEGQDGC-SFLVALMQKNRRQLRREGKDMETIGFAIYEVPLQFLGMAGVHLKRDFFLTNTSSARSELFINLREVSSRFCLPAGEYIIVPSTFEPQKEGDFVLRVFSEKAADSQELD-----DELTADLPEEDALPESE---------------IDEGFKALFAKLAGKDMEIDVPKLQMILNRVISKHKDLKT-DGFGKEACRCMISLMDTSGCGRLGLTDFHVLWEKIKRYLTIFREFDLDKSGTMSSYEMRLALESAGFKLTNNLFQLIILRYAKPDLNV-DFDNFVTCLIRLESMFKTFRTMDTDADGVVTF 692          
BLAST of Calpain vs. Ensembl Cavefish
Match: capn9 (calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2])

HSP 1 Score: 471.085 bits (1211), Expect = 2.059e-156
Identity = 272/661 (41.15%), Postives = 392/661 (59.30%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKD---MRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAF 2221
            Y ++ ++     KL+EDPDFPA  SS+F S+A      F WKRP +ICK+P+    G  R D+ QG LGDCWLLA +ASL+L++     V+  DQ FD+          W     + VVVDDRLP    +LVF+HSADNNEFWSALLEKAYAK+ G YE+L GGS +E MEDFTGG+ E  +   K+ P  LY  + K   + ++MGC+I+   SA+ E   A+GL+ GHAYSIT + +V    G  V+L+RVRNPWG + EW G WSD+S EW  + K+EK R+  N  +DGEFWM F+DF  N+ ++EIC+L P+SL +D   K++W + + +G+W +   AGGCRNFID+F TNPQF+   +  +D D +   +VI+ LMQK+   +R+  L    IG+ IY+  +     L K FF+F+++ A+S  +IN RE+  R  L  G Y+++P+TF P+ EA+F LR+FSE +               A+ + +T            +    E+    EK L  LF+ +AG + +I       +      K++K F G  L  C S+I L D D++G +EF EF + W  L+ W   F  +D D +G   +YE R AL  VG+ ++NTL ++I  R+ D +   I F+D++  ++RL N F
Sbjct:   27 YEELRQECLKKNKLFEDPDFPACDSSLFFSQAVP--VNFEWKRPGEICKDPKYILGGADRTDICQGQLGDCWLLAAIASLTLHKETLARVIQPDQSFDRGIC-------WHLP--LPVVVDDRLPCVRNQLVFLHSADNNEFWSALLEKAYAKLNGSYEALKGGSTLEGMEDFTGGVGEMYE--TKKAPSDLYTILKKALDRGSMMGCSIDITSSAESEAQTASGLVKGHAYSITGLTEVDYI-GKKVKLIRVRNPWG-QVEWNGPWSDNSREWSGVDKAEKTRVLENSTDDGEFWMEFEDFKANYDRVEICNLTPDSLMDDT--KKKWVVNVLEGNWIRGSTAGGCRNFIDTFWTNPQFK---LKLEDADGDGRCSVIVALMQKNRRKLRKEGLDLETIGFAIYQAPNDE-DHLEKDFFRFNSSKARSRTYINMREISERFSLEPGSYLVVPTTFQPHIEADFALRVFSESK---------------AEAMYST-------FPAPPMPSPPEEETPEEKGLRSLFEQIAGSVRLI-------LYFIYFWKEIK-FDGLTLNTCHSIINLMDVDNSGMIEFQEFKVFWEKLKKWMMLFLSYDTDRSGRMSSYELRLALKAVGIQLNNTLLQLICLRFADKKME-IDFDDYLTCIVRLENMF 635          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: capn9 (calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2])

HSP 1 Score: 503.442 bits (1295), Expect = 7.802e-171
Identity = 260/585 (44.44%), Postives = 367/585 (62.74%), Query Frame = 2
Query:  377 WKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRF--RFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXX---XXXXXXXNTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMK-NFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVG 2104
            W   ++I +NP+   DG +R D++QGALGDCWLLA +ASL+L + +   VVP  Q+F   Y G F F  +FW FG+W++V +DDRLPT  G+LVF+HSAD  EFWSALLEKAY+K+ G YE+L GGS  EAMEDFTGG+ E + L  K  P  L+  M K  ++ ++MGC+I+   +++ E   +NGL+ GHAYSIT V +V    G  V+L+R+RNPWG E EW G WSD +PEW+ + + E+ RL    A DGEFWM+FDDF ++FTK+EIC+L P+ +  +    R W + + DG W K   AGGCRNF ++F TNPQFR+++ +     DE      + I+ LMQK+MR++    L +GY IYK+ D   G + K FF ++ + A+SP FIN REV  R +LP G YVI+PSTF P++EA+F++R+F+EK N+SKE D      +I   +   D+   G     + K K             LF  +AG    I+  +L+D+LN +  K  +    GF +  CRS++AL D D +GK+   EF +LW  ++ W+  F+  D D +G   +YE +NALN  G
Sbjct:    4 WGLSREIVQNPEFIVDGATRTDIKQGALGDCWLLAAIASLTLNDQLLAKVVPPGQNFRDGYAGIFHFQQKFWHFGEWMDVFIDDRLPTKNGQLVFVHSADKREFWSALLEKAYSKLNGSYEALKGGSIAEAMEDFTGGVYELLDL--KTAPPDLFRIMCKARQKGSMMGCSIDVTNASESEARTSNGLVKGHAYSITGVDEVNYR-GQKVKLLRIRNPWG-EVEWNGAWSDHAPEWKALDQGERNRLQQVMAEDGEFWMSFDDFMRHFTKMEICNLTPDRVERE-GDPRYWTVTVHDGRWLKGCTAGGCRNFPETFWTNPQFRLKLHNEDDEADETGSKACSFIVALMQKNMRKQQRNMLTMGYAIYKIPD-QTGPMPKEFFLYNASKARSPSFINLREVSQRFRLPAGEYVIVPSTFEPHQEADFLVRVFAEKPNRSKESD-----DKIGAEIDLNDVAKPGTETEDDRKFKT------------LFGRLAGEDMEISPKELQDMLNKITAKHGELESTGFSMHACRSIVALTDVDGSGKLGLQEFRILWNKIKKWQAIFRKHDEDLSGTMSSYEMKNALNAAG 565          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003998.1 (pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 gene:ENSPMAG00000003440.1 transcript:ENSPMAT00000003998.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 497.278 bits (1279), Expect = 3.429e-166
Identity = 282/716 (39.39%), Postives = 394/716 (55.03%), Query Frame = 2
Query:  380 KRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCE---------------------------------TIKLNEKERPVGLYNQMLKFAKQST-------------------LMGCAIESAK---IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQF--RXXXXXXXXXXXXNTGTVIIGLMQKDMRQRNLGFLVIGYVIYKL---KDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTE--------------------------IAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKD----LEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFK--GFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDE 2251
            + P++IC NPQ   +G +R D++QGALGDCWLLA +ASL+L+  +   VVP  Q F   Y G F F+FW+FG+WV+VV+DD LPT   KL F+HS D NEFWSALLEKAYAK+ G YE+L GGS  EAMEDFTGG+ E                                 T K     R + +      F   S+                   L    IE      +E  + NGL+ GHAYSIT + +V   +G  V LVR+RNPWG E EW G WSD+S EW  +  SE+ RL    A DGEFWM+F DF +NF+K+EIC+L P++L    SG R W +   +G W +   AGGCRN+  +F TNPQF  R+   D D +D E   + I+ LMQK+MR++    L IGY IY++     P C  L   FF  +++ A+S  FIN REV  R +LP GHYVI+PST+ P++EA+F+LR++ EK N+S+     N  ++                          + +H+ +  +  +   V GE    +  +  +E D      ++FK +AG    I+  +L+D+LN V  K +K FK  GF L  C+SM+AL D D +GK+  PEF LLW  +++W+  F+ +D D +G   +YE R ALN  G  ++N ++++I  RY D E+  IKF D+I  ++RL   F       +D+
Sbjct:    1 RAPQEICYNPQFIVNGATRTDIKQGALGDCWLLAAIASLTLHPRLLARVVPEGQSFSDGYAGIFHFQFWQFGEWVDVVIDDLLPTQNNKLAFLHSTDRNEFWSALLEKAYAKLNGSYEALKGGSIAEAMEDFTGGVFEFYNLKKAPPDLYRIMRKGLEKASMMGCSIDEGSTFKYRSTPRAINMSKMTATFRAWSSGIRRFAERFLPSRLGHARLLASSGIEITSMFDLEARLPNGLVKGHAYSITGLDQVF-FEGQDVRLVRIRNPWG-EVEWNGAWSDNSWEWRVVDVSERRRLEQVRAEDGEFWMSFSDFKRNFSKMEICNLSPDTLRTQ-SGSRHWTVTAHEGRWLRGCTAGGCRNYAGTFWTNPQFHLRLHEEDDDPDDDEVACSFIVALMQKNMRRQKRDLLTIGYAIYEIPLKAPPGCTHLPGEFFVRNSSRARSHNFINLREVSDRFRLPPGHYVIVPSTYEPHQEADFLLRVYCEKMNRSRGETKHNSVSKGRPIFRGAFKQVSNLGGCGGPNCYRVVDEHIADEILKSNSERV-GEAVQPSMPVEVVETDEDRRFTQVFKKLAGEDMEISPRELQDLLNKVTAK-LKVFKSDGFSLYACQSMVALMDSDGSGKLGLPEFKLLWEKIKMWQAIFRKYDEDRSGTMSSYEMRAALNAAGFHLNNQMYQLITMRYAD-ESMTIKFNDYITCMVRLEAMFRIFHALDKDK 710          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: capn3a (calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912-97])

HSP 1 Score: 493.041 bits (1268), Expect = 1.772e-163
Identity = 289/729 (39.64%), Postives = 420/729 (57.61%), Query Frame = 2
Query:  296 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAI--------------------------------------ESAK---------IEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKDMR-QRNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMV---------------------DDGRAVTGEVKV---------KNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAF 2221
            L+EDPDFPA  +S++ S+ +    +F W RPK++C  P+      +   + +G LGDCW+LA +A +++ E +   V+P  Q F++NY G F F+FWRFG+WV+VVVDDRLPT+  +LVF+ SA+ NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  K  P  LY  M+K   + +LMGC+I                                      E AK          E     GL+  HAYSIT + +VK     +V+LVR+RNPWG+  EW G WSD+S EW  I+ SEK+RL    A DGEFW++F DF +NFTK+EIC+L P++L +D + K  W + + +G W +  +AGGCRN+ D+F TNPQ+R+++ D DD+  +N    + I+ LMQK+ R +R  G   L IG+ IY++ +   G    L K FF ++ + A+   +IN REV  R +LP G YVI+PSTF  ++E  F+LR+F+EK N S+E+D   G  + +K  +N  +V                     +DG     E K          K   +   +K  + +FK +AG    + A  L +ILN V+   KD+K   GF LE CR+M+AL D D +GK+ + +F  LW  L+ W+  F+ +D+D++G   +YE R A+N  G  ++N L+++I  R+ D EN  I F++FI  +IRL   F
Sbjct:   66 LFEDPDFPAHNNSIYFSQNAP--MQFQWMRPKELCV-PRSIVIEANHTHICEGDLGDCWVLAAIACMTMNEELLARVIPAGQSFEENYAGIFHFQFWRFGEWVDVVVDDRLPTFNNQLVFVQSAERNEFWSALLEKAYAKVHGSYEALKGGNTTEAMEDFTGGVTEYFEM--KNPPKDLYKIMVKATSRRSLMGCSIDDGMCWRCGVPAPDSIGLVRSNMSPPILRHIQLTPIGIEDAKKRKIAMLTHAESRTPMGLVRNHAYSITGLDEVKHR-SKIVQLVRLRNPWGH-VEWIGPWSDASKEWNEITPSEKQRLQLISAEDGEFWISFQDFCRNFTKLEICNLSPDALADDRTNK--WTVSVSEGRWVRGCSAGGCRNYPDTFWTNPQYRLQLYDEDDDPDDNELLCSFIVALMQKNRRKERRQGSTMLTIGFAIYEVTEELRGSREHLPKDFFLYNASRARCNSYINLREVTERFRLPPGEYVIVPSTFEAHQEGEFLLRVFAEKHNVSEEMDDIIGVKKKSKKKKNKPIVFISDRTKKGQQQPESPDESEPEDGNEEESEPKSNKLAEPENPKEPDLTPEDKQFKTIFKQLAGDDMEVGAADLHNILNKVITKHKDLKT-SGFSLESCRTMVALMDTDLSGKLGYNDFKYLWDKLKFWQQIFRKYDSDKSGSMTSYEMRLAINEAGYQLNNQLYQIITLRHAD-ENLNIGFDNFIACLIRLEAMF 783          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: capn1a (calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-1263])

HSP 1 Score: 390.963 bits (1003), Expect = 1.805e-125
Identity = 247/674 (36.65%), Postives = 370/674 (54.90%), Query Frame = 2
Query:  245 KQTLYSDILKQLKGTGKLWEDPDFPADTSSVFV----SKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE----SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCR--NFIDSFVTNPQFRXXXXXXXXXXXXNTGT-VIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKK-DMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAF 2221
            K   + +I K+      L+EDPDFPA  SS+ +    +  ++      WKRP ++ ++P+    G +R D+ QG L DCWLL+ +ASL+LY  +   VVP  Q F ++Y G F FRF ++G+WV+V VDDRLPT  G+LVF+ S   NEFWSALLEKAYAK+ G YE+L+ G  +EA+ DFTGG+ ET  +N    P   ++ + +  K+  ++ C IE    S + E V   GL+ GHAYSIT V K+K   G  V+L+RVRNP+G + E+ G WSD S  W  + + +++RL    A DGEFW++  DF KNF  +EICH G E   E    K  W   + +  W K +NAGG R       F  N QF + +++ D+      G   ++ L QK  R+ R +G  F+ IG  IYK   P   L  +   K    + +SP FI +REV  R  LP G+Y+IIP T +  +EA F+LRIF EK  + + L     + E+  +     MV    A                 D+EE F  +AG  ++I A +L+ ++   ++K        F +E CR ++AL D D++G++ + EFLL+W  +++    +K  D D++G   + E   AL +    V   + ++I  R+++P N  I F+ F+  + ++  AF
Sbjct:   26 KSKTFQEIKKECLQRKILFEDPDFPASLSSLHIRVQPTVITQSNNFIEWKRPWELVRHPEFIVSGATRADINQGTLPDCWLLSAIASLTLYPDLLAKVVPMGQSFHEDYAGIFLFRFCQYGEWVDVHVDDRLPTKKGELVFVQSGTGNEFWSALLEKAYAKLNGCYEALAYGFPVEALCDFTGGVGETFTMNNA--PRDYWDGISRAIKKGAIICCGIETLAASGRGEKVTPMGLVEGHAYSITGVIKLK-FPGKTVQLIRVRNPYG-KVEYTGPWSDGSTTWNEVPEEDQKRLHVR-AEDGEFWISDKDFRKNFHLVEICHQGSEV--EIEHRKNLWICELHNSMWLKGLNAGGSRRHRVFKEFPLNYQFFLTLLEEDNVMDVCHGCHFLLSLTQKHRRKFRKIGIDFVPIGIYIYKAVVPGKKLTPQQLRK-EKPLVESPEFIARREVTMRMTLPPGNYIIIPCTESAGQEAQFLLRIFMEKAQQHQGL---ASQLEVTPYFPR--MVSPPPAENF--------------DMEESFLQVAGKDKLIKADKLQALITLEIQKYTTVVVDKFSMESCRVLVALFDIDNSGQLGYEEFLLVWEFIKMTLKTYKMCDVDKSGTLSSTELPMALEHSRFKVGKLMQRLIMMRFSEP-NLTISFDSFVCLLAKMYTAF 671          
BLAST of Calpain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007888.1 (pep scaffold:Pmarinus_7.0:GL477427:174304:193458:1 gene:ENSPMAG00000007039.1 transcript:ENSPMAT00000007888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 336.65 bits (862), Expect = 1.835e-106
Identity = 203/563 (36.06%), Postives = 309/563 (54.88%), Query Frame = 2
Query:  713 KMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAI---ESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTG--TVIIGLMQKDMRQ-RNLG--FLVIGYVIYKLKDPNCGL----LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQN--KSKELDVENGKTEIAKH---LRNTDMVDDGRAVTGE-----------------VKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKK--DMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGV-IKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFME 2290
            ++ G YE+LSGGS  E  EDFTGG+ E+I+LN+   P  L+  + +   + +LMGC+I     A  E + +  L+ GHAYS+T   +V    G +V LVR+RNPWG + EW G WSD++P+W  +S  ++ RL  +   DGEFWM+F+DF + F+++EIC+L P++L++D  G   W     +GSW +  +AGGCRNFI       +F ++  + DD+  +N    T I+ LMQK+ R+ R  G   L +GY IY++ +   G     L K +F++ ++ A+S  FIN REV  R  LP G Y+++PSTF PN+EA+F+LRIFSEKQ+   S      N       H     NT +  DG + T E                     + K  +      +LF  +AG  + I+A +L+ ILN V+ K        GF LE CRSM++L D D T K+   EF  LW  ++ W+  F ++D D  G  ++ E R AL   G  ++  L +++  RY D ENG+ I F++++  ++RL   F T +   +D  +       +F+ 
Sbjct:    1 RLQGSYEALSGGSTTEGFEDFTGGVAESIELNKP--PSNLWRMLQQATLRGSLMGCSINITSQADSEAITSRKLVKGHAYSLTGTTEVDY-QGQMVRLVRIRNPWG-QVEWTGAWSDNAPQWGYVSDEDRGRLQVS-QEDGEFWMSFEDFLRQFSRLEICNLTPDALDDDSLG--HWSANNFEGSWVRGCSAGGCRNFIVHLWEKWKFHLKHTEEDDDPHDNEAGCTFIVALMQKERRKKRRQGGDVLTVGYAIYEVPEQFVGQPQVKLKKDYFQYHSSKARSEVFINLREVSQRFTLPAGEYIVVPSTFEPNQEADFILRIFSEKQSVTVSARTTTSNTSPHSPTHTCTYTNTRIPHDGCSHTRERAHSRARTPTPRHSDAPTSFTSFKFSSTCPRFYKLFDRLAGEDQEISAKELQSILNRVVSKLHSTVTTDGFGLEACRSMVSLMDKDGTAKLGVKEFNFLWKKIKNWQQIFLEYDTDSTGTMNSMEMRLALEAAGFRLNEKLNQIVTTRYADGENGITIDFDNYVCCLVRLETMFRTFQALEKDGNEKINLNLPQFLH 556          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO40193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W7])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 310/690 (44.93%), Postives = 430/690 (62.32%), Query Frame = 2
Query:  263 DILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTD---QDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAI--ESAKIEGVMANGLISGHAYSITDVQKVK---QTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMR---QRNLGFLVIGYVIYKLKDP--NCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIA-KHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFME 2290
            D+ +Q++ TGK +ED +F A  SS+F SK  +  R F WKRP DIC++P +F  G SR D+QQG LGDCWLLA +A+L+ +  +   VVP D      D+NY GA +F  W++G+W +V++DDRLPTY GKLVF+HS++ NEFWSALLEKAYAK+ G YESL GG   EA+EDFTGGL E+  LN K  P  L+  M    K+  LMGC+I  ++ +IE  + NGL+ GHAY++T  ++VK   +     VELVRVRNPWGNE+EWKG W D S EW+ +S  EK+ +   F +DGEFWM+FDDF K+FT +EIC LG +S  E  S    +E   E G W + + AGGCRNFI +F  NPQFR   +   D+D+++  TVII LMQKD R   +  +  L IG+ IYKL++     G L+  FF++  + A+SP FIN REV GR+ LP G YV+IP+TFNPNEE NF+LR++SEK +K+ E+D    KTE A +H R              V++  E+   L    +E F  ++G    I+A +L+ IL+  LK D+   K F LE  RS+I++ D+D +GK+ F EF   W  ++ W   F+ FD D++G  D YE R AL   G T+SN++   +  RY+   +G +  +DF+  + RL       + Q     +   F  ++F+E
Sbjct:    8 DVRRQVRSTGKPFEDDEFLAIDSSIFFSK--RPPRPFEWKRPSDICEDPHMFVGGASRLDIQQGMLGDCWLLAAIAALTQHSALMNKVVPQDYVANPNDRNYTGALKFCIWQYGEWKDVIIDDRLPTYNGKLVFVHSSERNEFWSALLEKAYAKLNGSYESLKGGQTGEALEDFTGGLAESFDLN-KNVPKDLFCIMQTAEKRHALMGCSIAAKANEIEAKLNNGLVKGHAYTVTGCRQVKAKTRRGDLDVELVRVRNPWGNEREWKGAWGDGSSEWQLLSDYEKKSIGLTFEDDGEFWMSFDDFKKHFTTLEICMLGADSAMEGSSVG--FESRSEHGMWRRGLTAGGCRNFIKTFHKNPQFR-ITLQDSDDDADDLCTVIIALMQKDRRKEKKHGINPLTIGFSIYKLEEEKDKQGNLDMEFFQYHASTARSPVFINSREVVGRYALPPGEYVVIPTTFNPNEEGNFVLRMYSEKAHKTCEVDE---KTEFAPQHQR-------------RVQISREQHDTLNSKFKEFFDNLSGRDGEIDAKELQQILSTALKNDLGG-KPFSLEGARSIISMYDEDASGKLGFEEFKETWLQVKKWMKIFQVFDEDKSGEMDTYELRGALKEAGFTLSNSVLYAVSARYSTG-DGKVNVDDFMEILTRLNILSAAFQKQAGQGGRRAAFDIDQFLE 673          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO48633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ83])

HSP 1 Score: 513.842 bits (1322), Expect = 2.329e-173
Identity = 278/679 (40.94%), Postives = 404/679 (59.50%), Query Frame = 2
Query:  224 MKKRDLDKQTLYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDK-NYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE-----SAKIEGVMANGLISGHAYSITDVQKVKQTD---GTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRN--LGFLVIGYVIYKL-KDPNCG-LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAF 2221
            M +R L K+  ++ + +QL  + +L+ED DFPA    +F  + S    + +WKRP +I K+PQ  A G S  DV QG + +CW +A +A L+    +  +V P DQ F+  +Y G FRF FW+FG+WVE++VDD LPTY G+L F  S D +EFWSALLEKAYAK+CG YE++S G   EA++D TGG+ E + L     P GL+N M+K  ++ +LMGC+IE     S + EG + NGLI+ HAYSIT ++K   +       V+L+R+RNP  N  EW+G WSD SPEW  +S  EK  L   F +DGEFWM+FDDF  NFT++EIC L P+S+ ++   +R+W++  E G W K + AGGCRNFI SF TNPQFR   +   D+D +   TVI+ LM+ D   R        IG+ IYK   D   G  L+++FF+++  +A +  F   RE+  R++L  G YV+IPSTFNP +E +F+LRIFSE+   + E+D E   T   K                 V +  +   +++ +  ++F  MAG    ++  +L++IL+    +++ N   F LE CRSMI++ D D +G + + EF  L   L  WK  F  +D D +G  +AYE R+ALN +G  +SN+    +  RY + + G I F+ FI  V+R+   F
Sbjct:    1 MSRRALHKRERFASLQRQLLNSKRLFEDRDFPASNRVLFTRRRSV---QLIWKRPHEISKSPQFIARGFSSSDVAQGRIRNCWFVAALADLTTNIDLLHHVCPPDQSFEPGSYCGMFRFNFWQFGEWVEIIVDDYLPTYNGRLYFTKSDDPDEFWSALLEKAYAKLCGSYEAMSLGRISEALQDMTGGMIENVDLQNP--PHGLFNVMMKAYERQSLMGCSIEVKKYSSDQYEGTLENGLITRHAYSITGLRKATLSSLRGRPEVDLIRLRNPHANSSEWRGAWSDRSPEWNMLSSQEKRELNLTFDDDGEFWMSFDDFLNNFTRLEICMLTPDSMEQN--DRRKWDVQNEKGRWQKGVTAGGCRNFIASFYTNPQFR-VCLKNPDDDDDELCTVIVSLMRVDHSHRVKIPDRAPIGFAIYKAPSDMRKGDRLDRAFFEYNKAVAMTTSFSKLREISSRYRLHAGEYVVIPSTFNPGQEGDFLLRIFSERPQYASEIDQETKMTSGPK-----------------VVITQDDAKSIDHEFWDVFHQMAGEDGEVDQYELQEILSKSFTRELNN-NLFALEACRSMISMFDTDRSGALGYNEFRALMILLEKWKNHFHKYDRDHSGDMNAYELRDALNGLGYQLSNSAMSSLVLRYHN-KRGTISFDTFIQIVVRVVVMF 652          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO34860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN59])

HSP 1 Score: 343.584 bits (880), Expect = 8.099e-108
Identity = 194/507 (38.26%), Postives = 299/507 (58.97%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKN--PQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTD--QDFD----KNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLN------EKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTV-------VELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGK--RRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGT-VIIGLMQKDMRQ---RNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVEN 1687
            YS +  + +   +L+ D  F  +TSS++ S++        WKRP +IC    P LF DG    DV QG LG+CW +A  +SL+L   +   V+P    Q++D    +NY G FRFRF+R G+W EVVVDD LPT  GKLV++HS + NEFWSAL+EKAYAK+ G YE+L+ GS  +A+ DFTGG+ E I L+      ++E+ + L+  + +  K+ +LM  +I+     ++E  +  GLI GHAY +T V+KV   +G +         ++R+RNPWG EKEW G+WSD S EW+ +   +++++   F NDGEFWM FDDF + FT   +CH+    +N+ +  K  ++W +   + +W +  NAGGC    D+F+ NPQ+           ++N G   ++ LMQ+D R+   + +G L IG+ I K+++     ++  F K   +I     FIN REV  R  L  G Y+++PST+ P+   +FM+RIF+ K++ +  LD ++
Sbjct:   12 YSKLKAECEKNEQLFVDSVFKPETSSLYYSRSCPP-EPVEWKRPSEICHPAVPHLFVDGADSHDVTQGKLGNCWFVAACSSLALRPFLLYKVIPDKDKQEWDPKKPENYQGIFRFRFYRQGEWTEVVVDDLLPTVNGKLVYIHSKEKNEFWSALIEKAYAKLAGTYEALAAGSTADALVDFTGGVAEAISLSNGGYAEDQEKRLQLFKTLERGHKEKSLMSASIKINNRNEMEQRLDTGLIKGHAYGVTMVKKVTVGEGLLSLFNKKHFYMIRLRNPWG-EKEWNGRWSDESEEWKKLKPGDRKKMGIVFENDGEFWMEFDDFCREFTDCTLCHV----INKAMIHKVFKQWHIYKHNYNWTQGQNAGGCVQNQDTFLKNPQY-------AFSITDNEGEDAMVSLMQEDRRKDKSKGVGNLTIGFYIMKVEENRKYRVHSMFPKAGDSI-----FINAREVMNRFFLAAGRYLVVPSTYEPHTPGHFMMRIFTRKRSNAMFLDQDH 500          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO48536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ84])

HSP 1 Score: 331.257 bits (848), Expect = 2.218e-103
Identity = 190/497 (38.23%), Postives = 262/497 (52.72%), Query Frame = 2
Query:  389 KDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTD----QDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESL--NEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQ---RNLGFLV---------------IGYVIYKLKDPN-------------------------CGLLNKSFFKFSTTIAKSPG-------------------FINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKEL 1675
            ++IC  P+ + DG SR D++QG LG+CWLLA ++ L+ ++P+   ++P        F   Y G   F+ W++G+WV V++DDRLPTY GKLVF+HS + NEFW ALLEKAYAK+ G YE+L GG   EA+EDFTGGL E   L +   P  L+  M +  K+S LMGC+I          N  +S              T G  VEL+R+RNPWG+EKEW G W D SPEW+ +S+ EK  L   F  DGEFWM+F+DF  +F K+E+C L  E+      +S   R    +E+G W K+++AGGCRNF+++F TNPQFR+          E TG  +  +  + M +     +GF +                G+ +YK+ +                           CG +  + +K      +  G                   FIN REV GR +L  G YVI+PSTF  N EA+F+LRIFSEK   S  L
Sbjct:   11 QEICSEPRFYVDGASRLDIKQGVLGNCWLLAAMSVLAQHKPLVDRIMPEGVYEADRFSPRYTGKVVFKLWQYGEWVTVIIDDRLPTYKGKLVFVHSPEKNEFWCALLEKAYAKIHGSYEALKGGLTGEALEDFTGGLSEVFVLEDA--PANLFQIMQRAEKRSALMGCSI----------NVFLS--------------TRGG-VELIRIRNPWGDEKEWTGAWGDRSPEWQELSQDEKRSLDLEFDVDGEFWMSFEDFKSHFDKLEVCMLDVENAIDKTQISFNSR----LENGFWRKHVSAGGCRNFLETFHTNPQFRLVSRVMSRMICEGTGFALYKVSNRVMSREICEGIGFALYKVSNRVISKVLCEGTGFALYKVSNRVISRVICEGTGFALYKVSNRVISRVICGGIGFALYKIDDITKRKYGVSRLDKEYFQFNKSTERSTFINSREVVGRFELAPGEYVIVPSTFIQNAEADFLLRIFSEKAVSSSAL 476          
BLAST of Calpain vs. Ensembl Nematostella
Match: EDO37991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE78])

HSP 1 Score: 153.295 bits (386), Expect = 6.594e-39
Identity = 99/316 (31.33%), Postives = 156/316 (49.37%), Query Frame = 2
Query:  305 DPDFPADTSSVFVS-KASKGYREFVWKRPKDI-----CKN--PQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVG---------LYNQMLKFAKQSTLMG--CAIESAKIE--GVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHL 1189
            D  FP    S++++ + S+  R   W RP +I     C+   P          D+ QG LGDCW L+ +A L+    + + ++ T +   +   GA++ R  + GKW  +++DD LP           A   + W  L+EKA AK+ G YE+L+ G  IE +   TG  CE+I L+E +   G         ++ Q++       LMG  C  ++   E  G  A GL + HAYS+ DV+ V       + L+R+RNPWG +  W G WSD+S  W   +   +  L  + A +G FWM+ +DF K F  +++C +
Sbjct:   46 DDSFPPVLKSLYINPRHSEHPRVADWLRPNEIDNFSTCRTNIPWAVFRNPRPSDIIQGVLGDCWFLSSLAVLAERPELLEKILITREVSPQ---GAYQVRLCKDGKWTVILIDDLLPCNQRGQPVYSWAHRRQLWVPLIEKAMAKLHGSYEALTAGRSIEGLATLTGAPCESIALHESQNNSGNTEPIDKDLIWAQLISSRTAGFLMGASCGGDTQPEEEPGYNAVGLQTHHAYSVLDVRDVHG-----IRLLRLRNPWG-QYSWTGDWSDASSLW---TPELRHELMVHGAQEGVFWMSLEDFMKYFDSVDVCKI 349          
BLAST of Calpain vs. Ensembl Medaka
Match: capn3a (calpain-3 [Source:NCBI gene;Acc:101157263])

HSP 1 Score: 525.783 bits (1353), Expect = 1.291e-176
Identity = 303/689 (43.98%), Postives = 428/689 (62.12%), Query Frame = 2
Query:  221 PMKKRDLDKQTLYSDILKQLKGTGKLWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKD-MRQRNLG--FLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQD 2248
            P+     D  TL  + L Q KG   L+ED  FPA   S+    +   S   +  VWKRPK+IC NPQ    G SR D+ QG LGDCWLLA +A L+L E +   VVP +Q F ++Y G F F+FWR+G WV+VVVDDR+PT   +LVF  SA+ NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  KE P  LY  M K  ++ +LMGC+I+S   A+ E     GL+ GHAYS+T V + K++    V LVR+RNPWG + EW G WSD+S EW T+SK+EKE+L    A DGEFWM+F+DF KN+TKIEIC+L P++L +D   K  W + + +G W +  +AGGCRN+ D+F TNPQ+R+ +++ DD+  +N    T ++ LMQK+  R+R +G     IG+ IY++   N   L K FF  +++ A+S  +IN REV  R +L  G YVI+PST+ P++E  F+LR+FSEK+N S+E++               + ++    V     V  E     +     +F+ +AG    I A +L+++LN V+  +KD+ N  GF LE CRSMIAL D D TG++   EF  LW  ++ W+  FK ++AD++G+ ++YE RNA+N+ G  ++N L+ +I  RY + EN  I F+ FI  ++RL   F   +   QD
Sbjct:   29 PLHFNGQDFSTLRQECL-QRKG---LFEDDSFPATVESLGFKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNEKLLFRVVPQEQSFSESYAGIFHFQFWRYGDWVDVVVDDRIPTLNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEM--KEAPKELYKTMKKALERGSLMGCSIDSLVPARFETRTTTGLVKGHAYSVTAVDEQKESK---VRLVRLRNPWG-QVEWNGPWSDNSKEWATLSKAEKEKLQHQSAEDGEFWMSFEDFKKNYTKIEICNLTPDTLEDDKIHK--WTVSVNEGRWLRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPDDNEVACTFVVSLMQKNRRRERKMGANLFTIGFSIYEMHG-NKQHLQKDFFLLNSSKARSKSYINLREVTQRFRLSPGEYVIVPSTYEPHQEGEFILRVFSEKRNTSEEIE---------------NRIEADHPVPAPASVGEES--EEDHHFRTIFQEIAGEDMEITANKLKNVLNRVITERKDL-NTVGFSLESCRSMIALMDMDGTGRLNLQEFRHLWNKIKQWEGIFKHYNADQSGIINSYEMRNAVNDAGFRLNNQLYHIITLRYAN-ENMNIDFDSFISCLVRLEAMFRAFQAFDQD 685          
BLAST of Calpain vs. Ensembl Medaka
Match: capn3a (calpain-3 [Source:NCBI gene;Acc:101157263])

HSP 1 Score: 524.628 bits (1350), Expect = 2.643e-176
Identity = 304/708 (42.94%), Postives = 434/708 (61.30%), Query Frame = 2
Query:  221 PMKKRDLDKQTLYSDILKQLKGTGKLWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVK--QTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKD-MRQRNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFME 2290
            P+     D  TL  + L Q KG   L+ED  FPA   S+    +   S   +  VWKRPK+IC NPQ    G SR D+ QG LGDCWLLA +A L+L E +   VVP +Q F ++Y G F F+FWR+G WV+VVVDDR+PT   +LVF  SA+ NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  KE P  LY  M K  ++ +LMGC+I+S   A+ E     GL+ GHAYS+T V + +  Q   + V LVR+RNPWG + EW G WSD+S EW T+SK+EKE+L    A DGEFWM+F+DF KN+TKIEIC+L P++L +D   K  W + + +G W +  +AGGCRN+ D+F TNPQ+R+ +++ DD+  +N    T ++ LMQK+  R+R +G     IG+ IY++     G    L K FF  +++ A+S  +IN REV  R +L  G YVI+PST+ P++E  F+LR+FSEK+N S+E++               + ++    V     V  E     +     +F+ +AG    I A +L+++LN V+  +KD+ N  GF LE CRSMIAL D D TG++   EF  LW  ++ W+  FK ++AD++G+ ++YE RNA+N+ G  ++N L+ +I  RY + EN  I F+ FI  ++RL   F   +   QD +     +  E+++
Sbjct:   29 PLHFNGQDFSTLRQECL-QRKG---LFEDDSFPATVESLGFKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNEKLLFRVVPQEQSFSESYAGIFHFQFWRYGDWVDVVVDDRIPTLNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEM--KEAPKELYKTMKKALERGSLMGCSIDSLVPARFETRTTTGLVKGHAYSVTAVDECRPSQQKESKVRLVRLRNPWG-QVEWNGPWSDNSKEWATLSKAEKEKLQHQSAEDGEFWMSFEDFKKNYTKIEICNLTPDTLEDDKIHK--WTVSVNEGRWLRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPDDNEVACTFVVSLMQKNRRRERKMGANLFTIGFSIYEVPKEMHGNKQHLQKDFFLLNSSKARSKSYINLREVTQRFRLSPGEYVIVPSTYEPHQEGEFILRVFSEKRNTSEEIE---------------NRIEADHPVPAPASVGEES--EEDHHFRTIFQEIAGEDMEITANKLKNVLNRVITERKDL-NTVGFSLESCRSMIALMDMDGTGRLNLQEFRHLWNKIKQWEGIFKHYNADQSGIINSYEMRNAVNDAGFRLNNQLYHIITLRYAN-ENMNIDFDSFISCLVRLEAMFRAFQAFDQDGDGTIRLSVLEWLQ 708          
BLAST of Calpain vs. Ensembl Medaka
Match: capn3a (calpain-3 [Source:NCBI gene;Acc:101157263])

HSP 1 Score: 524.628 bits (1350), Expect = 5.410e-176
Identity = 303/694 (43.66%), Postives = 428/694 (61.67%), Query Frame = 2
Query:  221 PMKKRDLDKQTLYSDILKQLKGTGKLWEDPDFPADTSSVF---VSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES---AKIEGVMANGLISGHAYSITDVQKVK--QTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXN--TGTVIIGLMQKD-MRQRNLG--FLVIGYVIYKLKDPNCG---LLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVL--KKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQD 2248
            P+     D  TL  + L Q KG   L+ED  FPA   S+    +   S   +  VWKRPK+IC NPQ    G SR D+ QG LGDCWLLA +A L+L E +   VVP +Q F ++Y G F F+FWR+G WV+VVVDDR+PT   +LVF  SA+ NEFWSALLEKAYAK+ G YE+L GG+  EAMEDFTGG+ E  ++  KE P  LY  M K  ++ +LMGC+I+S   A+ E     GL+ GHAYS+T V + +  Q   + V LVR+RNPWG + EW G WSD+S EW T+SK+EKE+L    A DGEFWM+F+DF KN+TKIEIC+L P++L +D   K  W + + +G W +  +AGGCRN+ D+F TNPQ+R+ +++ DD+  +N    T ++ LMQK+  R+R +G     IG+ IY++     G    L K FF  +++ A+S  +IN REV  R +L  G YVI+PST+ P++E  F+LR+FSEK+N S+E++               + ++    V     V  E     +     +F+ +AG    I A +L+++LN V+  +KD+ N  GF LE CRSMIAL D D TG++   EF  LW  ++ W+  FK ++AD++G+ ++YE RNA+N+ G  ++N L+ +I  RY + EN  I F+ FI  ++RL   F   +   QD
Sbjct:   29 PLHFNGQDFSTLRQECL-QRKG---LFEDDSFPATVESLGFKELGHKSNKVKNIVWKRPKEICDNPQFIVGGASRTDICQGDLGDCWLLAAIACLTLNEKLLFRVVPQEQSFSESYAGIFHFQFWRYGDWVDVVVDDRIPTLNNQLVFTKSAERNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFYEM--KEAPKELYKTMKKALERGSLMGCSIDSLVPARFETRTTTGLVKGHAYSVTAVDECRPSQQKESKVRLVRLRNPWG-QVEWNGPWSDNSKEWATLSKAEKEKLQHQSAEDGEFWMSFEDFKKNYTKIEICNLTPDTLEDDKIHK--WTVSVNEGRWLRGCSAGGCRNYPDTFWTNPQYRLRLLEEDDDPDDNEVACTFVVSLMQKNRRRERKMGANLFTIGFSIYEVPKEMHGNKQHLQKDFFLLNSSKARSKSYINLREVTQRFRLSPGEYVIVPSTYEPHQEGEFILRVFSEKRNTSEEIE---------------NRIEADHPVPAPASVGEES--EEDHHFRTIFQEIAGEDMEITANKLKNVLNRVITERKDL-NTVGFSLESCRSMIALMDMDGTGRLNLQEFRHLWNKIKQWEGIFKHYNADQSGIINSYEMRNAVNDAGFRLNNQLYHIITLRYAN-ENMNIDFDSFISCLVRLEAMFRAFQAFDQD 694          
BLAST of Calpain vs. Ensembl Medaka
Match: capn9 (calpain 9 [Source:NCBI gene;Acc:101158662])

HSP 1 Score: 498.049 bits (1281), Expect = 8.540e-167
Identity = 272/655 (41.53%), Postives = 396/655 (60.46%), Query Frame = 2
Query:  290 GKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKD---MRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMEL 2236
            G L+EDPDFPA  SS+F S+      +  WKRPK+IC+NP+    G  R D+ QG LGDCWLLA +ASL+L +     VVP DQDFD NY G F F+FW+  KW++VVVDDRLPT   +L+ +HSA N+EFWSALLEKAYAK+ G YESL GGS +EAMEDFTGG+ E  +   K  P  L++ M K   + ++MGC+I+   SA+ E   + GL+ GHAYSIT ++++ Q  G  V+L+RVRNPWG + EW G WSD+S EW  I K EK+R+  N   DGEFWM F+DF KN+ K+EIC++ P++L++D   KR W + + +G+W +   AGGCRN+ID+F TNPQFR   ++  D+D ++  +V+I LMQK+   +R+  L    IG+ +Y+  D     + K FF++  + A+S  +IN REV  R  LP G Y+++P+T+ P++EA+F++RIFSEK+           +T+  K LR   + D    + G+V+ +N+         E           +++ C   +  N V                         D+TG +EF EF + W  ++ W   F  FD D +G   +YE R+AL   G+ ++N L +++G R+ D +   I F+D++  ++RL N F+  E+
Sbjct:   38 GVLFEDPDFPAVDSSLFYSQTVP--VQIQWKRPKEICENPKFIVGGADRTDICQGQLGDCWLLAAIASLTLKKDAMARVVPPDQDFDHNYAGIFHFQFWQHNKWLDVVVDDRLPTVRNRLIMLHSASNDEFWSALLEKAYAKLNGSYESLKGGSTMEAMEDFTGGVGEMYET--KSAPENLFSIMKKALDRGSMMGCSIDITSSAESEAKTSTGLVKGHAYSITGMEEL-QFRGQTVKLIRVRNPWG-QVEWNGAWSDNSREWNYIDKKEKDRILQNSLEDGEFWMEFEDFKKNYDKVEICNMTPDALDDDT--KRHWAVNVFEGNWIRGSTAGGCRNYIDTFWTNPQFR-LQLEDADDDDDDVCSVVIALMQKNRRKLRKEGLDLETIGFAVYEAPDDESQ-VEKDFFRYHPSKARSRTYINMREVSERFTLPPGKYLLVPTTYQPHQEADFIIRIFSEKKADPPMPTPPEEETDEEKSLRR--LFDQ---LAGDVREQNQNFPPTRISYE---------ANLLSGC-FPERRNQV-------------------------DNTGMIEFQEFKVFWEKMKNWIMLFLAFDTDRSGKMSSYELRSALKAAGMQLNNQLLQLVGLRFGD-DTFNIDFDDYLTCIVRLENMFKLTEI 641          
BLAST of Calpain vs. Ensembl Medaka
Match: capn3b (calpain-3 [Source:NCBI gene;Acc:101169329])

HSP 1 Score: 501.516 bits (1290), Expect = 1.028e-166
Identity = 285/665 (42.86%), Postives = 406/665 (61.05%), Query Frame = 2
Query:  296 LWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIE---SAKIEGVMANGLISGHAYSITDVQKVKQT--DGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNT-GTVIIGLMQKDMR-QRNLG--FLVIGYVIYKLKDPNCGL---LNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTE----IAKHLR-NTDMVDDGRAVTGEVKVKNEKILALEKDLEE-----LFKVMAGPMEVINACQLRDILNAVLKKDMK-NFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAF 2221
            L+EDP FPA+ SS+F S   K   +  WKRP +IC+NPQ   DG +R D+ QG LGDCWLLA +A L+L E +   V+P +Q F +NY G F F+FWR+G+W+++VVDDR+PT    LVF  S   NEFWSALLEKAYAK+ G YE+L GG+ ++AMEDFTGG+ E  +L+E   P GL+  M K  ++ +LMGC+I+   +  IE     GL+ GHAYSI  +++  Q   DG  + L+R+RNPWG    WKG WS +S EW T+S ++++ L        EFWM+FDDF KNFTK+E+C+L P++L  D   ++ W + I +G W +  +AGGCRNF D+F TNPQ+R+ + + DD + E    TV++ LMQK  R QR+ G  FL IG+ IY++     G    L K FF ++ + AK   +IN REV  R +LP G YVI+P+TF  +EE  F+LR+FSE ++ S+E +    K E    ++   R N ++  +G     + K K + + A+E+  EE     +++ +AG    I A +L  I+  VL K  +    GF LE CRSMIAL D D +GK+   EF  LW  ++ W+  FK +D D      ++E RNA+N+ G  ++  L+ +I  RY D     I F+ +I   +RL   F
Sbjct:   77 LFEDPLFPANDSSLFYSH--KPSMKIEWKRPTEICENPQFIIDGANRTDICQGELGDCWLLAAIACLTLSEKLLYRVIPPEQSFTENYAGIFHFQFWRYGEWIDIVVDDRIPTCNNLLVFTKSFRENEFWSALLEKAYAKLHGSYEALKGGNTLDAMEDFTGGVTELFELSEA--PKGLFIIMKKALERGSLMGCSIDVTTANDIESRTNQGLVRGHAYSIIALEECDQVSEDGK-IRLIRLRNPWG-WVLWKGPWSVNSKEWSTVSTADRDNLKKQTLEMSEFWMSFDDFKKNFTKLEMCNLTPDALTGD--ERQSWTVSINEGRWVRGSSAGGCRNFPDTFWTNPQYRLRLYEEDDPEEEQVLCTVVVALMQKGRRMQRHAGAKFLTIGFSIYEVPKELQGQNQHLQKDFFLYNASKAKCKAYINLREVTERFRLPPGEYVILPTTFKAHEEGEFLLRVFSENKSTSEEAETSIDKIEPIVFVSDRARTNKEIEHEGIRGEKKKKPKRKPLQAVEETEEEKQFRVIYQKIAGEDMEICASELMAIMKNVLSKHSEIKSDGFSLETCRSMIALMDTDGSGKLNLQEFKHLWKKIKEWQLIFKRYDKDGKCSISSFEMRNAVNDAGFNLNKQLYDIIAMRYADKHLN-IDFDSYICCFVRLEGMF 732          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000062904.1 (SMESG000062904.1)

HSP 1 Score: 1405.96 bits (3638), Expect = 0.000e+0
Identity = 718/730 (98.36%), Postives = 724/730 (99.18%), Query Frame = 2
Query:  104 MSSSHSVTSRVXXXXXXXXXXXXXXXXXXXXXXXQLKPTPMKKRDLDKQTLYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMES 2293
            MSSSHSVTSRVITTKTTTIGGKTTTTTSKTESIEQLKPTPMKKRDLDKQT YSDIL+ LKGTGKLWEDPDFPADTSSVFVSKASKGYREF WKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTY G+LVFMHSADNNEFWSALLEKAYAKMCGIYESL+GGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSE+TGTVIIGLMQKDMRQRNL FLVIGYVIYKLKDPNCGLLNKSFFKFSTT+AKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAV+ EVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMES
Sbjct:    1 MSSSHSVTSRVITTKTTTIGGKTTTTTSKTESIEQLKPTPMKKRDLDKQTSYSDILEHLKGTGKLWEDPDFPADTSSVFVSKASKGYREFEWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYRGRLVFMHSADNNEFWSALLEKAYAKMCGIYESLNGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSEDTGTVIIGLMQKDMRQRNLDFLVIGYVIYKLKDPNCGLLNKSFFKFSTTVAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVSEEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMES 730          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000062904.1 (SMESG000062904.1)

HSP 1 Score: 1389.4 bits (3595), Expect = 0.000e+0
Identity = 713/730 (97.67%), Postives = 718/730 (98.36%), Query Frame = 2
Query:  104 MSSSHSVTSRVXXXXXXXXXXXXXXXXXXXXXXXQLKPTPMKKRDLDKQTLYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMES 2293
            MSSSHSVTSRVITTKTTTIGGKTTTTTSKTESIEQLKPTPMKKRDLDKQT YSDIL+ LKGTGKLWEDPDFPADTSSVFVSKASKGYREF WKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTY G+LVFMHSADNNEFWSALLEKAYAKMCGIYESL+GGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSE+TGTVIIGLMQKDMRQRNL FLVIGYVIYKLKDPNCGLLNKSFFKFSTT+AKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVD       EVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMES
Sbjct:    1 MSSSHSVTSRVITTKTTTIGGKTTTTTSKTESIEQLKPTPMKKRDLDKQTSYSDILEHLKGTGKLWEDPDFPADTSSVFVSKASKGYREFEWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYRGRLVFMHSADNNEFWSALLEKAYAKMCGIYESLNGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSEDTGTVIIGLMQKDMRQRNLDFLVIGYVIYKLKDPNCGLLNKSFFKFSTTVAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVD-------EVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMES 723          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000062904.1 (SMESG000062904.1)

HSP 1 Score: 1370.91 bits (3547), Expect = 0.000e+0
Identity = 706/730 (96.71%), Postives = 711/730 (97.40%), Query Frame = 2
Query:  104 MSSSHSVTSRVXXXXXXXXXXXXXXXXXXXXXXXQLKPTPMKKRDLDKQTLYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMES 2293
            MSSSHSVTSRVITTKTTTIGGKTTTTTSKTESIEQLKPTPMKKRDLDKQT YSDIL+ LKGTGKLWEDPDFPADTSSVFVSKASKGYREF WKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTY G+LVFMHSADNNEFWSALLEKAYAKMCGIYESL+GGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSE+TGTVIIGLMQKDMRQRNL FLVIGYVIYKLKDPNCGLLNKSFFKFSTT+AKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHL              EVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMES
Sbjct:    1 MSSSHSVTSRVITTKTTTIGGKTTTTTSKTESIEQLKPTPMKKRDLDKQTSYSDILEHLKGTGKLWEDPDFPADTSSVFVSKASKGYREFEWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYRGRLVFMHSADNNEFWSALLEKAYAKMCGIYESLNGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSEDTGTVIIGLMQKDMRQRNLDFLVIGYVIYKLKDPNCGLLNKSFFKFSTTVAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHL--------------EVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMES 716          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000062902.1 (SMESG000062902.1)

HSP 1 Score: 1285.4 bits (3325), Expect = 0.000e+0
Identity = 626/696 (89.94%), Postives = 663/696 (95.26%), Query Frame = 2
Query:  206 QLKPTPMKKRDLDKQTLYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFMES 2293
            Q K TP KK D+ +QT YSD+L+QLKGTGKLWEDPDFPADTSSVFVSKASKGYREF WKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSENTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTT+AKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEK NK+  LD++NGKT IAKHLR+TD VD  + V+ E KVKNEK++ALEK+LE+LF  MAGPMEVINACQLRDILNA+L KD+KNFKGFDLE+CRS++AL+D DH+GKMEF +F+ +W ++++WKTAFKDFD+D NGVFD +EFRNAL NVGL+VSN LFKV+ NRY DPE GVI FEDFIMAVIRLTNAFETMELQP+D+E NYVFTA+EF+ES
Sbjct:   35 QAKQTPKKKEDVGQQTSYSDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFEWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDKNYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSENTGTVIIGLMQKDMRQRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTVAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKPNKTDTLDIKNGKTNIAKHLRDTDDVDSDQPVSEESKVKNEKLVALEKELEKLFNDMAGPMEVINACQLRDILNAILVKDIKNFKGFDLELCRSLVALEDYDHSGKMEFKDFMKIWKDIKVWKTAFKDFDSDGNGVFDCFEFRNALINVGLSVSNALFKVVANRYIDPEKGVITFEDFIMAVIRLTNAFETMELQPEDDEGNYVFTADEFLES 730          
BLAST of Calpain vs. Planmine SMEST
Match: SMESG000039299.1 (SMESG000039299.1)

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 365/692 (52.75%), Postives = 483/692 (69.80%), Query Frame = 2
Query:  257 YSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDK-NYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKFAKQSTLMGCAIES--AKIEGVMANGLISGHAYSITDVQKVK---QTDGTVVELVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICHLGPESLNED-LSGKR--RWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRXXXXXXXXXXXXNTGTVIIGLMQKDMRQR---NLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPSTFNPNEEANFMLRIFSEKQNKSKELDVENG--KTEIAKHLRNTDMVDDGRAVTGEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKNFKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADENGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVIRLTNAFETMELQPQDEEKNYVFTAEEFME 2290
            Y+++   L+G  KL+EDPDFPA   S++ S+  +  R+  WKRP +IC+NP+  ++G SRFDV+QG LGDCWLLA VA LSL+  +F  VVP+DQ+F K +Y G FRFRFWRFG W EV+VDDRLPTY  KLV+MHS D+NEFWSALLEKAYAK+ G YESL GGS  EA+EDFTGG+ E   + +KE P  L++ M K   + +LMGC+IE+   K E  + NGLI GHAYSITDV+ V          ++L+R+RNPWGNE EWKG WSD SPEW  IS++++  +   F +DGEFWM++ DF KNF K+EICHLGP+SL  D L GK+  RWEMCIE+G W K +NAGGCRNF+D+F TNPQFRV+VVDPD++D EN GT+IIGLMQKDMR+R    + F  IGY IY+LKD N G L+ ++FK++ ++AK+P FIN REVCGRHKLP G YVI+PSTF PN+EA+F++RIFSEK N+S ELD +     TE  K +   D               + +I+AL +     F  +AG    I+A +L+DILN   KKD K F GF +E  +SM+A+ D D +GK+ F EF +LWT+LR+WK AFK FD D++G F++YE R  LN+VG  +SN +   +  R+ + E G++ F+D+I+  +RL   FET + QP D +   +F  + F++
Sbjct:  101 YNNVKNSLRG--KLYEDPDFPAVNESLYFSQ--RPPRKIDWKRPHEICQNPEFISEGASRFDVRQGELGDCWLLAAVACLSLHSELFNQVVPSDQNFSKPSYCGMFRFRFWRFGAWKEVLVDDRLPTYNNKLVYMHSTDSNEFWSALLEKAYAKISGSYESLKGGSTSEALEDFTGGVTEFFDM-KKEVPKNLFDIMFKAFSRCSLMGCSIEADPRKTEAQLPNGLIMGHAYSITDVKMVNINIPGKSGKIQLIRIRNPWGNEAEWKGSWSDKSPEWNYISQADRNTMGLTFDDDGEFWMSYQDFIKNFEKMEICHLGPQSLEADQLGGKKKSRWEMCIENGEWKKRLNAGGCRNFLDTFWTNPQFRVKVVDPDEDDDENLGTIIIGLMQKDMRKRRKEGVEFYTIGYAIYQLKDENQGPLDINYFKYNGSVAKAPSFINLREVCGRHKLPPGTYVIVPSTFEPNQEASFLMRIFSEKPNESGELDEQTAMIPTEPEKVVSPAD---------------DAQIMALRQS----FNQIAGQDLEIDAYELQDILNTAFKKDFK-FDGFSIETSKSMVAMMDYDQSGKLGFDEFKVLWTDLRLWKEAFKKFDQDKSGNFNSYELRLCLNSVGFRLSNKILNSLVMRFANKE-GLVLFDDYILCCVRLKTIFETYKSQPHDSKDRAMFDQDTFIQ 766          
The following BLAST results are available for this feature:
BLAST of Calpain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPN91.045e-18043.30calpain 9 [Source:HGNC Symbol;Acc:HGNC:1486][more]
CAPN32.558e-17442.01calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
CAPN35.228e-17140.83calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
CAPN25.492e-16540.18calpain 2 [Source:HGNC Symbol;Acc:HGNC:1479][more]
CAPN32.398e-16338.12calpain 3 [Source:HGNC Symbol;Acc:HGNC:1480][more]
back to top
BLAST of Calpain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clp-19.279e-14347.94Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-19.279e-14347.94Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-19.279e-14347.94Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-13.430e-14248.14Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-19.052e-14247.93Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
back to top
BLAST of Calpain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CalpB0.000e+044.62gene:FBgn0025866 transcript:FBtr0076343[more]
CalpB0.000e+044.62gene:FBgn0025866 transcript:FBtr0304675[more]
CalpA4.679e-16651.32gene:FBgn0012051 transcript:FBtr0086530[more]
CalpA3.975e-16447.51gene:FBgn0012051 transcript:FBtr0112869[more]
CalpA3.975e-16447.51gene:FBgn0012051 transcript:FBtr0086529[more]
back to top
BLAST of Calpain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn90.000e+044.23calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2][more]
capn3b1.617e-17344.55calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
capn3a1.623e-17343.65calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912... [more]
capn3b2.095e-17144.27calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
zgc:552628.854e-16741.30zgc:55262 [Source:ZFIN;Acc:ZDB-GENE-040426-2814][more]
back to top
BLAST of Calpain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPN32.821e-17643.18calpain 3 [Source:NCBI gene;Acc:100497532][more]
tgfbrap14.805e-17641.54transforming growth factor beta receptor associate... [more]
tgfbrap14.973e-17442.11transforming growth factor beta receptor associate... [more]
CAPN31.562e-17040.11calpain 3 [Source:NCBI gene;Acc:100497532][more]
CAPN31.158e-16840.53calpain 3 [Source:NCBI gene;Acc:100497532][more]
back to top
BLAST of Calpain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Capn92.917e-17742.05calpain 9 [Source:MGI Symbol;Acc:MGI:1920897][more]
Capn31.224e-17242.75calpain 3 [Source:MGI Symbol;Acc:MGI:107437][more]
Capn36.157e-16941.88calpain 3 [Source:MGI Symbol;Acc:MGI:107437][more]
Capn32.676e-16440.17calpain 3 [Source:MGI Symbol;Acc:MGI:107437][more]
Capn21.356e-16340.17calpain 2 [Source:MGI Symbol;Acc:MGI:88264][more]
back to top
BLAST of Calpain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P27730|CAN_SCHMA0.000e+047.45Calpain OS=Schistosoma mansoni OX=6183 PE=2 SV=1[more]
sp|Q9VT65|CANB_DROME0.000e+044.62Calpain-B OS=Drosophila melanogaster OX=7227 GN=Ca... [more]
sp|O35920|CAN9_RAT0.000e+043.06Calpain-9 OS=Rattus norvegicus OX=10116 GN=Capn9 P... [more]
sp|O14815|CAN9_HUMAN5.017e-18043.30Calpain-9 OS=Homo sapiens OX=9606 GN=CAPN9 PE=1 SV... [more]
sp|Q9D805|CAN9_MOUSE2.040e-17642.05Calpain-9 OS=Mus musculus OX=10090 GN=Capn9 PE=2 S... [more]
back to top
BLAST of Calpain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GW140.000e+054.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GXB30.000e+054.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DE360.000e+054.81Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EIH10.000e+051.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HRD30.000e+051.74Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Calpain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:552626.811e-16741.17calpain-1 catalytic subunit-like [Source:NCBI gene... [more]
capn1a4.022e-15939.70calpain-1 catalytic subunit-like [Source:NCBI gene... [more]
capn3b4.029e-15941.43calpain 3b [Source:ZFIN;Acc:ZDB-GENE-041001-149][more]
si:dkeyp-50d11.27.081e-15840.21si:dkeyp-50d11.2 [Source:ZFIN;Acc:ZDB-GENE-091113-... [more]
capn92.059e-15641.15calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2][more]
back to top
BLAST of Calpain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn97.802e-17144.44calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2][more]
ENSPMAT00000003998.13.429e-16639.39pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 g... [more]
capn3a1.772e-16339.64calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912... [more]
capn1a1.805e-12536.65calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc... [more]
ENSPMAT00000007888.11.835e-10636.06pep scaffold:Pmarinus_7.0:GL477427:174304:193458:1... [more]
back to top
BLAST of Calpain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calpain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401930.000e+044.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486332.329e-17340.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348608.099e-10838.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485362.218e-10338.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379916.594e-3931.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calpain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn3a1.291e-17643.98calpain-3 [Source:NCBI gene;Acc:101157263][more]
capn3a2.643e-17642.94calpain-3 [Source:NCBI gene;Acc:101157263][more]
capn3a5.410e-17643.66calpain-3 [Source:NCBI gene;Acc:101157263][more]
capn98.540e-16741.53calpain 9 [Source:NCBI gene;Acc:101158662][more]
capn3b1.028e-16642.86calpain-3 [Source:NCBI gene;Acc:101169329][more]
back to top
BLAST of Calpain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062904.10.000e+098.36SMESG000062904.1[more]
SMESG000062904.10.000e+097.67SMESG000062904.1[more]
SMESG000062904.10.000e+096.71SMESG000062904.1[more]
SMESG000062902.10.000e+089.94SMESG000062902.1[more]
SMESG000039299.10.000e+052.75SMESG000039299.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013168 ID=SMED30013168|Name=Calpain|organism=Schmidtea mediterranea sexual|type=transcript|length=2391bp
CACCAAGAATAGACAACTACAAACAGAGCTAAAGCACCATTTATTAATTA
ATATTCAGATATTTCTTTCATTTTTTATTTAAACCATCAAAAATATTAAA
ATCATGAGCTCGTCTCACAGTGTAACATCCAGAGTGATCACTACAAAAAC
AACGACGATAGGGGGCAAAACTACTACAACGACCTCGAAAACTGAGTCAA
TAGAACAGTTGAAACCTACTCCTATGAAAAAAAGAGATTTAGATAAACAA
ACTTTGTATTCTGATATACTAAAACAGTTGAAAGGAACTGGGAAATTGTG
GGAAGATCCAGATTTTCCAGCAGATACTTCTTCTGTATTTGTCAGTAAAG
CTAGTAAAGGATATCGGGAATTTGTGTGGAAACGACCAAAGGACATTTGT
AAAAATCCGCAATTATTTGCTGATGGTGTCAGTAGATTTGATGTTCAACA
AGGAGCGCTAGGAGACTGTTGGCTTCTAGCTGTGGTGGCTTCTTTATCTC
TGTATGAACCGATCTTTAAAAATGTAGTTCCAACTGATCAAGATTTTGAT
AAAAACTATATTGGAGCGTTTCGATTTCGATTCTGGAGATTTGGTAAATG
GGTTGAAGTAGTTGTTGATGACCGTTTACCGACGTACGGGGGGAAATTAG
TGTTCATGCATTCAGCCGATAACAATGAGTTCTGGTCTGCACTTTTGGAG
AAGGCATATGCCAAAATGTGTGGCATATACGAATCGCTAAGTGGGGGCAG
TCAGATTGAGGCCATGGAAGATTTCACTGGAGGTTTATGTGAAACTATTA
AGTTGAATGAAAAAGAAAGACCAGTCGGACTCTACAACCAAATGCTTAAA
TTTGCAAAGCAGTCAACTTTAATGGGATGTGCAATTGAATCAGCTAAAAT
CGAGGGCGTCATGGCAAACGGTTTAATTTCAGGTCATGCGTATAGTATCA
CGGATGTTCAAAAGGTTAAACAAACTGATGGAACTGTGGTGGAGTTGGTT
CGAGTTCGAAATCCGTGGGGAAATGAAAAAGAATGGAAAGGAAAATGGTC
TGATAGCTCTCCTGAGTGGGAAACGATTTCTAAAAGTGAAAAAGAAAGGC
TTTGCTCGAATTTTGCTAATGATGGAGAGTTTTGGATGACGTTTGATGAT
TTTGCAAAAAACTTTACGAAAATTGAAATTTGTCATTTGGGGCCGGAAAG
TTTAAATGAAGATCTGAGTGGTAAGAGACGGTGGGAAATGTGCATAGAAG
ATGGCTCATGGTGTAAAAATATAAATGCGGGAGGCTGTAGAAATTTCATT
GATTCTTTTGTTACTAATCCCCAATTTCGGGTGGAAGTTGTAGATCCAGA
CGATGAGGATAGTGAGAACACGGGAACTGTCATTATCGGTCTAATGCAGA
AAGATATGAGACAAAGAAACTTAGGTTTTTTGGTCATTGGCTATGTAATT
TATAAACTGAAAGATCCAAATTGTGGATTATTGAATAAATCATTCTTTAA
GTTCTCAACAACTATTGCAAAATCTCCTGGATTTATTAACCAACGAGAAG
TCTGTGGAAGGCATAAGTTACCCACGGGTCATTATGTGATTATCCCATCA
ACATTCAATCCTAACGAAGAAGCCAATTTTATGCTGAGAATTTTCAGTGA
GAAACAAAATAAATCCAAAGAACTTGATGTTGAGAATGGAAAAACTGAGA
TTGCTAAACATTTGAGGAATACCGACATGGTCGATGATGGTAGGGCCGTT
ACTGGAGAAGTGAAAGTCAAAAATGAGAAAATTTTAGCTTTGGAAAAGGA
CCTAGAAGAATTATTCAAAGTTATGGCCGGGCCAATGGAAGTTATAAATG
CTTGTCAATTAAGGGATATATTAAATGCAGTGTTGAAAAAAGACATGAAG
AATTTTAAAGGTTTTGATCTAGAAGTGTGCAGAAGTATGATAGCATTAAA
AGATGACGACCACACTGGCAAAATGGAATTTCCTGAGTTTTTGCTGTTGT
GGACAAATCTTAGAATCTGGAAAACTGCATTCAAAGATTTTGATGCTGAT
GAAAATGGAGTTTTCGATGCTTACGAATTTAGGAATGCTCTAAATAACGT
TGGACTGACTGTAAGTAACACTTTGTTCAAAGTTATTGGCAATCGCTATA
CGGATCCGGAAAATGGTGTAATAAAATTTGAAGATTTCATAATGGCAGTA
ATAAGACTAACGAATGCTTTTGAAACTATGGAACTTCAGCCTCAAGATGA
GGAAAAGAACTATGTATTCACAGCAGAGGAGTTCATGGAATCATTTCTCT
ACATGTAATTTTTGAAAAGATTCTTCTTATTTTACTTTTATAATTACATT
TGAAAACTTTTTTAGACGAATAATTATTCAATTTATAATGC
back to top

protein sequence of SMED30013168-orf-1

>SMED30013168-orf-1 ID=SMED30013168-orf-1|Name=SMED30013168-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=735bp
MSSSHSVTSRVITTKTTTIGGKTTTTTSKTESIEQLKPTPMKKRDLDKQT
LYSDILKQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFVWKRPKDICK
NPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPTDQDFDK
NYIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEK
AYAKMCGIYESLSGGSQIEAMEDFTGGLCETIKLNEKERPVGLYNQMLKF
AKQSTLMGCAIESAKIEGVMANGLISGHAYSITDVQKVKQTDGTVVELVR
VRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDF
AKNFTKIEICHLGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFID
SFVTNPQFRVEVVDPDDEDSENTGTVIIGLMQKDMRQRNLGFLVIGYVIY
KLKDPNCGLLNKSFFKFSTTIAKSPGFINQREVCGRHKLPTGHYVIIPST
FNPNEEANFMLRIFSEKQNKSKELDVENGKTEIAKHLRNTDMVDDGRAVT
GEVKVKNEKILALEKDLEELFKVMAGPMEVINACQLRDILNAVLKKDMKN
FKGFDLEVCRSMIALKDDDHTGKMEFPEFLLLWTNLRIWKTAFKDFDADE
NGVFDAYEFRNALNNVGLTVSNTLFKVIGNRYTDPENGVIKFEDFIMAVI
RLTNAFETMELQPQDEEKNYVFTAEEFMESFLYM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0004198calcium-dependent cysteine-type endopeptidase activity
GO:0005509calcium ion binding
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
Vocabulary: INTERPRO
TermDefinition
IPR033883C2_III
IPR036213Calpain_III_sf
IPR038765Papain-like_cys_pep_sf
IPR022684Calpain_cysteine_protease
IPR001300Peptidase_C2_calpain_cat
IPR022683Calpain_III
IPR002048EF_hand_dom
IPR022682Calpain_domain_III
IPR011992EF-hand-dom_pair
IPR000169Pept_cys_AS
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022684Peptidase C2, calpain familyPRINTSPR00704CALPAINcoord: 207..234
score: 55.71
coord: 182..205
score: 75.69
coord: 339..360
score: 61.36
coord: 50..73
score: 28.89
coord: 152..177
score: 66.54
coord: 391..408
score: 62.22
coord: 488..516
score: 56.09
coord: 92..114
score: 49.28
coord: 116..132
score: 69.02
IPR022683Peptidase C2, calpain, domain IIISMARTSM007202calcoord: 376..522
e-value: 3.4E-58
score: 209.3
IPR001300Peptidase C2, calpain, catalytic domainSMARTSM00230cys_prot_2coord: 47..371
e-value: 1.9E-161
score: 552.3
IPR001300Peptidase C2, calpain, catalytic domainPFAMPF00648Peptidase_C2coord: 66..361
e-value: 1.2E-125
score: 418.4
IPR001300Peptidase C2, calpain, catalytic domainPROSITEPS50203CALPAIN_CATcoord: 65..363
score: 76.527
IPR001300Peptidase C2, calpain, catalytic domainCDDcd00044CysPccoord: 55..361
e-value: 8.13432E-129
score: 383.22
IPR002048EF-hand domainSMARTSM00054efh_1coord: 638..666
e-value: 0.18
score: 20.9
coord: 608..636
e-value: 2.9
score: 14.1
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 687..705
score: 5.42
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 634..669
score: 12.198
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 227..372
e-value: 2.8E-49
score: 168.2
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 569..734
e-value: 3.4E-38
score: 133.1
NoneNo IPR availableGENE3DG3DSA:2.60.120.380coord: 376..525
e-value: 3.4E-50
score: 171.9
NoneNo IPR availablePANTHERPTHR10183CALPAINcoord: 48..699
NoneNo IPR availablePANTHERPTHR10183:SF396CALPAIN-A-RELATEDcoord: 48..699
IPR022682Peptidase C2, calpain, large subunit, domain IIIPFAMPF01067Calpain_IIIcoord: 384..518
e-value: 5.8E-44
score: 149.8
IPR000169Cysteine peptidase, cysteine active sitePROSITEPS00139THIOL_PROTEASE_CYScoord: 116..127
IPR033883Calpain subdomain IIICDDcd00214Calpain_IIIcoord: 375..524
e-value: 1.3864E-53
score: 179.802
IPR036213Calpain large subunit, domain III superfamilySUPERFAMILYSSF49758Calpain large subunit, middle domain (domain III)coord: 377..524
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 50..370
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 565..730