p2X purinoceptor 4

Overview
Namep2X purinoceptor 4
Smed IDSMED30013163
Length (bp)1387
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of p2X purinoceptor 4 (SMED30013163) t-SNE clustered cells

Violin plots show distribution of expression levels for p2X purinoceptor 4 (SMED30013163) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of p2X purinoceptor 4 (SMED30013163) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for p2X purinoceptor 4 (SMED30013163) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013163

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013163SMESG000046751.1 Contig1503GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30013163SMESG000046751.1 dd_Smed_v4_7729_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of p2X purinoceptor 4 vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 257.299 bits (656), Expect = 5.823e-81
Identity = 145/378 (38.36%), Postives = 213/378 (56.35%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEY 1194
            + CC  L A + +Y T +I +I++  +    R +Q  IL YV  +    +KGYQ++  + SSV  K KGV   + +     +WD+AD V+P QE N+LF+ TNV+ T NQTQG+CPE P    + CK+DA C         NG  TG+CV  +  +KTCE+ AWCP+E+DT     +  +K   N+T+L+KN I + + N  + N+    +     SCIY+A      +CPIF++   +     +   ++ V GGI+ + + W+CNLD     C P YSF RL T+      S G+NFR+A YY +    E R L K YG+R  I V GKA K       +N+GSG+ALL +AT++CD I+ + + KR  Y E  Y+Y
Sbjct:    2 AGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDA-TTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPA-FLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGHS-FQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKY 374          
BLAST of p2X purinoceptor 4 vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 246.899 bits (629), Expect = 7.470e-77
Identity = 145/394 (36.80%), Postives = 213/394 (54.06%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVF----------------IYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEY 1194
            + CC  L A + +Y T +I +I++  +    R +Q  IL YV                  +    +KGYQ++  + SSV  K KGV   + +     +WD+AD V+P QE N+LF+ TNV+ T NQTQG+CPE P    + CK+DA C         NG  TG+CV  +  +KTCE+ AWCP+E+DT     +  +K   N+T+L+KN I + + N  + N+    +     SCIY+A      +CPIF++   +     +   ++ V GGI+ + + W+CNLD     C P YSF RL T+      S G+NFR+A YY +    E R L K YG+R  I V GKA K       +N+GSG+ALL +AT++CD I+ + + KR  Y E  Y+Y
Sbjct:    2 AGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGCYHPHLAEVEMESPRRWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDA-TTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPA-FLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGHS-FQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKY 390          
BLAST of p2X purinoceptor 4 vs. Ensembl Human
Match: P2RX2 (purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:HGNC:15459])

HSP 1 Score: 233.802 bits (595), Expect = 8.941e-72
Identity = 136/359 (37.88%), Postives = 201/359 (55.99%), Query Frame = 1
Query:  106 DYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDS-YGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVN--ASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKY 1173
            DY T K+ V++N  +   +R +Q  ILLY   Y   ++K YQ+S  G  SS++ K KG+     T S+  +WD+ + V PP+  +   I T V  T++QTQG CPE+  V N+TC +DADC   ++  LGNG  TG+CV     P  KTCE+  WCP+E+      +   +   PN+T+LIKN+I + + +  + N+   T   +     + ASD    YCPIFK+  FI        TEL   GG+I VII W+C+LD     C P+YSF RL  K+   S G+NFR+A YY+ N    R L K YG+RI + V G+A K S     +N+ + +  + + + +CD+I+  F+ K + Y
Sbjct:   27 DYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGI-----TTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPS-KTCEVFGWCPVEDGASVSQFLGTM--APNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASD---LYCPIFKLG-FIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCDWILLTFMNKNKVY 373          
BLAST of p2X purinoceptor 4 vs. Ensembl Human
Match: P2RX2 (purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:HGNC:15459])

HSP 1 Score: 233.032 bits (593), Expect = 9.802e-71
Identity = 136/359 (37.88%), Postives = 201/359 (55.99%), Query Frame = 1
Query:  106 DYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDS-YGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVN--ASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKY 1173
            DY T K+ V++N  +   +R +Q  ILLY   Y   ++K YQ+S  G  SS++ K KG+     T S+  +WD+ + V PP+  +   I T V  T++QTQG CPE+  V N+TC +DADC   ++  LGNG  TG+CV     P  KTCE+  WCP+E+      +   +   PN+T+LIKN+I + + +  + N+   T   +     + ASD    YCPIFK+  FI        TEL   GG+I VII W+C+LD     C P+YSF RL  K+   S G+NFR+A YY+ N    R L K YG+RI + V G+A K S     +N+ + +  + + + +CD+I+  F+ K + Y
Sbjct:   27 DYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGI-----TTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPS-KTCEVFGWCPVEDGASVSQFLGTM--APNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASD---LYCPIFKLG-FIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCDWILLTFMNKNKVY 373          
BLAST of p2X purinoceptor 4 vs. Ensembl Human
Match: P2RX5 (purinergic receptor P2X 5 [Source:HGNC Symbol;Acc:HGNC:8536])

HSP 1 Score: 226.868 bits (577), Expect = 6.681e-69
Identity = 134/375 (35.73%), Postives = 196/375 (52.27%), Query Frame = 1
Query:   79 CNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQD-SYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIK-TCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGK-FSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYE 1191
            C  L  ++ DY T K  + +N  +   +R+LQA IL Y+ ++   +KKGYQD    L S+V+ K KGV F + ++  + +WD+AD V+P Q  N  F+ TN++ T NQ Q +C EN  + +  C  D+DC   + +  GNG  TG+C+      + TCEI AWCPLE  +  E     +KE  ++T+ IKN I F + N  +SN+          SC +   +    YCPIF++ S I     +D  ++ + GG+I + I WNC+LD     C P YSF RL  K  K  S G+NFR+A YY +    E R L K YG+R  + V GK    +FF                   CD ++ + + KRE Y +  YE
Sbjct:    6 CKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEE--PFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKN---HYCPIFRLGSVI-RWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKG---AFF-------------------CDLVLIYLIKKREFYRDKKYE 352          
BLAST of p2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 236.884 bits (603), Expect = 3.117e-73
Identity = 135/383 (35.25%), Postives = 208/383 (54.31%), Query Frame = 1
Query:   61 STCSSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYYERNN-KEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHD 1200
            S    CC+ +     DY T KI +I++  +    R  QA ++ YV  Y     KGYQD+  + SSV  K KG+   + +     +WD+AD ++PPQE  + F+ TN++ T NQTQ  C ENP    STC +  DC        G+G  TG+CV+ S  +KTCE+ +WCPLE    D     ++ +  N+TVLIKN I + + N  + N+    +      C++  S      CPIF++   +G   + D   + V+GG++ V I W+C+LD     C P Y+F RL  K      + G+NFR+A YY+ ++  E R L K YG+R  + V G+A K +     +N+G+G+ALL +  ++CD+I+  F+ +++ Y E  Y Y D
Sbjct:    2 SESVGCCDSVSQCFFDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTP-ASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEK-IVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVF--SRKTDPDCPIFRLGDIVGEAEE-DFQIMAVHGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNMGAGLALLGLVNVICDWIVLTFMKRKQHYKEQKYTYVD 379          
BLAST of p2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx1 (purinergic receptor P2X, ligand-gated ion channel, 1 [Source:ZFIN;Acc:ZDB-GENE-030319-1])

HSP 1 Score: 233.032 bits (593), Expect = 1.061e-71
Identity = 135/381 (35.43%), Postives = 208/381 (54.59%), Query Frame = 1
Query:  103 LDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLF-----TKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSV 1230
             +Y T +  +++N  +    RI+Q G+L Y+  +    +KGYQ       SV  K KGV F + +  +R+ WD+AD V P Q  ++  + TN + T  Q QG CPE P   N  C  D+DC   K    GNG MTG+C+N +   +TCEI +WCP+E+D    +   I+    NYT+ IKN+I F + +V RSNL     +    +C+Y+   + L  CPIF++   +   +    +E+   GG I V+I W+CNLD     C+P+Y F  L+      +  K S G+NFR+A YY  N+ + R L KV+G+RI I V G A K         +GSG+ +  +AT+VCD ++ + LPK+  Y  +  ++ D   C++ P++
Sbjct:   17 FEYETPREVLVKNRRVAIVCRIIQLGVLAYIIGWVFMYEKGYQTVDNAIGSVFTKMKGVSFTNISGQERI-WDVADYVFPEQGDSSFVVMTNFIPTIGQVQGKCPELPDGKNK-CTNDSDCDDSKYKRTGNGHMTGRCMNKT---QTCEIYSWCPVEDDRKIPD-PPILLTAENYTLFIKNSITFPQFDVVRSNLVEGIDQNYINNCVYHPKTAPL--CPIFRLGDIVER-SGFSFSEIARVGGAIGVLIDWDCNLDLSIRFCKPKYEFYGLYGTGKNDQVDKASLGYNFRFAKYYVENSVQKRTLMKVFGVRIDIIVHGLAGKFDIIPTLTAIGSGVGIFGVATVVCDLLLLYILPKKNFYKTM--KFKDAEICEETPAL 386          
BLAST of p2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx1 (purinergic receptor P2X, ligand-gated ion channel, 1 [Source:ZFIN;Acc:ZDB-GENE-030319-1])

HSP 1 Score: 233.032 bits (593), Expect = 1.240e-71
Identity = 135/381 (35.43%), Postives = 208/381 (54.59%), Query Frame = 1
Query:  103 LDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFT-----KYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSV 1230
             +Y T +  +++N  +    RI+Q G+L Y+  +    +KGYQ       SV  K KGV F + +  +R+ WD+AD V P Q  ++  + TN + T  Q QG CPE P   N  C  D+DC   K    GNG MTG+C+N +   +TCEI +WCP+E+D    +   I+    NYT+ IKN+I F + +V RSNL     +    +C+Y+   + L  CPIF++   +   +    +E+   GG I V+I W+CNLD     C+P+Y F  L+      +  K S G+NFR+A YY  N+ + R L KV+G+RI I V G A K         +GSG+ +  +AT+VCD ++ + LPK+  Y  +  ++ D   C++ P++
Sbjct:   17 FEYETPREVLVKNRRVAIVCRIIQLGVLAYIIGWVFMYEKGYQTVDNAIGSVFTKMKGVSFTNISGQERI-WDVADYVFPEQGDSSFVVMTNFIPTIGQVQGKCPELPDGKNK-CTNDSDCDDSKYKRTGNGHMTGRCMNKT---QTCEIYSWCPVEDDRKIPD-PPILLTAENYTLFIKNSITFPQFDVVRSNLVEGIDQNYINNCVYHPKTAPL--CPIFRLGDIVER-SGFSFSEIARVGGAIGVLIDWDCNLDLSIRFCKPKYEFYGLYGTGKNDQVDKASLGYNFRFAKYYVENSVQKRTLMKVFGVRIDIIVHGLAGKFDIIPTLTAIGSGVGIFGVATVVCDLLLLYILPKKNFYKTM--KFKDAEICEETPAL 386          
BLAST of p2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx1 (purinergic receptor P2X, ligand-gated ion channel, 1 [Source:ZFIN;Acc:ZDB-GENE-030319-1])

HSP 1 Score: 233.032 bits (593), Expect = 1.240e-71
Identity = 135/381 (35.43%), Postives = 208/381 (54.59%), Query Frame = 1
Query:  103 LDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFT-----KYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSV 1230
             +Y T +  +++N  +    RI+Q G+L Y+  +    +KGYQ       SV  K KGV F + +  +R+ WD+AD V P Q  ++  + TN + T  Q QG CPE P   N  C  D+DC   K    GNG MTG+C+N +   +TCEI +WCP+E+D    +   I+    NYT+ IKN+I F + +V RSNL     +    +C+Y+   + L  CPIF++   +   +    +E+   GG I V+I W+CNLD     C+P+Y F  L+      +  K S G+NFR+A YY  N+ + R L KV+G+RI I V G A K         +GSG+ +  +AT+VCD ++ + LPK+  Y  +  ++ D   C++ P++
Sbjct:   17 FEYETPREVLVKNRRVAIVCRIIQLGVLAYIIGWVFMYEKGYQTVDNAIGSVFTKMKGVSFTNISGQERI-WDVADYVFPEQGDSSFVVMTNFIPTIGQVQGKCPELPDGKNK-CTNDSDCDDSKYKRTGNGHMTGRCMNKT---QTCEIYSWCPVEDDRKIPD-PPILLTAENYTLFIKNSITFPQFDVVRSNLVEGIDQNYINNCVYHPKTAPL--CPIFRLGDIVER-SGFSFSEIARVGGAIGVLIDWDCNLDLSIRFCKPKYEFYGLYGTGKNDQVDKASLGYNFRFAKYYVENSVQKRTLMKVFGVRIDIIVHGLAGKFDIIPTLTAIGSGVGIFGVATVVCDLLLLYILPKKNFYKTM--KFKDAEICEETPAL 386          
BLAST of p2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx4b (purinergic receptor P2X, ligand-gated ion channel, 4b [Source:ZFIN;Acc:ZDB-GENE-030319-4])

HSP 1 Score: 231.106 bits (588), Expect = 5.285e-71
Identity = 132/368 (35.87%), Postives = 203/368 (55.16%), Query Frame = 1
Query:  100 VLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYYERN-NKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEY 1194
            + D+ T  I V+ +  + + FR+LQ  I++YV +Y  W K+ YQ+   + SSV  K KG    + +     +WD ++ V+PPQ  N+ F+ TN + T  QTQG CPE P  F + C++D+DC        GNG  TGKCV  S  IKTCE+ +WCPLENDT     + ++    ++TVLIKN I + +   ++ N+    +     +C +N       +CP+F++   + T +  D + + + GGII + I W+C+LD     C P+YSF RL  K      + G+NFRYA YY  N N E R L K +G+R  + V G A K +     +NVG+ +ALL +  ++CD+ M   L   E Y +  +++
Sbjct:   11 LFDHGTPVILVVSSKKVGFIFRLLQLCIIVYVAVYVCWYKRAYQERDSVISSVSTKVKGNILTNSSALGTHVWDTSEYVIPPQGENSFFVLTNAIVTQGQTQGSCPEIPSEF-TNCQSDSDCKEGLKEIRGNGVQTGKCVQYSETIKTCEVLSWCPLENDTVIPKPA-LLSAAEDFTVLIKNNIQYPKFKFRKRNILRHINSTYLKNCTFNHKTD--PHCPVFRLGDIV-TESGEDFSIMALKGGIIGIFIDWSCDLDFNERFCVPKYSFRRLDNKNPENNVAPGYNFRYAKYYMNNENTETRTLIKAFGIRFDVIVFGMAGKFNIVPTIVNVGAALALLNLMKVICDWFMLNCLSDSEYYSKHKFKH 373          
BLAST of p2X purinoceptor 4 vs. Ensembl Xenopus
Match: ENSXETT00000000163.1 (purinergic receptor P2X, ligand gated ion channel, 4 [Source:NCBI gene;Acc:100489363])

HSP 1 Score: 251.521 bits (641), Expect = 1.344e-78
Identity = 146/377 (38.73%), Postives = 212/377 (56.23%), Query Frame = 1
Query:   73 SCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKY--GKFSKGWNFRYANYYERNNK-EHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEY 1194
             CC  + + + DY T +IA+I++  I +  R +Q GIL YV  +    +KGYQ+   + SSV  K KGV   + +     +WD+AD ++P QE NA F+ TN++ T NQTQG CPE P   NS C     C    +    NG  TGKCV  +  + TCEI AWCP+ENDT   + +  +    N+TVLIKN I + +    + N+ +  S     SC Y+  +    +CPIF++ S +    +T   ++ V GG++ + I W+C+LD K  +C P+YSF RL  +      S G+NFR+A Y++ +N  E R+L KVYG+R  I V G A K       +N+GSG AL  +AT++CD I+  F  KR  Y E  Y+Y
Sbjct:   16 GCCGQVYSCIFDYDTPRIALIKSRKIGFLNRFIQLGILAYVIGWVFIWEKGYQEFDTVVSSVTSKVKGVAVTNTSELGVKIWDVADYIIPAQEENAFFVMTNLILTQNQTQGYCPELPE--NSVCSEKQPCTPGYVGKQSNGVQTGKCVPYNSTVNTCEIFAWCPVENDTHVPDPA-FLNGAENFTVLIKNNIWYPKFQAFKRNILSNISSSYLKSCQYDKVNH--PFCPIFRLGSIVKEAGET-FRDMAVQGGVMGIQINWDCDLDWKLTYCVPKYSFRRLDNREIDHNVSPGYNFRFAKYFKDSNGVESRSLMKVYGIRFDILVFGTAGKFDIIPTMINIGSGAALFGVATVLCDMIVFHFFKKRHYYREKKYKY 386          
BLAST of p2X purinoceptor 4 vs. Ensembl Xenopus
Match: ENSXETT00000000415.1 (purinergic receptor P2X, ligand gated ion channel, 4 [Source:NCBI gene;Acc:100489363])

HSP 1 Score: 244.973 bits (624), Expect = 2.683e-76
Identity = 145/377 (38.46%), Postives = 211/377 (55.97%), Query Frame = 1
Query:   73 SCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKY--GKFSKGWNFRYANYYERNNK-EHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEY 1194
             CC  + + + DY T +IA+I++  I +  R +Q GIL YV  +    +KGYQ+   + SSV  K KGV   + +     +WD+AD ++P  E NA F+ TN++ T NQTQG CPE P   NS C     C    +    NG  TGKCV  +  + TCEI AWCP+ENDT   + +  +    N+TVLIKN I + +    + N+ +  S     SC Y+  +    +CPIF++ S +    +T   ++ V GG++ + I W+C+LD K  +C P+YSF RL  +      S G+NFR+A Y++ +N  E R+L KVYG+R  I V G A K       +N+GSG AL  +AT++CD I+  F  KR  Y E  Y+Y
Sbjct:    6 GCCGQVYSCIFDYDTPRIALIKSRKIGFLNRFIQLGILAYVIGWVFIWEKGYQEFDTVVSSVTSKVKGVAVTNTSELGVKIWDVADYIIP--EENAFFVMTNLILTQNQTQGYCPELPE--NSVCSEKQPCTPGYVGKQSNGVQTGKCVPYNSTVNTCEIFAWCPVENDTHVPDPA-FLNGAENFTVLIKNNIWYPKFQAFKRNILSNISSSYLKSCQYDKVNH--PFCPIFRLGSIVKEAGET-FRDMAVQGGVMGIQINWDCDLDWKLTYCVPKYSFRRLDNREIDHNVSPGYNFRFAKYFKDSNGVESRSLMKVYGIRFDILVFGTAGKFDIIPTMINIGSGAALFGVATVLCDMIVFHFFKKRHYYREKKYKY 374          
BLAST of p2X purinoceptor 4 vs. Ensembl Xenopus
Match: ENSXETT00000000980.1 (purinergic receptor P2X, ligand gated ion channel, 4 [Source:NCBI gene;Acc:100489363])

HSP 1 Score: 240.35 bits (612), Expect = 1.198e-74
Identity = 143/377 (37.93%), Postives = 210/377 (55.70%), Query Frame = 1
Query:   73 SCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKY--GKFSKGWNFRYANYYERNNK-EHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEY 1194
             CC  + + + DY T +IA+I++  I +  R +Q GIL YV  +    +KGYQ+   + SSV  K KGV   + +     +WD+AD ++P QE NA F+ TN++ T NQTQG CPEN ++       DA            G  TGKCV  +  + TCEI AWCP+ENDT   + +  +    N+TVLIKN I + +    + N+ +  S     SC Y+  +    +CPIF++ S +    +T   ++ V GG++ + I W+C+LD K  +C P+YSF RL  +      S G+NFR+A Y++ +N  E R+L KVYG+R  I V G A K       +N+GSG AL  +AT++CD I+  F  KR  Y E  Y+Y
Sbjct:    5 GCCGQVYSCIFDYDTPRIALIKSRKIGFLNRFIQLGILAYVIGWVFIWEKGYQEFDTVVSSVTSKVKGVAVTNTSELGVKIWDVADYIIPAQEENAFFVMTNLILTQNQTQGYCPENILLNILLFLPDA------------GVQTGKCVPYNSTVNTCEIFAWCPVENDTHVPDPA-FLNGAENFTVLIKNNIWYPKFQAFKRNILSNISSSYLKSCQYDKVNH--PFCPIFRLGSIVKEAGET-FRDMAVQGGVMGIQINWDCDLDWKLTYCVPKYSFRRLDNREIDHNVSPGYNFRFAKYFKDSNGVESRSLMKVYGIRFDILVFGTAGKFDIIPTMINIGSGAALFGVATVLCDMIVFHFFKKRHYYREKKYKY 365          
BLAST of p2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 236.884 bits (603), Expect = 3.461e-73
Identity = 135/392 (34.44%), Postives = 211/392 (53.83%), Query Frame = 1
Query:  103 LDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDS-YGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCV--NASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGK--FSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSVNMAINEHFPP 1260
             DY T K  + +N  +   FR++Q  IL Y+  +   +KKGYQ++   + SS++ K KGV F + +     LWD+ D V+PPQ  N  F+ TN++ T NQ Q  CPE+  + ++ C  ++DCP  + +  GNG  TG+C+   A     TCEI AWCP+E     +  + ++ +  N+TV IKN+I F + +  ++N+    +     +C Y+  D    YCPIF +   + +   ++   + + GG+I + I WNCNLD     C P YSF RL  K+ +   S G+NFR+A YY + N  ++R L K YG+R  I V GKA K +     +N+GSG+ALL      CD ++ + + K   Y +  +E  ++  C +          HFPP
Sbjct:   14 FDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKK--KPKTPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDD---HYCPIFHLGKIV-SWAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSNFYRDKKFE--EVKRCLR----------HFPP 387          
BLAST of p2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 237.269 bits (604), Expect = 6.579e-73
Identity = 135/394 (34.26%), Postives = 213/394 (54.06%), Query Frame = 1
Query:   88 LRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDS-YGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCV--NASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGK--FSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSVNMAINEH 1251
            L  +  DY T K  + +N  +   FR++Q  IL Y+  +   +KKGYQ++   + SS++ K KGV F + +     LWD+ D V+PPQ  N  F+ TN++ T NQ Q  CPE+  + ++ C  ++DCP  + +  GNG  TG+C+   A     TCEI AWCP+E     +  + ++ +  N+TV IKN+I F + +  ++N+    +     +C Y+  D    YCPIF +   + +   ++   + + GG+I + I WNCNLD     C P YSF RL  K+ +   S G+NFR+A YY + N  ++R L K YG+R  I V GKA K +     +N+GSG+ALL      CD ++ + + K   Y +  +E  ++N     P + + I  H
Sbjct:    9 LFLSFFDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKK--KPKTPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDD---HYCPIFHLGKIV-SWAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSNFYRDKKFE--EVNKGTPHPPMFLCIYSH 394          
BLAST of p2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 258.07 bits (658), Expect = 1.695e-81
Identity = 145/361 (40.17%), Postives = 208/361 (57.62%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIM 1143
            + CC++LRA + +Y T +I +I++  +    R++Q  IL YV  +    +KGYQ++  + SSV  K KGV   + +     +WD+AD VVP QE N+LFI TN++ T NQTQG CPE P    S C +DA+C +       +G  TG+CV  +  +KTCE+ AWCP+END      +  +K   N+T+L+KN I + + N  + N+    +     SCIYNA      +CPIF++   +     +   E+ V GGI+ + I W+CNLD    HC P YSF RL T+      S G+NFR+A YY +    E R L K YG+R  I V GKA K       +NVGSG+ALL +AT++CD I+
Sbjct:    2 AGCCSVLRAFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDK-TSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVPTPA-FLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTD--PFCPIFRLGQIVADAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIV 357          
BLAST of p2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 236.884 bits (603), Expect = 1.167e-73
Identity = 142/361 (39.34%), Postives = 197/361 (54.57%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIM 1143
            + CC++LRA + +Y T +I +I++  +    R++Q  IL YV  +    +KGYQ++  + SSV  K KGV   + +     +WD+AD VVP QE N+LFI TN++ T NQTQG CPE P    S C +DA+C +       +G  TG+CV  +  +KTCE+ AWCP+END            VP   +L          N+  S L          SCIYNA      +CPIF++   +     +   E+ V GGI+ + I W+CNLD    HC P YSF RL T+      S G+NFR+A YY +    E R L K YG+R  I V GKA K       +NVGSG+ALL +AT++CD I+
Sbjct:    2 AGCCSVLRAFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDK-TSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDA----------GVPTRNIL---------PNITTSYL---------KSCIYNARTD--PFCPIFRLGQIVADAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIV 330          
BLAST of p2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx2 (purinergic receptor P2X, ligand-gated ion channel, 2 [Source:MGI Symbol;Acc:MGI:2665170])

HSP 1 Score: 232.261 bits (591), Expect = 4.077e-71
Identity = 143/404 (35.40%), Postives = 218/404 (53.96%), Query Frame = 1
Query:  106 DYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDS-YGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNA-SPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNN-KEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSVNMAINEHF---PPIKEPLINNPISEE 1299
            DY T K+ V++N  + +  R++Q  ILLY   Y   ++K YQDS  G  SS++ K KG+     T S+  +WD+ + V PP+  + + I T +  T +QT G CPE+  V +STC  D DC   ++   GNG  TG+CV     D KTCE+ AWCP+E+ T + ++  + K  PN+T+LIKN+I + +    + N+ +  S+ +        SD    YCPIF++  FI      + TEL   GG+I VII WNC+LD     C P+YSF RL  KY   S G+NFR+A YY+ N     R L K YG+RI + V G+A K S     +N+ + +  + + + +CD+I+  F+ K + Y    ++            V   +++H    PP+ EP   +  S +
Sbjct:   28 DYETPKVIVVRNRRLGFVHRMVQLLILLYFVWYVFIVQKSYQDSETGPESSIITKVKGI-----TMSEHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHLDDDCVAGQLDMQGNGIRTGRCVPYYHGDSKTCEVSAWCPVEDGTSENHF--LGKMAPNFTILIKNSIHYPKFKFSKGNIASQKSDYLKHCTFDQDSDP---YCPIFRLG-FIVEQAGENFTELAHKGGVIGVIINWNCDLDLSESECNPKYSFRRLDPKYDPASSGYNFRFAKYYKINGTTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSIGVGSFLCDWILLTFMNKNKLYSHKKFD-----------KVVDTLDQHMGQRPPVPEPSQQDSTSTD 409          
BLAST of p2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 230.335 bits (586), Expect = 5.840e-71
Identity = 132/334 (39.52%), Postives = 189/334 (56.59%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKL 1062
            + CC++LRA + +Y T +I +I++  +    R++Q  IL YV  +    +KGYQ++  + SSV  K KGV   + +     +WD+AD VVP QE N+LFI TN++ T NQTQG CPE P    S C +DA+C +       +G  TG+CV  +  +KTCE+ AWCP+END      +  +K   N+T+L+KN I + + N  + N+    +     SCIYNA      +CPIF++   +     +   E+ V GGI+ + I W+CNLD    HC P YSF RL T+      S G+NFR+A YY +    E R L K YG+R  I V GKA  L
Sbjct:    2 AGCCSVLRAFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDK-TSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVPTPA-FLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTD--PFCPIFRLGQIVADAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKATVL 330          
BLAST of p2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx2 (purinergic receptor P2X, ligand-gated ion channel, 2 [Source:MGI Symbol;Acc:MGI:2665170])

HSP 1 Score: 230.335 bits (586), Expect = 1.290e-70
Identity = 136/359 (37.88%), Postives = 203/359 (56.55%), Query Frame = 1
Query:  106 DYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDS-YGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNA-SPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNN-KEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKY 1173
            DY T K+ V++N  + +  R++Q  ILLY   Y   ++K YQDS  G  SS++ K KG+     T S+  +WD+ + V PP+  + + I T +  T +QT G CPE+  V +STC  D DC   ++   GNG  TG+CV     D KTCE+ AWCP+E+ T + ++  + K  PN+T+LIKN+I + +    + N+ +  S+ +        SD    YCPIF++  FI      + TEL   GG+I VII WNC+LD     C P+YSF RL  KY   S G+NFR+A YY+ N     R L K YG+RI + V G+A K S     +N+ + +  + + + +CD+I+  F+ K + Y
Sbjct:   28 DYETPKVIVVRNRRLGFVHRMVQLLILLYFVWYVFIVQKSYQDSETGPESSIITKVKGI-----TMSEHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHLDDDCVAGQLDMQGNGIRTGRCVPYYHGDSKTCEVSAWCPVEDGTSENHF--LGKMAPNFTILIKNSIHYPKFKFSKGNIASQKSDYLKHCTFDQDSDP---YCPIFRLG-FIVEQAGENFTELAHKGGVIGVIINWNCDLDLSESECNPKYSFRRLDPKYDPASSGYNFRFAKYYKINGTTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSIGVGSFLCDWILLTFMNKNKLY 375          
BLAST of p2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q99571|P2RX4_HUMAN (P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX4 PE=1 SV=2)

HSP 1 Score: 257.299 bits (656), Expect = 2.796e-80
Identity = 145/378 (38.36%), Postives = 213/378 (56.35%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEY 1194
            + CC  L A + +Y T +I +I++  +    R +Q  IL YV  +    +KGYQ++  + SSV  K KGV   + +     +WD+AD V+P QE N+LF+ TNV+ T NQTQG+CPE P    + CK+DA C         NG  TG+CV  +  +KTCE+ AWCP+E+DT     +  +K   N+T+L+KN I + + N  + N+    +     SCIY+A      +CPIF++   +     +   ++ V GGI+ + + W+CNLD     C P YSF RL T+      S G+NFR+A YY +    E R L K YG+R  I V GKA K       +N+GSG+ALL +AT++CD I+ + + KR  Y E  Y+Y
Sbjct:    2 AGCCAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDA-TTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPA-FLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGHS-FQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKY 374          
BLAST of p2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q9JJX6|P2RX4_MOUSE (P2X purinoceptor 4 OS=Mus musculus OX=10090 GN=P2rx4 PE=1 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 4.644e-79
Identity = 143/361 (39.61%), Postives = 207/361 (57.34%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIM 1143
            + CC++L + + +Y T +I +I++  +    R++Q  IL YV  +    +KGYQ++  + SSV  K KGV   + +     +WD+AD VVP QE N+LFI TN++ T NQTQG CPE P    S C +DA+C +       +G  TG+CV  +  +KTCE+ AWCP+END      +  +K   N+T+L+KN I + + N  + N+    +     SCIYNA      +CPIF++   +     +   E+ V GGI+ + I W+CNLD    HC P YSF RL T+      S G+NFR+A YY +    E R L K YG+R  I V GKA K       +NVGSG+ALL +AT++CD I+
Sbjct:    2 AGCCSVLGSFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDK-TSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGVPTPA-FLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTD--PFCPIFRLGQIVADAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIV 357          
BLAST of p2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q5E9U1|P2RX4_BOVIN (P2X purinoceptor 4 OS=Bos taurus OX=9913 GN=P2RX4 PE=2 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 2.526e-78
Identity = 140/361 (38.78%), Postives = 210/361 (58.17%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIM 1143
            + CC +L A + +Y T +I +I++  +    R +Q  IL YV  +    +KGYQ++  + SSV VK KGV   + +     +WD+AD V+P QE N++FI TN+V T NQTQG+CPE P    + C+TDA+C         +G  TG+CV+ +  +KTCE+ AWCP+E+DT +      +K   N+T+L+KN I + + N  + N+    +     +CIY+A      +CPIF++   + +   +   ++ + GGI+ + I WNCNLD     C P YSF RL T+      S G+NFR+A YY +    EHR L K YG+R  I V GKA K       +N+GSG+ALL +AT++CD I+
Sbjct:    2 TGCCTVLGAFLFEYDTPRIVLIRSRKVGLMNRTVQLLILAYVIGWVFVWEKGYQETDSVVSSVTVKAKGVTMTNTSKLGFRIWDVADYVIPAQEENSVFIMTNMVITMNQTQGLCPEIPGK-TTVCETDANCTAGSAGTHSSGVATGRCVSFNGTLKTCEVAAWCPVEDDT-EVPKPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTAYLKTCIYDAKTD--PFCPIFRLGKIVESAGHS-FQDIAIEGGIMGIQIKWNCNLDRAASFCLPRYSFRRLDTRDLAHNVSPGYNFRFAKYYSDLKGAEHRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGVATVLCDVIV 357          
BLAST of p2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|P51577|P2RX4_RAT (P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2rx4 PE=1 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 2.272e-77
Identity = 142/361 (39.34%), Postives = 206/361 (57.06%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIM 1143
            + CC++L + + +Y T +I +I++  +    R +Q  IL YV  +    +KGYQ++  + SSV  K KGV   + +     +WD+AD V+P QE N+LFI TN++ T NQTQ  CPE P    S C +DADC    +    +G  TG+CV  +  +KTCE+ AWCP+END      +  +K   N+T+L+KN I + + N  + N+    +     SCIYNA      +CPIF++ + +     +   E+ V GGI+ + I W+CNLD     C P YSF RL T+      S G+NFR+A YY +   KE R L K YG+R  I V GKA K       +NVGSG+ALL +AT++CD I+
Sbjct:    2 AGCCSVLGSFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVIPAQEENSLFIMTNMIVTVNQTQSTCPEIPDK-TSICNSDADCTPGSVDTHSSGVATGRCVPFNESVKTCEVAAWCPVENDVGVPTPA-FLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNAQTD--PFCPIFRLGTIVEDAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASLCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGKEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIV 357          
BLAST of p2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q9UBL9|P2RX2_HUMAN (P2X purinoceptor 2 OS=Homo sapiens OX=9606 GN=P2RX2 PE=1 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 4.707e-70
Identity = 136/359 (37.88%), Postives = 201/359 (55.99%), Query Frame = 1
Query:  106 DYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDS-YGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVN--ASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKY 1173
            DY T K+ V++N  +   +R +Q  ILLY   Y   ++K YQ+S  G  SS++ K KG+     T S+  +WD+ + V PP+  +   I T V  T++QTQG CPE+  V N+TC +DADC   ++  LGNG  TG+CV     P  KTCE+  WCP+E+      +   +   PN+T+LIKN+I + + +  + N+   T   +     + ASD    YCPIFK+  FI        TEL   GG+I VII W+C+LD     C P+YSF RL  K+   S G+NFR+A YY+ N    R L K YG+RI + V G+A K S     +N+ + +  + + + +CD+I+  F+ K + Y
Sbjct:   27 DYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGI-----TTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPS-KTCEVFGWCPVEDGASVSQFLGTM--APNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASD---LYCPIFKLG-FIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCDWILLTFMNKNKVY 373          
BLAST of p2X purinoceptor 4 vs. TrEMBL
Match: A0A267EI98 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018619g1 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 9.535e-87
Identity = 151/365 (41.37%), Postives = 215/365 (58.90%), Query Frame = 1
Query:  109 YPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQ--RVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNAS--PDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYE 1191
            Y T K+  I +  +   +R++Q  I+ YV  + +  KKGYQD   + S V  K KGV + + T +     +WD+AD VVPPQE NA FITTN V T +QTQG C E+P V  + C +DADCP  K   LGNG  TG+CV +S  P+  +CEI AWCP+E D        +  E  N+TVLIK++I F    V+R N+    +     +C+YN    +  YCP+F++   +      + T++   GG++ + + W+CNLD    +C P Y F RL  +  K +KGWNFRYANYY  N+ +HR L K YGLR ++ V G+A + +   L+MN+GSG+ALL IAT++CD I+ +   K+  Y    YE
Sbjct:   24 YETSKVVQISSIKVSVIYRLIQLLIIAYVIGWVVVYKKGYQDFDDVVSGVTTKVKGVQYTNLTGTSIGARIWDVADYVVPPQENNAFFITTNAVVTRDQTQGACDEDPSV--APCFSDADCPAGKPQMLGNGVNTGRCVPSSQAPNKTSCEILAWCPVEVDQLPAG-GTMFPEAVNFTVLIKDSIEFPLFGVKRRNVLDYYNSSQLQNCVYNPDTDM--YCPVFRIGDILKLAGIDNFTKIATVGGVVSITVNWDCNLDWDASYCNPTYRFRRLDDENTKIAKGWNFRYANYYRINDTDHRTLIKAYGLRFVVYVTGRAGRFNVIPLTMNLGSGLALLGIATVLCDMIVLYLHHKKVIYRGAKYE 383          
BLAST of p2X purinoceptor 4 vs. TrEMBL
Match: A0A267GN82 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018619g2 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 9.638e-87
Identity = 151/365 (41.37%), Postives = 215/365 (58.90%), Query Frame = 1
Query:  109 YPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQ--RVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNAS--PDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYE 1191
            Y T K+  I +  +   +R++Q  I+ YV  + +  KKGYQD   + S V  K KGV + + T +     +WD+AD VVPPQE NA FITTN V T +QTQG C E+P V  + C +DADCP  K   LGNG  TG+CV +S  P+  +CEI AWCP+E D        +  E  N+TVLIK++I F    V+R N+    +     +C+YN    +  YCP+F++   +      + T++   GG++ + + W+CNLD    +C P Y F RL  +  K +KGWNFRYANYY  N+ +HR L K YGLR ++ V G+A + +   L+MN+GSG+ALL IAT++CD I+ +   K+  Y    YE
Sbjct:   24 YETSKVVQISSIKVSVIYRLIQLLIIAYVIGWVVVYKKGYQDFDDVVSGVTTKVKGVQYTNLTGTSIGARIWDVADYVVPPQENNAFFITTNAVVTRDQTQGACDEDPSV--APCFSDADCPAGKPQMLGNGVNTGRCVPSSQAPNKTSCEILAWCPVEVDQLPAG-GTMFPEAVNFTVLIKDSIEFPLFGVKRRNVLDYYNSSQLQNCVYNPDTDM--YCPVFRIGDILKLAGIDNFTKIATVGGVVSITVNWDCNLDWDASYCNPTYRFRRLDDENTKIAKGWNFRYANYYRINDTDHRTLIKAYGLRFVVYVTGRAGRFNVIPLTMNLGSGLALLGIATVLCDMIVLYLHHKKVIYRGAKYE 383          
BLAST of p2X purinoceptor 4 vs. TrEMBL
Match: A0A0R3W512 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5180 PE=4 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 9.274e-86
Identity = 144/364 (39.56%), Postives = 219/364 (60.16%), Query Frame = 1
Query:   94 ANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQ--RVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNAS--PDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKY 1173
            +N+ DY T K+  I +  I + +R++Q GI+LYV ++ ++ +KGYQ      S V  K KG+ F+++TNS    ++WD AD V+PPQ+ +A F+ TN+V T  QT G C E+  V  S CK+D DC   +I+ +G+G  TG CV ++   ++  CEI  WCP E D    +Y  I+   PN+TV++KN+I F + NV+R N+ +   +   ++C YN ++  +KYCPIF+++  I      +  ++   GG++ + I WNCNLD   + C P+Y+F RL        KGWNFR++++Y  +    R L K YG++  I V GK  K    T SMN+GSG+ALL IAT++CD I+     KRE Y
Sbjct:   14 SNLFDYETQKVVQINSFKIGFTYRLIQLGIVLYVVLWVMYHEKGYQAFDEAVSGVTAKLKGIAFSNQTNSNLGAIVWDAADYVIPPQQRSAFFVMTNLVTTLGQTLGTCEESHDVAGSGCKSDKDCEAGRIVMIGSGVQTGVCVPSTRKANLSVCEIYGWCPTEYDVLPSDY--ILTNAPNFTVMLKNSIEFPKYNVKRRNILSWMDKHFLSTCRYNPNNEKMKYCPIFRLAD-IMEYTKAENKQIWNKGGMVSIHIEWNCNLDYNEEQCLPKYTFRRLDDFDNPVGKGWNFRFSHHYIEDKVHKRNLIKAYGIQFFITVYGKGGKFHLLTFSMNLGSGLALLGIATVLCDNIVLNVTKKREIY 374          
BLAST of p2X purinoceptor 4 vs. TrEMBL
Match: A0A2C9M458 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106075112 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 2.141e-85
Identity = 157/384 (40.89%), Postives = 234/384 (60.94%), Query Frame = 1
Query:   73 SCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRV---LWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVN-ASPDIKTCEIRAWCPLENDTFDENYSN-IIKEVPNYTVLIKNTIIFDEVNVQRSN---LFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYY--ERNN--KEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVY 1188
            S C+ + + + +Y T +I  I++  + +  R LQ  IL Y+  Y +  KKGYQ+     S++  K KGV F++ ++   +    WD+AD V+PPQE+ A F+ TNV+ T NQTQ  CPE+P +  S C  D+ CP  KIL  GNGP TGKCVN A+     CEI  WC +E+D+  +N ++ ++    N+T+ IKN I F +  V+R N   L+A  +E+  + C +N +++L KYCPIF +   +  IN+ D   L + GG+I V+I W+CNLD   D C PEYSF+RL       S+G+NFRYA+YY  + N+  K++R L+K  G+  +I V+GKA K S   L +N GSG+ALL + T++CD I+ + L  ++ Y E  Y
Sbjct:   12 SVCSCVASTLFEYYTPRIVHIKSKKVGFINRFLQLVILSYIIGYVIVYKKGYQEFDTCQSAITTKLKGVVFSNLSHLSDIGVRTWDVADYVIPPQEIGATFVMTNVIPTLNQTQSTCPEDPTIDGSFCIDDSSCPQGKILDKGNGPFTGKCVNSANEKSHVCEIYGWCLVEDDSRYKNMTDPVLSGSHNFTMFIKNNIEFPKFGVRRRNILDLYANDTEL--SDCRWNRTNALSKYCPIFLLDDIVKDINE-DYNHLALQGGVIEVVINWDCNLDFSVDDCLPEYSFKRLDRGDYSISRGFNFRYADYYAVKENDTFKQYRNLYKATGIIFVINVQGKAGKFSIIPLLLNFGSGLALLALTTVICDLIVLYVLKAKKYYREHKY 392          
BLAST of p2X purinoceptor 4 vs. TrEMBL
Match: A0A1I8J6R2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 3.576e-85
Identity = 151/365 (41.37%), Postives = 215/365 (58.90%), Query Frame = 1
Query:  109 YPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQ--RVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNAS--PDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYE 1191
            Y T K+  I +  +   +R++Q  I+ YV  + +  KKGYQD   + S V  K KGV + + T +     +WD+AD VVPPQE NA FITTN V T +QTQG C E+P V  + C +DADCP  K   LGNG  TG+CV +S  P+  +CEI AWCP+E D        +  E  N+TVLIK++I F    V+R N+    +     +C+YN    +  YCP+F++   +      + T++   GG++ + + W+CNLD    +C P Y F RL  +  K +KGWNFRYANYY  N+ +HR L K YGLR ++ V G+A + +   L+MN+GSG+ALL IAT++CD I+ +   K+  Y    YE
Sbjct:   24 YETSKVVQISSIKVSVIYRLIQLLIIAYVIGWVVVYKKGYQDFDDVVSGVTTKVKGVQYTNLTGTSIGARIWDVADYVVPPQENNAFFITTNAVVTRDQTQGACDEDPSV--APCFSDADCPAGKPQMLGNGVNTGRCVPSSQAPNKTSCEILAWCPVEVDQLPAG-GTMFPEAVNFTVLIKDSIEFPLFGVKRRNVLDYYNSSQLQNCVYNPDTDM--YCPVFRIGDILKLAGIDNFTKIAT-GGVVSITVNWDCNLDWDASYCNPTYRFRRLDDENTKIAKGWNFRYANYYRINDTDHRTLIKAYGLRFVVYVTGRAGRFNVIPLTMNLGSGLALLGIATVLCDMIVLYLHHKKVIYRGAKYE 382          
BLAST of p2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 248.44 bits (633), Expect = 4.010e-77
Identity = 147/389 (37.79%), Postives = 219/389 (56.30%), Query Frame = 1
Query:   52 SMKSTCSSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLG--NGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYS-NIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYYERNNKEH-RALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHD 1200
            +M ++  +CC  L     DY T K  VI++  +    R+ QA ++ Y+  Y    KKGYQD+  + SSV  K KG+   + ++    +WD+AD ++PPQE N+ F+ TN+  T NQTQ  CPENP    S+C +D DC  KK    G  +G  TG+CV+ S  IKTCE+ AWCPLE   +DE     ++ E  N+TVLIKN++ + + N  R N+    +    + C++  S      CPIF++   +    + D   + V+GG++ V I W+C+LD   + C P Y+F RL  K      + G+NFR+A YY+ +N E  R L K YG+R  I V GKA K +     +N+G+G+ L+ + T+VCD+ +  F+ KR  Y E  Y Y D
Sbjct:   63 TMAASDKNCCVSLTRCFFDYSTPKTLVIRSKTVGAINRLCQALVIAYIIGYVCVWKKGYQDTDTVISSVTTKVKGIALTNTSDLGTRIWDVADYIIPPQEENSFFVLTNLNITPNQTQSHCPENPGP-ESSCSSDQDC--KKGFRNGRLSGVRTGRCVHFSERIKTCEVLAWCPLEK--YDEPPDPPMLAEAENFTVLIKNSVRYPKFNFSRRNILPHINSTYLSKCVF--SRDTDPDCPIFRLRDIVAEAGE-DFQAMAVHGGVMGVQIRWDCDLDMPANWCVPRYTFRRLDNKDPENNVAPGYNFRFAKYYKSSNGEEIRTLIKGYGIRFDIMVFGKAGKFNVVPTLLNIGAGLGLMGLVTVVCDWFVLVFMRKRHLYRERKYSYVD 443          
BLAST of p2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 248.054 bits (632), Expect = 2.960e-76
Identity = 147/389 (37.79%), Postives = 219/389 (56.30%), Query Frame = 1
Query:   52 SMKSTCSSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLG--NGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYS-NIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTK--YGKFSKGWNFRYANYYERNNKEH-RALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHD 1200
            +M ++  +CC  L     DY T K  VI++  +    R+ QA ++ Y+  Y    KKGYQD+  + SSV  K KG+   + ++    +WD+AD ++PPQE N+ F+ TN+  T NQTQ  CPENP    S+C +D DC  KK    G  +G  TG+CV+ S  IKTCE+ AWCPLE   +DE     ++ E  N+TVLIKN++ + + N  R N+    +    + C++  S      CPIF++   +    + D   + V+GG++ V I W+C+LD   + C P Y+F RL  K      + G+NFR+A YY+ +N E  R L K YG+R  I V GKA K +     +N+G+G+ L+ + T+VCD+ +  F+ KR  Y E  Y Y D
Sbjct:   63 TMAASDKNCCVSLTRCFFDYSTPKTLVIRSKTVGAINRLCQALVIAYIIGYVCVWKKGYQDTDTVISSVTTKVKGIALTNTSDLGTRIWDVADYIIPPQEENSFFVLTNLNITPNQTQSHCPENPGP-ESSCSSDQDC--KKGFRNGRLSGVRTGRCVHFSERIKTCEVLAWCPLEK--YDEPPDPPMLAEAENFTVLIKNSVRYPKFNFSRRNILPHINSTYLSKCVF--SRDTDPDCPIFRLRDIVAEAGE-DFQAMAVHGGVMGVQIRWDCDLDMPANWCVPRYTFRRLDNKDPENNVAPGYNFRFAKYYKSSNGEEIRTLIKGYGIRFDIMVFGKAGKFNVVPTLLNIGAGLGLMGLVTVVCDWFVLVFMRKRHLYRERKYSYVD 443          
BLAST of p2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:103022360])

HSP 1 Score: 239.195 bits (609), Expect = 2.864e-74
Identity = 136/370 (36.76%), Postives = 202/370 (54.59%), Query Frame = 1
Query:  103 LDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGK-FSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINN 1209
             +Y T +  +++N  +    R++Q G+L+Y+  +    +KGYQ       SV  K KGV + + +  Q+V WD++D V P Q   +  + TN + T  QTQ  CPE P   N TC +D DC   +    GNG MTGKCVN +    TCEI +WCP+E+D    +   ++    NYT+ IKN+I F E NV RSNL     +    +C+++     L  CPIFK+   I   +  + T++   GG I ++I W CNLD +   C P+Y F  L+    +  S G+NFR A YY  +  E R L KV+GLRI I V G ARK         +GSG+ +  +AT+VCD ++ + LPKR+ Y  + ++Y  + +
Sbjct:   14 FEYETPRQVLVRNRRVGVVCRLIQLGVLVYIIGWVFIYEKGYQTEDTAIGSVFTKMKGVAYTNISGEQKV-WDVSDYVYPDQGAESFVVMTNFIITVGQTQSTCPELPDGKN-TCHSDEDCKKGEFKRTGNGEMTGKCVNTT---NTCEIMSWCPVEDDRQIPD-PPLLLAAENYTLFIKNSITFPEFNVVRSNLVEGVDQNYIKTCMFHPEKDPL--CPIFKLGD-IAQYSGFNFTQIAQGGGAIGILIDWECNLDLRIQKCIPKYRFHGLYGSSSEGASVGYNFRKAKYYVEDKVEKRTLMKVFGLRIDIIVHGLARKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYLLPKRDFYKNMKFKYTTVQD 374          
BLAST of p2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:103022360])

HSP 1 Score: 239.195 bits (609), Expect = 2.913e-74
Identity = 136/370 (36.76%), Postives = 202/370 (54.59%), Query Frame = 1
Query:  103 LDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGK-FSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINN 1209
             +Y T +  +++N  +    R++Q G+L+Y+  +    +KGYQ       SV  K KGV + + +  Q+V WD++D V P Q   +  + TN + T  QTQ  CPE P   N TC +D DC   +    GNG MTGKCVN +    TCEI +WCP+E+D    +   ++    NYT+ IKN+I F E NV RSNL     +    +C+++     L  CPIFK+   I   +  + T++   GG I ++I W CNLD +   C P+Y F  L+    +  S G+NFR A YY  +  E R L KV+GLRI I V G ARK         +GSG+ +  +AT+VCD ++ + LPKR+ Y  + ++Y  + +
Sbjct:   14 FEYETPRQVLVRNRRVGVVCRLIQLGVLVYIIGWVFIYEKGYQTEDTAIGSVFTKMKGVAYTNISGEQKV-WDVSDYVYPDQGAESFVVMTNFIITVGQTQSTCPELPDGKN-TCHSDEDCKKGEFKRTGNGEMTGKCVNTT---NTCEIMSWCPVEDDRQIPD-PPLLLAAENYTLFIKNSITFPEFNVVRSNLVEGVDQNYIKTCMFHPEKDPL--CPIFKLGD-IAQYSGFNFTQIAQGGGAIGILIDWECNLDLRIQKCIPKYRFHGLYGSSSEGASVGYNFRKAKYYVEDKVEKRTLMKVFGLRIDIIVHGLARKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYLLPKRDFYKNMKFKYTTVQD 374          
BLAST of p2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx8 (purinergic receptor P2X, ligand-gated ion channel, 8 [Source:ZFIN;Acc:ZDB-GENE-030319-7])

HSP 1 Score: 231.491 bits (589), Expect = 2.207e-71
Identity = 131/376 (34.84%), Postives = 204/376 (54.26%), Query Frame = 1
Query:   88 LRANVL---DYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSY-GLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPD-IKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLF--TKYGKFSKGWNFRYANYYERNNKE-HRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYE 1191
            LRA +L   DY T K  + +N  +   +R++Q  +L Y+  +    KKGYQ++   + SSV+ K KGV   + + +   LW   D V+P Q  + LFITTN +ET NQ  G C E+  V +  C+ + DCP  + +  GNG  TG+C+    +   TCEI  WCP+E          ++ +  N+T+ IKN I F +    +SN+     +    +C+Y+A      YCPIF++   +   +  D  ++ + GG I ++I W+C+LD  Y HC P Y+F RL   +     S G+NFRYA+Y++    E HR L KVYG+R  I+V G+A K +     +N+GSG+AL+   +  CD ++ + + K   Y E  +E
Sbjct:    5 LRAVLLSAFDYKTEKYVIAKNKKVGILYRVIQLSLLGYIIGWVFLTKKGYQETEESIQSSVITKVKGVLLTNSSGTGPRLWGPEDYVIPQQGEDVLFITTNFIETPNQKLGYCAESFKVLDGRCRKNEDCPEGEAVVAGNGVRTGRCLKKDRNSTGTCEIYGWCPIEKS--QRLIVPLLGKTENFTIYIKNFIRFPKFGFSKSNVLDTAGDSYLKTCLYDAIAH--PYCPIFRLGDIV-LRSGHDFQDMALLGGSIGILIEWHCDLDKGYSHCHPRYTFTRLDFNSTANSVSSGYNFRYAHYFKNPAGETHRTLLKVYGIRFDIQVHGRAGKFNIIPTIINIGSGLALMGAGSFFCDMVLLYMMKKSTLYRERKFE 375          
BLAST of p2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008095.1 (pep scaffold:Pmarinus_7.0:GL481209:13988:23244:1 gene:ENSPMAG00000007268.1 transcript:ENSPMAT00000008095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 220.32 bits (560), Expect = 1.628e-67
Identity = 127/377 (33.69%), Postives = 202/377 (53.58%), Query Frame = 1
Query:   79 CNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDS-YGLXXXXXXKTKGVGFASKTNS--QRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHD 1200
            C  L  +  +Y T K+ + ++ ++   +R++Q  IL Y+  +   +KKGYQ++     +SV+ K KGV   + T    QR LWD AD V+PPQ  +  F+ TN+V T  Q QG+C ENP V  + C+ D DCP  +    GNG  TG+CV  +   + CE+ AWCP+EN         +++E  N+TV IK ++ F   NV R N+          SC ++   S L  CP+F++   +        +++   GG+I V + W+C+LD     C  +Y F RL ++  + + G NFR+A Y  ++  E R+L KVYG+R  + V GKA K S     +N+G+G+ALL     +CD  + +   +  +Y +  +E  +
Sbjct:    6 CGALVCSAFEYKTEKLMIARDRSVGVVYRLMQLVILAYIIGWVFVVKKGYQETDPDPETSVITKVKGVALTNSTEGPGQR-LWDTADYVIPPQGESRFFVVTNLVSTPRQRQGLCAENPNVPGARCQEDGDCPAGRTFNTGNGICTGRCVPTNGTARVCEVHAWCPVENSPTPREA--VLREAENFTVFIKVSVNFTRFNVHRRNVLEEGDSSYLKSCEFHPERSPL--CPVFRLGE-LAVRAGASFSDMATRGGVIAVHLAWDCDLDRDLSACAAQYRFSRLDSERSRVAAGHNFRFARYSWQDGAETRSLLKVYGVRFDVMVSGKAGKFSIVPTLLNLGAGLALLGAGAFLCDLFLLYASKESPQYRQRKFERSE 376          
BLAST of p2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007719.1 (pep scaffold:Pmarinus_7.0:GL477301:21784:46999:1 gene:ENSPMAG00000006964.1 transcript:ENSPMAT00000007719.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 176.407 bits (446), Expect = 1.364e-51
Identity = 117/375 (31.20%), Postives = 176/375 (46.93%), Query Frame = 1
Query:   82 NILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWL--KKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERL--FTKYGKFSKGWNFRYANYY-ERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYE 1191
            ++L    L+Y   K A I++        ++    ++ V  Y+ W+    GYQ+  G+ SS   K KG      T    ++ D AD V+ P+E N+ F+ TN +ET NQ QG C E+P V  + C +D DC        G G  TG CV  +   K+CE+ AWCPL  D+                            N  + N+    +  + +   +  SD     CPIF +   +    + D  EL + GG+  ++I WNCNLD     C+P Y F RL    +    S G+NFR+  YY +    E R L K YG+R ++EV G+A K S     +++GSG+ LL +  ++CD I+ +   K   Y E +YE
Sbjct:    7 DVLSKFYLNYTITKKARIKSRKAAILTFLV---FVMLVISYTGWVIYTHGYQEFDGVVSSSTAKVKGA-----TEVTGMVMDAADYVISPEEPNSFFVMTNFIETPNQKQGACAEDPDV--APCSSDTDCRAGVTDPEGEGVFTGLCVPINNTTKSCEVNAWCPLPKDS----------------------------NPPKHNILGSNASYLKSCRYHRQSDP---ECPIFILGDIVSEAGE-DFKELAIEGGVFSIMIEWNCNLDLNEQACKPNYKFRRLDKENRNKTISPGYNFRFPKYYKDAKGIETRTLVKAYGIRFMVEVIGQAGKASLLRSLISLGSGVGLLGMVWVICDLIVLFCCRKSRIYREQLYE 339          
BLAST of p2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008762.1 (pep scaffold:Pmarinus_7.0:GL477338:26903:57888:-1 gene:ENSPMAG00000007911.1 transcript:ENSPMAT00000008762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.821 bits (364), Expect = 6.973e-40
Identity = 104/325 (32.00%), Postives = 153/325 (47.08%), Query Frame = 1
Query:   88 LRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFN---STCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYE-RNNKEHRALFKVYGLRILIEVRGK 1050
            L  N+  YP   +  I+N        +++  IL Y   Y +  +  Y++   ++S+V VK KG       N     +D AD VVP QE N  F+ TN + T NQTQ     NP       S C+ D DC      +LG+G  TG+C+      K+CE+  WCP+E  T       ++    N TV I+N + F + N +R N          +SC Y+  D     CPIF++   I  +     + + V GGII ++I+W+C L +    C P YSF RL   Y    +G+NFR   Y     + + R L K +G+R  I V G+
Sbjct:    9 LPCNIFFYPRELVIGIENKYCGPIHMVVRIVILGYGARYVVGFEHAYREYEDVTSAVRVKVKGTAKVDIPNEGVRTFDSADYVVPDQEPNTFFVMTNFIVTKNQTQVTTCCNPEAMKFSVSPCQNDGDCTRDASKHLGSGIQTGRCIRYDATCKSCEVMGWCPVERRT-SPPQPPLLPATENATVYIQNHVYFIKNNKERENFPLNLEGKDLSSCRYHPRDD--PSCPIFRLGD-ITAMAGHSFSSMSVQGGIIAIVISWDCKLSEV--ECFPAYSFHRLDRNYTT-KRGYNFRSLVYKSMETDVQTRTLVKAFGIRFNILVTGQ 326          
BLAST of p2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000196.1 (pep scaffold:Pmarinus_7.0:GL482356:953:3300:-1 gene:ENSPMAG00000000176.1 transcript:ENSPMAT00000000196.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 4.044e-12
Identity = 35/113 (30.97%), Postives = 58/113 (51.33%), Query Frame = 1
Query:  496 GPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGG 834
            G  TG+CV    ++ TCE+ AWCP+E +  +     +++   N+T+LIKN I F + NV + NL     +    SC ++   + L  CPIF +   + +    D   + + GG
Sbjct:    1 GEKTGRCVPFDKNVSTCEVNAWCPVEVEGKNTG-KRLLRSAENFTILIKNNIRFPKFNVSKGNLPENMDKNFLKSCHHHPKHNNL--CPIFSLRDILRSAGQ-DFKSIGINGG 109          
BLAST of p2X purinoceptor 4 vs. Ensembl Nematostella
Match: EDO41363 (P2X purinoceptor [Source:UniProtKB/TrEMBL;Acc:A7S4Q4])

HSP 1 Score: 254.603 bits (649), Expect = 1.880e-80
Identity = 149/392 (38.01%), Postives = 221/392 (56.38%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRV-------LWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPD--IKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDK 1218
            ++CC  +  ++L+Y T KI  I++  +    R++Q  I+ Y+  Y +  KKGYQ+     SSV  K KG  F + T ++         +WD AD V+PP+E +A F+ TN+V T +Q QG CPE+P + N  C  D +C   +    G+G  TGKCV +  +  IK CE+ AWCP+E    D         + N+TVLIKNT+ F    V + N+          SC Y+   S L  CPIF++ +        D  +L   GG+I +IITWNC+ D     C+P YSF RL       +KG+NFR+ANYY +N+  HR LFK YG+R ++ V G+  K +   L +N+GSG+ALL+IAT++CD ++ + L ++E Y E  Y+Y   N+ D+
Sbjct:    2 AACCGKVIDSLLEYNTSKIVHIKSKKVGLINRLIQLAIIGYIIGYVIIYKKGYQEVEKPYSSVTTKLKGTSFTNLTGNESFPLYGGPFVWDQADYVIPPEENDAFFVATNMVITPDQRQGTCPESPDIANVKCTRDENCTRMEETSYGHGFQTGKCVPSDQEKGIKVCEVFAWCPVE---LDITPMPQFPSLKNFTVLIKNTVQFPSFGVSKRNIAPDADTSTLKSCQYDKDTSPL--CPIFRLETITKEAGQ-DFNKLAYKGGVIGIIITWNCDFDSLLYSCKPVYSFRRLDNANAPIAKGYNFRHANYYVKNDTLHRTLFKAYGIRFVVTVTGQGGKFNVVPLFLNLGSGLALLSIATVLCDVVVLYVLRRKEFYREKKYQYVVENSSDE 387          
BLAST of p2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx5 (P2X purinoceptor 5 [Source:NCBI gene;Acc:101173001])

HSP 1 Score: 227.639 bits (579), Expect = 5.348e-69
Identity = 127/368 (34.51%), Postives = 196/368 (53.26%), Query Frame = 1
Query:   97 NVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQD-SYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERL-FTKYGKFSKGWNFRYANYYERNNKE-HRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYE 1191
            ++L+Y T K  + +N  I   FR+ Q  +L Y+  +   +KKGYQ+    + +SV+ K KGV   + + +   LW   D V+PP      FI TN +ET NQ  G C E+P V N  C++D DC   + +  G+G MTG C+N++    TCEI AWCP+E+         ++ E  N+T+ IKN I F +    +SN+   + +     C Y+  +    YCPIF++   +    + D  ++   GG + ++I WNC+LD     C P YSF RL        + G+NFR+A YY+    E +R L+KVYG+R  I + G+A K +     + +GSG+AL+ I   VCD I+ + +     Y E  +E
Sbjct:   10 SLLNYKTEKYVIAENRRIGILFRLYQLAVLGYIIGWVFVVKKGYQEKEEAVQTSVITKVKGVSLINSSQTGPYLWSAEDYVIPPNGEQVFFIVTNYIETPNQRLGFCAESPKVPNGMCQSDEDCLEGESIAAGHGIMTGLCLNST---GTCEIYAWCPVEHS--KRPTEALLSEAENFTIYIKNFIRFPKFEFSKSNVLETSDDSYLKKCSYDRENH--PYCPIFRLRDLVRNTGN-DFQDMAAKGGSVGILIEWNCDLDKDSSECNPRYSFTRLDMNLNSSITSGYNFRHARYYKDEKGETYRTLYKVYGIRFDIMINGQAGKFNIVPTIIAIGSGVALMGIGAFVCDMILLYMMNTSSFYRERKFE 369          
BLAST of p2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:101169631])

HSP 1 Score: 221.476 bits (563), Expect = 1.675e-67
Identity = 133/389 (34.19%), Postives = 201/389 (51.67%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSN--IIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLF-----TKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCD 1215
            S   N L     +Y T +  +++N  +    R++Q G+L Y+  +    +KGYQ +    SSV  K KGVG  + +  +RV WD +D V PPQ  ++  + TN + T NQT G CPE P  +   CK+D DC         +G +TG CV  +   KTCE+ AWCPLE+D    N  N  ++    N+T+ IKN++ F    + RSNL          +C+++  +S L  CPIFK+   +  ++      +   GG I ++I W CN D     C+P+Y F  L+         K S G+NFRYA YY  +  E R L KV+G+R  I V+   RK         +GSG+ +  +AT+VCD ++ + LP+R+ Y  + ++Y D    D
Sbjct:    3 SCAANALSDFFFEYETPRQVLVRNKRVGVVCRLIQLGVLAYIIGWVFIYEKGYQITETAVSSVFTKVKGVGSTNISGVERV-WDPSDYVFPPQGDSSFVVMTNYILTENQTMGKCPELPGRY--ICKSDTDCKGGTYNRTVDGKLTGVCVKET---KTCELLAWCPLEDD---RNIPNPPLLMSAENFTLFIKNSVTFPLFGITRSNLVEEIDGKTIKNCLFDPDNSPL--CPIFKLGDIV-KLSGFTFETMAKQGGAIGLVIDWTCNFDYDVKKCKPKYEFHGLYGNPRVKDTSKASVGYNFRYAKYYMGDKMEKRTLMKVFGIRFDIIVQSLGRKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYVLPRRDFYKNMKFKYTDTAAQD 379          
BLAST of p2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:101169631])

HSP 1 Score: 221.476 bits (563), Expect = 4.189e-67
Identity = 132/384 (34.38%), Postives = 200/384 (52.08%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSN--IIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLF-----TKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHD 1200
            S   N L     +Y T +  +++N  +    R++Q G+L Y+  +    +KGYQ +    SSV  K KGVG  + +  +RV WD +D V PPQ  ++  + TN + T NQT G CPE P  +   CK+D DC         +G +TG CV    + KTCE+ AWCPLE+D    N  N  ++    N+T+ IKN++ F    + RSNL          +C+++  +S L  CPIFK+   +  ++      +   GG I ++I W CN D     C+P+Y F  L+         K S G+NFRYA YY  +  E R L KV+G+R  I V+   RK         +GSG+ +  +AT+VCD ++ + LP+R+ Y  + ++Y D
Sbjct:    3 SCAANALSDFFFEYETPRQVLVRNKRVGVVCRLIQLGVLAYIIGWVFIYEKGYQITETAVSSVFTKVKGVGSTNISGVERV-WDPSDYVFPPQGDSSFVVMTNYILTENQTMGKCPELPGRY--ICKSDTDCKGGTYNRTVDGKLTGVCVK---ETKTCELLAWCPLEDD---RNIPNPPLLMSAENFTLFIKNSVTFPLFGITRSNLVEEIDGKTIKNCLFDPDNSPL--CPIFKLGDIV-KLSGFTFETMAKQGGAIGLVIDWTCNFDYDVKKCKPKYEFHGLYGNPRVKDTSKASVGYNFRYAKYYMGDKMEKRTLMKVFGIRFDIIVQSLGRKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYVLPRRDFYKNMKFKYTD 374          
BLAST of p2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx4b (purinergic receptor P2X 4 [Source:NCBI gene;Acc:101168548])

HSP 1 Score: 209.92 bits (533), Expect = 3.703e-62
Identity = 132/371 (35.58%), Postives = 200/371 (53.91%), Query Frame = 1
Query:   70 SSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERL--FTKYGKFSKGWNFRYANYYER-NNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKY 1173
            ++ C     +V DY T K  VI +  +   FR  Q  ++LYV  Y   ++KGYQ++  + S+V  K KG  + + ++    +WD+AD V+PPQ  ++ FI TN+V T  QTQ  CPE P   ++ CK D DC         NG  TG C N S  +KTCE+ +WCPLE DT     + ++    N+TVLIKN+I + + N    N+    +    A C +N        CPIF++   I    + D  E+ V GGI+ ++I W+C+LD     C P+YSF RL    +    + G+NFR+A +Y+R +  E R L K YG+R  + V G A K       +N+G+ ++ L++  IV D++M   + KR+ Y
Sbjct:    4 AAGCRGFLHHVFDYETAKTLVIPHFGVGIVFRFTQLLVVLYVVGYVCVVQKGYQETDSVISTVTTKVKGFAYTNTSDMDPRMWDVADYVIPPQGDSSFFILTNLVVTPEQTQSHCPELPNP-STVCKDDCDCIEGYNDPRRNGIRTGLCENFSTTVKTCEVFSWCPLEVDTRLPKKA-LLAAAENFTVLIKNSITYPKFNFHGRNILPHVNSSYLAHCEFNRLTD--PDCPIFRLKRIISEA-EADFQEMAVKGGILGILIDWSCDLDWWAGKCLPKYSFHRLDNQNQGNDVAPGYNFRFAKFYKRADGVEERTLIKAYGIRFEVIVFGTAGKFGIVPAIVNLGAALSFLSLVPIVADWVMLTCMRKRDLY 369          
BLAST of p2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx3a (P2X purinoceptor 3 [Source:NCBI gene;Acc:101165153])

HSP 1 Score: 194.126 bits (492), Expect = 6.910e-57
Identity = 143/394 (36.29%), Postives = 201/394 (51.02%), Query Frame = 1
Query:  109 YPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQD-SYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNL-FACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGK--FSKGWNFRYANYYE-RNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSVNMAINEHFPPIKEPL 1275
            Y T K  V+++ ++    RI+Q  I+ Y   +    +K YQ    G+ SSV+ K KG G   + N Q  + D+AD V PPQ      I T ++ T +Q QG C E+   FN  C TD DC + K   L NG +TG C N S     CEI  WCP END  D   S  + +V N+T+ IKN+I F   NV R N   + TSE+I  +C+Y+   +    CPIF+V   +      DLT L   GG I + I W CN D   + C P+YSF RL   + K   SKG+NFR+A YY+  N  E R L K + +R  + V G A K S     +N+ +    + + T++CD I+  FL   ++Y    +E    +  +  PS+     E  P IKE +
Sbjct:   18 YETTKSVVVKSWSVGIINRIVQLLIITYFVGWVFIHEKAYQVIDTGIESSVMTKVKGFG---RLNHQ--VMDVADYVYPPQGSGIFCIMTRIIVTEDQFQGRCAESQPNFN--CSTDEDCYLHKNTLLSNGVITGVCRNESGG--RCEIEGWCPAEND--DVTNSTTL-DVLNFTIFIKNSIRFPLFNVTRGNFPSSMTSEMI-KNCVYHPEHN--PSCPIFRVGDVLNYTGQ-DLTSLTEKGGEIGINIEWKCNFDRDIELCVPKYSFTRLDAPFMKNQVSKGYNFRFAKYYKTENGTEFRTLHKAFAIRFDVMVTGNAGKFSTIPTLINLVAAFTSIGLGTVICDIILLNFLKGAKQYKAKKFEEVSESQIETSPSL-----ESKPSIKEGM 390          
BLAST of p2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000046751.1 (SMESG000046751.1)

HSP 1 Score: 847.425 bits (2188), Expect = 0.000e+0
Identity = 417/417 (100.00%), Postives = 417/417 (100.00%), Query Frame = 1
Query:   55 MKSTCSSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSVNMAINEHFPPIKEPLINNPISEENV 1305
            MKSTCSSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLSSSVVVKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSVNMAINEHFPPIKEPLINNPISEENV
Sbjct:    1 MKSTCSSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLSSSVVVKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSVNMAINEHFPPIKEPLINNPISEENV 417          
BLAST of p2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000046729.1 (SMESG000046729.1)

HSP 1 Score: 433.335 bits (1113), Expect = 4.438e-150
Identity = 217/378 (57.41%), Postives = 278/378 (73.54%), Query Frame = 1
Query:   67 CSSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDI-KTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYH 1197
            CS   N    ++  Y T K+++I +  I +  R  Q  IL+YV +YS+  K+GYQD YGLSSSV+VK KG+G + + +  R +WDI D+VVPPQE+NA+FITTN +ET NQ+QG CPE+  V ++ C+ D+DC   K L+LGNG MTG+CV +     KTCEI+AWCP+ENDT     S ++KEVP++TVLI+NTIIFD +NVQRSNLF+ T  II   CIYNASD LLKYCPIFKVS+ IG I++++L E+L  GG+IRVIITWNCNLD   D+C P YSF RL+   G FSKGWNFRYANY+E ++ EHR L+KV+GLRILIEVRGKA K S  TLSMN+GSG+ALL+IA  VCD ++     K++KY +  YE H
Sbjct:    8 CSKAVN----HIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKDSDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISNSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKDKY-QYKYEVH 380          
BLAST of p2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000046729.1 (SMESG000046729.1)

HSP 1 Score: 418.698 bits (1075), Expect = 8.332e-145
Identity = 207/351 (58.97%), Postives = 263/351 (74.93%), Query Frame = 1
Query:   67 CSSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDI-KTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTI 1116
            CS   N    ++  Y T K+++I +  I +  R  Q  IL+YV +YS+  K+GYQD YGLSSSV+VK KG+G + + +  R +WDI D+VVPPQE+NA+FITTN +ET NQ+QG CPE+  V ++ C+ D+DC   K L+LGNG MTG+CV +     KTCEI+AWCP+ENDT     S ++KEVP++TVLI+NTIIFD +NVQRSNLF+ T  II   CIYNASD LLKYCPIFKVS+ IG I++++L E+L  GG+IRVIITWNCNLD   D+C P YSF RL+   G FSKGWNFRYANY+E ++ EHR L+KV+GLRILIEVRGKA K S  TLSMN+GSG+ALL+I
Sbjct:    8 CSKAVN----HIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKDSDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISNSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSI 354          
BLAST of p2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000046895.1 (SMESG000046895.1)

HSP 1 Score: 409.838 bits (1052), Expect = 1.032e-140
Identity = 208/398 (52.26%), Postives = 282/398 (70.85%), Query Frame = 1
Query:   55 MKSTCSSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSVNMAINE 1248
            MKST       ++    +Y T KI  I +  I + FR  Q  +++Y+  Y L   +GYQDSYGLSSSVVVK KG+   + + S+R +WDI+D ++PPQE  A F+TTN +ET NQTQ +C E+  V  + C  D DC   K + LGNG MTG+CVN+   IKTCEI +WCPLENDT  +    I+KE+P++T+LI+NTI+FDE++V+RSNLFA  +  IP +C++N +D+ LKYCPIFK+SSF+GTI   ++ +LL +GGII+VII WNC+LD   + C+PEYSF RL  K GK SKGWNFR+ANYY  N +E+R L+KV+GLRIL EVRGKARK S  TL+MN+GSG+ALL +AT++CDFI+ + +P REKY +  YE H+ ++  +  + N   NE
Sbjct:    1 MKSTVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQLLLIVYIIGYVLIYMRGYQDSYGLSSSVVVKVKGISSTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTESNE 398          
BLAST of p2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000028996.1 (SMESG000028996.1)

HSP 1 Score: 282.337 bits (721), Expect = 5.320e-91
Identity = 160/371 (43.13%), Postives = 226/371 (60.92%), Query Frame = 1
Query:  100 VLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLXXXXXXKTKGVGFASKT-NSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADC-PIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNI--IKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHD 1200
            +++Y T KI  I+N  I   FR +Q  IL YV  Y +  KKGYQ++    S+V+ K KGV   +++      +WD+AD V+PPQE NA FIT+N + T  QTQG CPE+     + CKT+ADC P++ I+ LG+G  TG C+N     +TCE+ AWCP+E+   D     +  +  V N+TV IKN I F +  V RSN+ +  ++ + +SC Y++S++    CPIF++   I  +      ++L  GG+I   I W+CNLD   ++C P YSF RL +   K +KGWNFR+ANYY  N  ++R L K YG+R +I V  KA K S   L+MN+GSG+ALL IATI+CDFI+ + L  R KY E  Y   D
Sbjct:   14 IIEYETVKIVSIKNKKIGLIFRFIQLVILSYVIGYVIVYKKGYQETEPGISAVISKVKGVSLTNRSFAGGETIWDVADYVIPPQEENAFFITSNALITKKQTQGKCPEDKNTVGAQCKTNADCVPLEPII-LGDGVKTGVCINN----QTCEVYAWCPVESSAEDSKTVKLPLLNNVNNFTVYIKNNIEFRKFKVFRSNIPSNFNKSMLSSCRYSSSNT---KCPIFQIG-MILNLTGKSYDDILKTGGVISFSINWDCNLDVSLENCFPTYSFNRLDSDDIKLAKGWNFRHANYYYINETQYRDLIKAYGIRFVISVSSKAGKFSIIPLTMNLGSGLALLAIATIICDFIVLYILRNRSKYIEAKYHLID 375          
The following BLAST results are available for this feature:
BLAST of p2X purinoceptor 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2RX45.823e-8138.36purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX47.470e-7736.80purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX28.941e-7237.88purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:... [more]
P2RX29.802e-7137.88purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:... [more]
P2RX56.681e-6935.73purinergic receptor P2X 5 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx4a3.117e-7335.25purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx11.061e-7135.43purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx11.240e-7135.43purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx11.240e-7135.43purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4b5.285e-7135.87purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000000163.11.344e-7838.73purinergic receptor P2X, ligand gated ion channel,... [more]
ENSXETT00000000415.12.683e-7638.46purinergic receptor P2X, ligand gated ion channel,... [more]
ENSXETT00000000980.11.198e-7437.93purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx53.461e-7334.44purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx56.579e-7334.26purinergic receptor P2X, ligand gated ion channel,... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2rx41.695e-8140.17purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx41.167e-7339.34purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx24.077e-7135.40purinergic receptor P2X, ligand-gated ion channel,... [more]
P2rx45.840e-7139.52purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx21.290e-7037.88purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of p2X purinoceptor 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99571|P2RX4_HUMAN2.796e-8038.36P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX... [more]
sp|Q9JJX6|P2RX4_MOUSE4.644e-7939.61P2X purinoceptor 4 OS=Mus musculus OX=10090 GN=P2r... [more]
sp|Q5E9U1|P2RX4_BOVIN2.526e-7838.78P2X purinoceptor 4 OS=Bos taurus OX=9913 GN=P2RX4 ... [more]
sp|P51577|P2RX4_RAT2.272e-7739.34P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 G... [more]
sp|Q9UBL9|P2RX2_HUMAN4.707e-7037.88P2X purinoceptor 2 OS=Homo sapiens OX=9606 GN=P2RX... [more]
back to top
BLAST of p2X purinoceptor 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EI989.535e-8741.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GN829.638e-8741.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0R3W5129.274e-8639.56Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A2C9M4582.141e-8540.89Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1I8J6R23.576e-8541.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx4a4.010e-7737.79purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a2.960e-7637.79purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx12.864e-7436.76purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx12.913e-7436.76purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx82.207e-7134.84purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008095.11.628e-6733.69pep scaffold:Pmarinus_7.0:GL481209:13988:23244:1 g... [more]
ENSPMAT00000007719.11.364e-5131.20pep scaffold:Pmarinus_7.0:GL477301:21784:46999:1 g... [more]
ENSPMAT00000008762.16.973e-4032.00pep scaffold:Pmarinus_7.0:GL477338:26903:57888:-1 ... [more]
ENSPMAT00000000196.14.044e-1230.97pep scaffold:Pmarinus_7.0:GL482356:953:3300:-1 gen... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO413631.880e-8038.01P2X purinoceptor [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx55.348e-6934.51P2X purinoceptor 5 [Source:NCBI gene;Acc:101173001... [more]
p2rx11.675e-6734.19purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx14.189e-6734.38purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx4b3.703e-6235.58purinergic receptor P2X 4 [Source:NCBI gene;Acc:10... [more]
p2rx3a6.910e-5736.29P2X purinoceptor 3 [Source:NCBI gene;Acc:101165153... [more]
back to top
BLAST of p2X purinoceptor 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046751.10.000e+0100.00SMESG000046751.1[more]
SMESG000046729.14.438e-15057.41SMESG000046729.1[more]
SMESG000046729.18.332e-14558.97SMESG000046729.1[more]
SMESG000046895.11.032e-14052.26SMESG000046895.1[more]
SMESG000028996.15.320e-9143.13SMESG000028996.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013163 ID=SMED30013163|Name=p2X purinoceptor 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1387bp
TATACATTGAAATACTTTGAAATACATTAGCATTGTAGAGTGAAATCTTA
TTCAATGAAATCGACCTGCTCAAGTTGCTGTAATATTCTACGAGCGAACG
TCTTGGATTATCCAACTTATAAAATTGCAGTTATTCAAAACACTAACATC
GTTTATTTTTTTCGAATTTTGCAAGCTGGAATTCTTTTATACGTATTTAT
ATATTCACTGTGGTTAAAGAAAGGTTATCAAGATTCTTACGGACTATCCA
GTAGTGTGGTTGTGAAAACTAAAGGAGTCGGATTTGCCAGTAAGACTAAT
TCACAAAGAGTACTTTGGGATATTGCAGACTCAGTAGTTCCTCCACAAGA
AGTCAATGCATTATTTATAACAACAAACGTTGTCGAAACCTACAATCAAA
CTCAAGGAATGTGTCCTGAAAACCCTGTGGTGTTTAATTCGACATGTAAA
ACAGATGCCGATTGCCCAATAAAAAAGATTTTATACTTGGGAAATGGACC
TATGACTGGGAAATGTGTTAATGCGTCACCGGATATCAAGACCTGCGAAA
TTCGAGCTTGGTGTCCTCTAGAAAACGATACCTTCGATGAAAATTATAGT
AATATTATAAAAGAAGTTCCAAATTACACGGTTTTAATAAAAAATACAAT
AATCTTTGATGAAGTCAATGTGCAACGGTCCAATTTGTTCGCTTGTACAA
GCGAAATTATTCCTGCTAGTTGTATTTACAATGCCTCTGATAGTCTACTA
AAATATTGCCCTATTTTCAAAGTTTCTTCTTTCATTGGGACAATAAATGA
CACAGATCTCACTGAATTGTTGGTTTATGGTGGTATCATAAGAGTAATTA
TTACTTGGAATTGTAACCTAGACGATAAATATGATCACTGCCGACCAGAA
TATTCATTTGAAAGATTATTTACGAAGTATGGAAAATTCAGCAAAGGCTG
GAATTTTAGGTATGCCAATTATTACGAGAGGAATAATAAAGAGCATAGAG
CTTTATTCAAAGTTTATGGATTAAGAATTCTAATTGAAGTTCGTGGAAAA
GCTCGAAAACTCAGCTTTTTTACATTGTCTATGAATGTTGGTTCTGGCAT
TGCGTTACTTACAATTGCCACGATTGTTTGTGATTTTATTATGCAATGGT
TTCTACCGAAACGAGAGAAATACTGCGAAATCGTTTATGAATATCATGAT
ATCAACAATTGTGATAAGCCACCATCAGTCAATATGGCAATAAATGAACA
CTTTCCACCGATTAAAGAACCTTTGATTAATAATCCAATTTCTGAAGAAA
ATGTATAAAAGCTATTTTGAAAAAGTATTTATTCTGAAGAATTTATTTTA
TAATAAAATTGTTTTATTTTCTAAGCTATTATTATTC
back to top

protein sequence of SMED30013163-orf-1

>SMED30013163-orf-1 ID=SMED30013163-orf-1|Name=SMED30013163-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=418bp
MKSTCSSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIY
SLWLKKGYQDSYGLSSSVVVKTKGVGFASKTNSQRVLWDIADSVVPPQEV
NALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPM
TGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTII
FDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDT
DLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWN
FRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIA
LLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSVNMAINEHF
PPIKEPLINNPISEENV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0004931extracellular ATP-gated cation channel activity
GO:0001614purinergic nucleotide receptor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: biological process
TermDefinition
GO:0098655cation transmembrane transport
GO:0033198response to ATP
GO:0035590purinergic nucleotide receptor signaling pathway
GO:0060079excitatory postsynaptic potential
Vocabulary: INTERPRO
TermDefinition
IPR001429P2X_purnocptor
IPR027309P2X_extracellular_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0098794postsynapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001429P2X purinoreceptorPRINTSPR01307P2XRECEPTORcoord: 86..94
score: 48.79
coord: 297..307
score: 60.47
coord: 162..173
score: 73.19
coord: 316..330
score: 44.64
coord: 252..264
score: 33.11
IPR001429P2X purinoreceptorTIGRFAMTIGR00863TIGR00863coord: 7..375
e-value: 4.2E-103
score: 343.0
NoneNo IPR availableGENE3DG3DSA:1.10.287.940coord: 40..360
e-value: 3.5E-104
score: 350.3
NoneNo IPR availablePFAMPF00864P2X_receptorcoord: 17..380
e-value: 9.2E-112
score: 373.8
NoneNo IPR availablePANTHERPTHR10125P2X PURINOCEPTORcoord: 7..385
NoneNo IPR availableTMHMMTMhelixcoord: 345..367
NoneNo IPR availableTMHMMTMhelixcoord: 32..54
IPR027309P2X purinoreceptor extracellular domain superfamilyGENE3DG3DSA:2.60.490.10coord: 60..335
e-value: 3.5E-104
score: 350.3