KHD-1

Overview
NameKHD-1 (AFD29610.1)
Smed IDSMED30013157
Length (bp)1677
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of KHD-1 (SMED30013157) t-SNE clustered cells

Violin plots show distribution of expression levels for KHD-1 (SMED30013157) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of KHD-1 (SMED30013157) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for KHD-1 (SMED30013157) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013157

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30013157SMESG000070471.1 SmedASXL_003885SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30013157SMESG000070471.1 dd_Smed_v4_294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013157SMESG000070471.1 dd_Smed_v4_294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013157SMESG000070471.1 dd_Smed_v4_294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013157SMESG000070471.1 dd_Smed_v4_294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013157SMESG000070471.1 dd_Smed_v4_294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013157SMESG000070471.1 dd_Smed_v4_294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013157SMESG000070471.1 dd_Smed_v4_294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013157SMESG000070471.1 dd_Smed_v4_294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30013157SMESG000070471.1 dd_Smed_v4_294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013157SMESG000070471.1 dd_Smed_v4_294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013157SMESG000070471.1 dd_Smed_v4_294_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013157SMESG000070471.1 Contig47058uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013157SMESG000070471.1 Contig47058newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30013157SMESG000070471.1 dd_Smed_v6_294_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 1 cellSMED30013157SMESG000070471.1 NB.19.5fsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Category 1 cellSMED30013157SMESG000070471.1 NB.19.5fsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30013157SMESG000070471.1 SMED_01038_V2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of KHD-1 vs. Ensembl Human
Match: KHDRBS3 (KH RNA binding domain containing, signal transduction associated 3 [Source:HGNC Symbol;Acc:HGNC:18117])

HSP 1 Score: 117.857 bits (294), Expect = 2.046e-30
Identity = 56/101 (55.45%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ +P  NFVGKLLGP G +LK +QE+T TKMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P+EAY  + +AL E+KK +IPD N++
Sbjct:   35 IPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDE 135          
BLAST of KHD-1 vs. Ensembl Human
Match: KHDRBS2 (KH RNA binding domain containing, signal transduction associated 2 [Source:HGNC Symbol;Acc:HGNC:18114])

HSP 1 Score: 119.398 bits (298), Expect = 6.018e-29
Identity = 56/101 (55.45%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ YP  NFVGKLLGP G +LK +QE+T  KMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. Ensembl Human
Match: KHDRBS3 (KH RNA binding domain containing, signal transduction associated 3 [Source:HGNC Symbol;Acc:HGNC:18117])

HSP 1 Score: 117.087 bits (292), Expect = 7.762e-29
Identity = 56/101 (55.45%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ +P  NFVGKLLGP G +LK +QE+T TKMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P+EAY  + +AL E+KK +IPD N++
Sbjct:   34 IPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDE 134          
BLAST of KHD-1 vs. Ensembl Human
Match: KHDRBS3 (KH RNA binding domain containing, signal transduction associated 3 [Source:HGNC Symbol;Acc:HGNC:18117])

HSP 1 Score: 116.701 bits (291), Expect = 4.432e-28
Identity = 56/101 (55.45%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ +P  NFVGKLLGP G +LK +QE+T TKMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P+EAY  + +AL E+KK +IPD N++
Sbjct:   62 IPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDE 162          
BLAST of KHD-1 vs. Ensembl Human
Match: KHDRBS1 (KH RNA binding domain containing, signal transduction associated 1 [Source:HGNC Symbol;Acc:HGNC:18116])

HSP 1 Score: 112.464 bits (280), Expect = 4.883e-26
Identity = 52/97 (53.61%), Postives = 70/97 (72.16%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPD 662
            IPV+ YP  NFVGK+LGP G T+K +QE+T  K+S+LG GS+R+  KE+EL   GDPKY HL   LH+ I+  G P EAY  +++A+ EVKK ++PD
Sbjct:  162 IPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPD 258          
BLAST of KHD-1 vs. Ensembl Celegans
Match: E02D9.1 (pep chromosome:WBcel235:I:6800386:6803841:1 gene:WBGene00017098.1 transcript:E02D9.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:E02D9.1)

HSP 1 Score: 85.1149 bits (209), Expect = 7.596e-18
Identity = 37/106 (34.91%), Postives = 65/106 (61.32%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAPGQM 689
            +P+  +PN NF+GK+LGP G TL+T+ +     + ILG GS ++ EKE ELL SGDP++ H    LH++++++     AY  ++  + E+ +++ P   +  P  +
Sbjct:  135 VPIYRHPNFNFIGKVLGPKGATLQTLCKTHKCHIYILGRGSTKDREKEAELLASGDPQHAHFSGPLHVKVETVAPAYIAYGRVAAVIEELSRILQPIHEDTTPAHL 240          
BLAST of KHD-1 vs. Ensembl Celegans
Match: E02D9.1 (pep chromosome:WBcel235:I:6800386:6801970:1 gene:WBGene00017098.1 transcript:E02D9.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:E02D9.1)

HSP 1 Score: 84.7297 bits (208), Expect = 7.753e-18
Identity = 37/106 (34.91%), Postives = 65/106 (61.32%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAPGQM 689
            +P+  +PN NF+GK+LGP G TL+T+ +     + ILG GS ++ EKE ELL SGDP++ H    LH++++++     AY  ++  + E+ +++ P   +  P  +
Sbjct:  135 VPIYRHPNFNFIGKVLGPKGATLQTLCKTHKCHIYILGRGSTKDREKEAELLASGDPQHAHFSGPLHVKVETVAPAYIAYGRVAAVIEELSRILQPIHEDTTPAHL 240          
BLAST of KHD-1 vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 82.0333 bits (201), Expect = 9.406e-17
Identity = 36/98 (36.73%), Postives = 62/98 (63.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDP 665
            +P + +P+ NFVG++LGP G T K ++++T  K+ + G GS+R+ +KE+  LN G P + HL + LH+ I      + A   +  A+ EV+K+++P P
Sbjct:   94 VPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEE--LNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLLVPAP 189          
BLAST of KHD-1 vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 81.6481 bits (200), Expect = 2.455e-16
Identity = 36/98 (36.73%), Postives = 62/98 (63.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDP 665
            +P + +P+ NFVG++LGP G T K ++++T  K+ + G GS+R+ +KE+  LN G P + HL + LH+ I      + A   +  A+ EV+K+++P P
Sbjct:   94 VPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEE--LNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLLVPAP 189          
BLAST of KHD-1 vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 80.8777 bits (198), Expect = 4.419e-16
Identity = 36/98 (36.73%), Postives = 62/98 (63.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDP 665
            +P + +P+ NFVG++LGP G T K ++++T  K+ + G GS+R+ +KE+  LN G P + HL + LH+ I      + A   +  A+ EV+K+++P P
Sbjct:  136 VPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEE--LNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLLVPAP 231          
BLAST of KHD-1 vs. Ensembl Fly
Match: qkr58E-1 (gene:FBgn0022986 transcript:FBtr0339537)

HSP 1 Score: 118.242 bits (295), Expect = 8.301e-29
Identity = 52/100 (52.00%), Postives = 74/100 (74.00%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNE 671
             P++ YP  NFVGK+LGP G TL+ +QE+T  KM ++G  S+R+  KE+EL +SG+PKY HL   LH++I ++  P+EAY+ ISYAL E++K MIPD N+
Sbjct:  119 FPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKFMIPDAND 218          
BLAST of KHD-1 vs. Ensembl Fly
Match: qkr58E-1 (gene:FBgn0022986 transcript:FBtr0346637)

HSP 1 Score: 117.857 bits (294), Expect = 1.348e-28
Identity = 52/100 (52.00%), Postives = 74/100 (74.00%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNE 671
             P++ YP  NFVGK+LGP G TL+ +QE+T  KM ++G  S+R+  KE+EL +SG+PKY HL   LH++I ++  P+EAY+ ISYAL E++K MIPD N+
Sbjct:  119 FPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKFMIPDAND 218          
BLAST of KHD-1 vs. Ensembl Fly
Match: qkr58E-1 (gene:FBgn0022986 transcript:FBtr0071843)

HSP 1 Score: 118.242 bits (295), Expect = 1.510e-28
Identity = 52/100 (52.00%), Postives = 74/100 (74.00%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNE 671
             P++ YP  NFVGK+LGP G TL+ +QE+T  KM ++G  S+R+  KE+EL +SG+PKY HL   LH++I ++  P+EAY+ ISYAL E++K MIPD N+
Sbjct:  119 FPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLSRDLHVEISTVAPPAEAYHRISYALGEIRKFMIPDAND 218          
BLAST of KHD-1 vs. Ensembl Fly
Match: qkr58E-3 (gene:FBgn0022984 transcript:FBtr0339538)

HSP 1 Score: 112.464 bits (280), Expect = 4.223e-27
Identity = 46/101 (45.54%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            +PV+ YP  NF GK+LGP G +L+ +QE+T  K++I G  S+R+  KE++L ++GDP+Y HL+  L L++ ++  P+E Y  I+YALAE++K +IPD N++
Sbjct:   86 VPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYLIPDKNDE 186          
BLAST of KHD-1 vs. Ensembl Fly
Match: qkr58E-3 (gene:FBgn0022984 transcript:FBtr0307214)

HSP 1 Score: 112.464 bits (280), Expect = 4.223e-27
Identity = 46/101 (45.54%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            +PV+ YP  NF GK+LGP G +L+ +QE+T  K++I G  S+R+  KE++L ++GDP+Y HL+  L L++ ++  P+E Y  I+YALAE++K +IPD N++
Sbjct:   86 VPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYLIPDKNDE 186          
BLAST of KHD-1 vs. Ensembl Zebrafish
Match: khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:NCBI gene;Acc:768147])

HSP 1 Score: 116.316 bits (290), Expect = 4.437e-28
Identity = 54/101 (53.47%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ YP  NFVGKLLGP G ++K +QE+T  KMSILG GS+R+  KE+EL  SG+ KY HL + LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSGEAKYAHLSNDLHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. Ensembl Zebrafish
Match: KHDRBS3 (KH domain containing, RNA binding, signal transduction associated 3 [Source:NCBI gene;Acc:101867535])

HSP 1 Score: 107.842 bits (268), Expect = 1.349e-25
Identity = 52/92 (56.52%), Postives = 69/92 (75.00%), Query Frame = 3
Query:  399 NFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            NFVGKLLGP G +LK +QE T TKMSILG GS+R+ EKE+EL  SG+ KY+HL + LH+ I+    P+EAY  + +AL E+KK +IPD N++
Sbjct:   25 NFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKEKEEELRKSGETKYHHLNEDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDE 116          
BLAST of KHD-1 vs. Ensembl Zebrafish
Match: khdrbs1b (KH domain containing, RNA binding, signal transduction associated 1b [Source:ZFIN;Acc:ZDB-GENE-040426-2344])

HSP 1 Score: 104.76 bits (260), Expect = 4.176e-24
Identity = 47/97 (48.45%), Postives = 68/97 (70.10%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPD 662
            IPV+ YP  NFVGK+LGP G T+K +QE+T  K+S+LG GS+R+  KE+EL  +G+PKY HL   LH+ I+      +AY  +++A+ E+KK + PD
Sbjct:   65 IPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKNKEEELRKNGEPKYAHLSMELHVFIEVFAPVPDAYMRMAHAMEEIKKFLFPD 161          
BLAST of KHD-1 vs. Ensembl Zebrafish
Match: khdrbs1a (KH domain containing, RNA binding, signal transduction associated 1a [Source:ZFIN;Acc:ZDB-GENE-000210-25])

HSP 1 Score: 103.605 bits (257), Expect = 1.857e-23
Identity = 47/96 (48.96%), Postives = 65/96 (67.71%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIP 659
            IPV+ YP  NFVGK+LGP G T+K +QE T  K+S+LG GS+R+  KE+EL   GDPKY HL   LH+ I+      + Y  +++A+ EVKK ++P
Sbjct:   75 IPVKQYPRFNFVGKILGPQGSTIKRLQEDTGAKISVLGKGSMRDKNKEEELRKGGDPKYAHLGMELHVHIEVFAPIPDCYLRMAHAMDEVKKFLMP 170          
BLAST of KHD-1 vs. Ensembl Zebrafish
Match: khdrbs1a (KH domain containing, RNA binding, signal transduction associated 1a [Source:ZFIN;Acc:ZDB-GENE-000210-25])

HSP 1 Score: 102.834 bits (255), Expect = 2.449e-23
Identity = 47/96 (48.96%), Postives = 65/96 (67.71%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIP 659
            IPV+ YP  NFVGK+LGP G T+K +QE T  K+S+LG GS+R+  KE+EL   GDPKY HL   LH+ I+      + Y  +++A+ EVKK ++P
Sbjct:   75 IPVKQYPRFNFVGKILGPQGSTIKRLQEDTGAKISVLGKGSMRDKNKEEELRKGGDPKYAHLGMELHVHIEVFAPIPDCYLRMAHAMDEVKKFLMP 170          
BLAST of KHD-1 vs. Ensembl Xenopus
Match: KHDRBS3 (KH domain containing, RNA binding, signal transduction associated 3 [Source:NCBI gene;Acc:100379996])

HSP 1 Score: 115.546 bits (288), Expect = 1.052e-27
Identity = 55/101 (54.46%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IP++ +P  NFVGKLLGP G +LK +QE T TKMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P+EAY  + +AL E+KK +IPD N++
Sbjct:   61 IPIKQFPKFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKAKEEELRKSGEAKYYHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDE 161          
BLAST of KHD-1 vs. Ensembl Xenopus
Match: pdc (phosducin [Source:Xenbase;Acc:XB-GENE-983832])

HSP 1 Score: 113.235 bits (282), Expect = 9.732e-27
Identity = 51/97 (52.58%), Postives = 71/97 (73.20%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPD 662
            IPV+ YP  NFVGK+LGP G T+K +QE+T  K+S+LG GS+R+  KE+EL   GDPKY+HL   LH+ I+  G P E+Y  +++A+ EVKK ++PD
Sbjct:   93 IPVKLYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYSHLNMDLHVFIEVFGPPCESYTRMAHAMEEVKKFLVPD 189          
BLAST of KHD-1 vs. Ensembl Xenopus
Match: khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:NCBI gene;Acc:779662])

HSP 1 Score: 112.464 bits (280), Expect = 1.061e-26
Identity = 53/101 (52.48%), Postives = 72/101 (71.29%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ YP  NFVGKLLGP G +LK +QE+T  KMSILG GS+R+  KE+EL  S + K+ HL D LH+ ++    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKIKEEELRKSDEAKHAHLSDELHVLLEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. Ensembl Xenopus
Match: pdc (phosducin [Source:Xenbase;Acc:XB-GENE-983832])

HSP 1 Score: 111.309 bits (277), Expect = 3.326e-26
Identity = 50/96 (52.08%), Postives = 70/96 (72.92%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIP 659
            IPV+ YP  NFVGK+LGP G T+K +QE+T  K+S+LG GS+R+  KE+EL   GDPKY+HL   LH+ I+  G P E+Y  +++A+ EVKK ++P
Sbjct:   67 IPVKLYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYSHLNMDLHVFIEVFGPPCESYTRMAHAMEEVKKFLVP 162          
BLAST of KHD-1 vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:Xenbase;Acc:XB-GENE-971062])

HSP 1 Score: 78.5666 bits (192), Expect = 2.033e-15
Identity = 37/96 (38.54%), Postives = 61/96 (63.54%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIP 659
            +PV+ YP+ NFVG++LGP G T K ++ +T  K+ + G GS+R+ +KE++  N G P + HL + LH+ I      + A   +  A+ EVKK+++P
Sbjct:   89 VPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQ--NRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVP 182          
BLAST of KHD-1 vs. Ensembl Mouse
Match: Khdrbs3 (KH domain containing, RNA binding, signal transduction associated 3 [Source:MGI Symbol;Acc:MGI:1313312])

HSP 1 Score: 118.242 bits (295), Expect = 4.235e-31
Identity = 56/101 (55.45%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ +P  NFVGKLLGP G +LK +QE+T TKMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P+EAY  + +AL E+KK +IPD N++
Sbjct:    9 IPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDE 109          
BLAST of KHD-1 vs. Ensembl Mouse
Match: Khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:MGI Symbol;Acc:MGI:2159649])

HSP 1 Score: 119.013 bits (297), Expect = 5.366e-29
Identity = 56/101 (55.45%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ YP  NFVGKLLGP G +LK +QE+T  KMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKTKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. Ensembl Mouse
Match: Khdrbs3 (KH domain containing, RNA binding, signal transduction associated 3 [Source:MGI Symbol;Acc:MGI:1313312])

HSP 1 Score: 117.087 bits (292), Expect = 2.191e-28
Identity = 56/101 (55.45%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ +P  NFVGKLLGP G +LK +QE+T TKMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P+EAY  + +AL E+KK +IPD N++
Sbjct:   62 IPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDE 162          
BLAST of KHD-1 vs. Ensembl Mouse
Match: Khdrbs3 (KH domain containing, RNA binding, signal transduction associated 3 [Source:MGI Symbol;Acc:MGI:1313312])

HSP 1 Score: 117.087 bits (292), Expect = 2.191e-28
Identity = 56/101 (55.45%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ +P  NFVGKLLGP G +LK +QE+T TKMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P+EAY  + +AL E+KK +IPD N++
Sbjct:   62 IPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDE 162          
BLAST of KHD-1 vs. Ensembl Mouse
Match: Khdrbs3 (KH domain containing, RNA binding, signal transduction associated 3 [Source:MGI Symbol;Acc:MGI:1313312])

HSP 1 Score: 117.087 bits (292), Expect = 2.191e-28
Identity = 56/101 (55.45%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ +P  NFVGKLLGP G +LK +QE+T TKMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P+EAY  + +AL E+KK +IPD N++
Sbjct:   62 IPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDE 162          
BLAST of KHD-1 vs. UniProt/SwissProt
Match: sp|Q920F3|KHDR2_RAT (KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Khdrbs2 PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.182e-28
Identity = 56/101 (55.45%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ YP  NFVGKLLGP G +LK +QE+T  KMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. UniProt/SwissProt
Match: sp|P13230|GRP33_ARTSA (Glycine-rich protein GRP33 OS=Artemia salina OX=85549 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.864e-28
Identity = 55/101 (54.46%), Postives = 78/101 (77.23%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIP--DPN 668
            +PV+ +P  NF+GKLLGP G T+K +Q++T TK+SILG GS+R+  KE+EL NSGD KY HL ++LH++I SI +P+EA+  ++YAL E+KK + P  DPN
Sbjct:   80 LPVDQFPKYNFLGKLLGPGGSTMKQLQDETMTKISILGRGSMRDRNKEEELRNSGDVKYAHLNEQLHIEIISIASPAEAHARMAYALTEIKKYITPEEDPN 180          
BLAST of KHD-1 vs. UniProt/SwissProt
Match: sp|Q5VWX1|KHDR2_HUMAN (KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Homo sapiens OX=9606 GN=KHDRBS2 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.890e-28
Identity = 56/101 (55.45%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ YP  NFVGKLLGP G +LK +QE+T  KMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. UniProt/SwissProt
Match: sp|Q9WU01|KHDR2_MOUSE (KH domain-containing, RNA-binding, signal transduction-associated protein 2 OS=Mus musculus OX=10090 GN=Khdrbs2 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 3.753e-28
Identity = 56/101 (55.45%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ YP  NFVGKLLGP G +LK +QE+T  KMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKTKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. UniProt/SwissProt
Match: sp|Q9R226|KHDR3_MOUSE (KH domain-containing, RNA-binding, signal transduction-associated protein 3 OS=Mus musculus OX=10090 GN=Khdrbs3 PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.533e-27
Identity = 56/101 (55.45%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ +P  NFVGKLLGP G +LK +QE+T TKMSILG GS+R+  KE+EL  SG+ KY HL D LH+ I+    P+EAY  + +AL E+KK +IPD N++
Sbjct:   62 IPVKQFPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDE 162          
BLAST of KHD-1 vs. TrEMBL
Match: H9CXT9 (KHD-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 2.986e-120
Identity = 306/306 (100.00%), Postives = 306/306 (100.00%), Query Frame = 3
Query:   87 MDGQSQDYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLIDAYENELHGVDEATCPNIAMLVRNELFRLRGGXXXXXXXXXXXXXXXXXXXXIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAPGQMPMVTPLMXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINNFNPMFMNGANDTGFTDDYPTMGFDNSFESXXXXXXXXXXXXXXXXXXNAPYSRPM 1004
            MDGQSQDYTQNADAQFQPAAQQNQQGNQQQQQPKRENQFQGLIDAYENELHGVDEATCPNIAMLVRNELFRLRGGVIDTVDVLTTKKTKVRTKVDIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAPGQMPMVTPLMGGPNGGFGGMRNQPMNQQRGGRGRGGNRGSNRGGVGGPPRINNFNPMFMNGANDTGFTDDYPTMGFDNSFESGRGGGKMMRGGGMDRMNRNAPYSRPM
Sbjct:    1 MDGQSQDYTQNADAQFQPAAQQNQQGNQQQQQPKRENQFQGLIDAYENELHGVDEATCPNIAMLVRNELFRLRGGVIDTVDVLTTKKTKVRTKVDIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAPGQMPMVTPLMGGPNGGFGGMRNQPMNQQRGGRGRGGNRGSNRGGVGGPPRINNFNPMFMNGANDTGFTDDYPTMGFDNSFESGRGGGKMMRGGGMDRMNRNAPYSRPM 306          
BLAST of KHD-1 vs. TrEMBL
Match: A0A4S2M594 (KH domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002587 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 2.008e-46
Identity = 93/170 (54.71%), Postives = 125/170 (73.53%), Query Frame = 3
Query:  207 GLIDAYENELHGVDEATCPNIAMLVRNELFRLRGGXXXXXXXXXXXXXXXXXXXXIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAP------GQMPMV 698
            G I+A   EL  +DE   P +  L  NELFRLRGG+ +++D+++ ++ K+R K++IP   YP VNFVGKLLGP G+TL+  QE T TKM+ILG+GSLR+  KE+ELL+SGDPKY HL+ +LHLQ+DS+  PSEAYY +S+ALAE++KVM+P+ NE  P      G  PMV
Sbjct:   13 GAIEAIVRELKNLDEKAFPALHALAENELFRLRGGIAESIDIVSNRQVKIRAKIEIPSSQYPGVNFVGKLLGPGGQTLRATQESTKTKMAILGAGSLRDDSKERELLSSGDPKYQHLKQKLHLQVDSLAPPSEAYYRLSHALAELRKVMLPESNECPPPPWVPQGTSPMV 182          
BLAST of KHD-1 vs. TrEMBL
Match: A0A4S2M597 (KH domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002587 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.544e-46
Identity = 93/170 (54.71%), Postives = 125/170 (73.53%), Query Frame = 3
Query:  207 GLIDAYENELHGVDEATCPNIAMLVRNELFRLRGGXXXXXXXXXXXXXXXXXXXXIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAP------GQMPMV 698
            G I+A   EL  +DE   P +  L  NELFRLRGG+ +++D+++ ++ K+R K++IP   YP VNFVGKLLGP G+TL+  QE T TKM+ILG+GSLR+  KE+ELL+SGDPKY HL+ +LHLQ+DS+  PSEAYY +S+ALAE++KVM+P+ NE  P      G  PMV
Sbjct:   13 GAIEAIVRELKNLDEKAFPALHALAENELFRLRGGIAESIDIVSNRQVKIRAKIEIPSSQYPGVNFVGKLLGPGGQTLRATQESTKTKMAILGAGSLRDDSKERELLSSGDPKYQHLKQKLHLQVDSLAPPSEAYYRLSHALAELRKVMLPESNECPPPPWVPQGTSPMV 182          
BLAST of KHD-1 vs. TrEMBL
Match: A0A564YXH5 (KH domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS9986 PE=4 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 3.909e-46
Identity = 91/156 (58.33%), Postives = 121/156 (77.56%), Query Frame = 3
Query:  213 IDAYENELHGVDEATCPNIAMLVRNELFRLRGGXXXXXXXXXXXXXXXXXXXXIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAP 680
            ++    E+  +DE T P +  +  NELFRLRGG+ DT+DV+  K+ K+R KV IPVE YP++NFVGKLLGP G TL+T+Q++T+TKM+ILG GSLR+  KE+ELL+ GDPKY HL+  LHLQID +  P++AYYNIS+ALA+VK+VM+PD N Q P
Sbjct:   14 VEVLSREVQNLDENTFPTLKSIGENELFRLRGGIADTLDVVDNKRVKIRAKVMIPVEQYPSINFVGKLLGPGGSTLRTIQDETHTKMAILGRGSLRDEAKEKELLSGGDPKYQHLKHPLHLQIDCLAPPADAYYNISHALAQVKRVMVPDANGQQP 169          
BLAST of KHD-1 vs. TrEMBL
Match: A0A4S2M5E9 (KH domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002587 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 4.080e-46
Identity = 93/170 (54.71%), Postives = 125/170 (73.53%), Query Frame = 3
Query:  207 GLIDAYENELHGVDEATCPNIAMLVRNELFRLRGGXXXXXXXXXXXXXXXXXXXXIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAP------GQMPMV 698
            G I+A   EL  +DE   P +  L  NELFRLRGG+ +++D+++ ++ K+R K++IP   YP VNFVGKLLGP G+TL+  QE T TKM+ILG+GSLR+  KE+ELL+SGDPKY HL+ +LHLQ+DS+  PSEAYY +S+ALAE++KVM+P+ NE  P      G  PMV
Sbjct:   13 GAIEAIVRELKNLDEKAFPALHALAENELFRLRGGIAESIDIVSNRQVKIRAKIEIPSSQYPGVNFVGKLLGPGGQTLRATQESTKTKMAILGAGSLRDDSKERELLSSGDPKYQHLKQKLHLQVDSLAPPSEAYYRLSHALAELRKVMLPESNECPPPPWVPQGTSPMV 182          
BLAST of KHD-1 vs. Ensembl Cavefish
Match: khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:NCBI gene;Acc:768147])

HSP 1 Score: 116.701 bits (291), Expect = 2.788e-28
Identity = 54/101 (53.47%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ YP  NFVGKLLGP G ++K +QE+T  KMSILG GS+R+  KE+EL  SG+ KY HL + LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSGEAKYAHLSNDLHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. Ensembl Cavefish
Match: khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:NCBI gene;Acc:768147])

HSP 1 Score: 117.087 bits (292), Expect = 4.016e-28
Identity = 54/101 (53.47%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ YP  NFVGKLLGP G ++K +QE+T  KMSILG GS+R+  KE+EL  SG+ KY HL + LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSGEAKYAHLSNDLHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. Ensembl Cavefish
Match: khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:NCBI gene;Acc:768147])

HSP 1 Score: 116.701 bits (291), Expect = 5.064e-28
Identity = 54/101 (53.47%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ YP  NFVGKLLGP G ++K +QE+T  KMSILG GS+R+  KE+EL  SG+ KY HL + LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSGEAKYAHLSNDLHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. Ensembl Cavefish
Match: khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:NCBI gene;Acc:768147])

HSP 1 Score: 117.087 bits (292), Expect = 9.260e-28
Identity = 54/101 (53.47%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ YP  NFVGKLLGP G ++K +QE+T  KMSILG GS+R+  KE+EL  SG+ KY HL + LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSGEAKYAHLSNDLHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. Ensembl Cavefish
Match: khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:NCBI gene;Acc:768147])

HSP 1 Score: 116.701 bits (291), Expect = 1.311e-27
Identity = 54/101 (53.47%), Postives = 73/101 (72.28%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ YP  NFVGKLLGP G ++K +QE+T  KMSILG GS+R+  KE+EL  SG+ KY HL + LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVQQYPKFNFVGKLLGPRGNSMKRLQEETGAKMSILGKGSMRDKGKEEELRKSGEAKYAHLSNDLHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. Ensembl Sea Lamprey
Match: KHDRBS3 (KH RNA binding domain containing, signal transduction associated 3 [Source:HGNC Symbol;Acc:HGNC:18117])

HSP 1 Score: 112.079 bits (279), Expect = 4.191e-28
Identity = 52/105 (49.52%), Postives = 75/105 (71.43%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAPGQ 686
            IPV  +P  NF+GKLLGP G +LK ++E+T TK+SILG GS+R+ +KE++L  SG+ KY HL + LH+ I+    PS+AY  + +AL EVKK ++PD N++   Q
Sbjct:   43 IPVRQHPKFNFIGKLLGPRGNSLKRLKEETGTKLSILGKGSMRDRDKEEDLRKSGEAKYAHLNEDLHVLIEVFAPPSQAYRRMGHALDEVKKYLVPDYNDEIRQQ 147          
BLAST of KHD-1 vs. Ensembl Sea Lamprey
Match: khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:NCBI gene;Acc:768147])

HSP 1 Score: 111.694 bits (278), Expect = 2.308e-27
Identity = 53/101 (52.48%), Postives = 72/101 (71.29%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IP + +P  NFVGKLLGP G +LK +QE+T TKMSILG GS+R+   E+E+  SG+ KY HL + LH+ I+    PSEAY  + +AL EVKK ++PD N++
Sbjct:   43 IPAKQHPKFNFVGKLLGPRGNSLKRMQEETGTKMSILGKGSMRDKALEEEMRKSGENKYAHLSEELHVLIEVFAPPSEAYSRMGHALDEVKKYLVPDYNDE 143          
BLAST of KHD-1 vs. Ensembl Sea Lamprey
Match: khdrbs1a (KH domain containing, RNA binding, signal transduction associated 1a [Source:ZFIN;Acc:ZDB-GENE-000210-25])

HSP 1 Score: 100.523 bits (249), Expect = 2.520e-23
Identity = 49/101 (48.51%), Postives = 68/101 (67.33%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IP + +P  NFVGKLLGP G TLK +Q +T T+M+I+G G +++  KE+EL NSG+ KY HL + LH+ I+      EAY  + +AL EVKK   PD N++
Sbjct:   67 IPAKQHPKFNFVGKLLGPQGNTLKRLQVETGTRMAIMGKGCMKDRAKEEELRNSGEAKYVHLNEELHVLIEVYAPLPEAYSRMGHALEEVKKFFNPDYNDE 167          
BLAST of KHD-1 vs. Ensembl Sea Lamprey
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 48.1358 bits (113), Expect = 4.486e-6
Identity = 18/43 (41.86%), Postives = 32/43 (74.42%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLR 500
            IP + +P++NF+G ++GP G TLK ++++ N K+ I G GS++
Sbjct:  212 IPQDEHPDINFIGLIIGPRGNTLKKIEKECNAKIMIRGKGSVK 254          
BLAST of KHD-1 vs. Ensembl Yeast
Match: MSL5 (Component of commitment complex; which defines first step in splicing pathway; essential protein that interacts with Mud2p and Prp40p, forming a bridge between the intron ends; also involved in nuclear retention of pre-mRNA; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000004106])

HSP 1 Score: 58.9214 bits (141), Expect = 8.926e-10
Identity = 31/70 (44.29%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQI 581
            IPV+ YP+VNFVG LLGP G+TL+ +QE +N K++I G GS++  +   +L     P   +  D LH  I
Sbjct:  154 IPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGKNASDL----PPGAMNFEDPLHCLI 219          
BLAST of KHD-1 vs. Ensembl Nematostella
Match: EDO44127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWI4])

HSP 1 Score: 106.686 bits (265), Expect = 5.698e-27
Identity = 51/101 (50.50%), Postives = 70/101 (69.31%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ +P  NFVGKLLGP G T K +Q  T TKMSILG GS+R+ EKE+EL  + DPKY HL + LH+ I+    P +A+  +  A+ E+KK +IP+ N++
Sbjct:   55 IPVKDHPKFNFVGKLLGPRGNTFKRLQNSTGTKMSILGKGSMRDKEKEEELRATEDPKYAHLGEELHVLIEVEAPPGQAHARLGIAIEEIKKYLIPEMNDE 155          
BLAST of KHD-1 vs. Ensembl Nematostella
Match: EDO30297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T170])

HSP 1 Score: 67.0106 bits (162), Expect = 7.430e-13
Identity = 30/95 (31.58%), Postives = 53/95 (55.79%), Query Frame = 3
Query:  375 PVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIP 659
            PV+ +P  NFVG+++GP G TL+ ++  T  K+ + G GS+++ + E+E    G P Y HL + LH+ I         +  +  A+  V+ ++ P
Sbjct:   60 PVKEFPKFNFVGRVIGPRGMTLREIESTTGCKLLVRGKGSMKDKKLEEE--KRGQPNYEHLDEDLHVLISCEDTEERCHTRLEKAVERVQSLLRP 152          
BLAST of KHD-1 vs. Ensembl Nematostella
Match: EDO45484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSV9])

HSP 1 Score: 51.9878 bits (123), Expect = 1.765e-7
Identity = 25/60 (41.67%), Postives = 42/60 (70.00%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPE----KEQELLNSGD 539
            IP +  P VNF+G L+GP G TLK ++++TN K+ I G GS+++ +    ++ +L+NSG+
Sbjct:  186 IPQDENPEVNFIGLLIGPRGNTLKNMEKETNAKIMIRGKGSIKDGKQGRGRDMQLMNSGE 245          
BLAST of KHD-1 vs. Ensembl Nematostella
Match: EDO28641 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5W9])

HSP 1 Score: 46.595 bits (109), Expect = 3.388e-6
Identity = 17/43 (39.53%), Postives = 30/43 (69.77%), Query Frame = 3
Query:  375 PVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRN 503
            PV+ +P  NFVG+++GP G TL+ ++  T  K+ + G GS+++
Sbjct:   99 PVKEFPKFNFVGRVIGPRGMTLREIESTTGCKLLVRGKGSMKD 141          
BLAST of KHD-1 vs. Ensembl Medaka
Match: khdrbs2 (KH RNA binding domain containing, signal transduction associated 2 [Source:NCBI gene;Acc:101155877])

HSP 1 Score: 119.013 bits (297), Expect = 3.674e-29
Identity = 55/101 (54.46%), Postives = 72/101 (71.29%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV  YP  NFVGKLLGP G ++K +QE+T  KMSILG GS+R+ EKE+EL   GD KY HL + LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   69 IPVRQYPKFNFVGKLLGPRGNSMKRLQEETGVKMSILGKGSMRDKEKEEELRKGGDAKYAHLSNDLHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 169          
BLAST of KHD-1 vs. Ensembl Medaka
Match: khdrbs2 (KH RNA binding domain containing, signal transduction associated 2 [Source:NCBI gene;Acc:101155877])

HSP 1 Score: 118.627 bits (296), Expect = 4.934e-29
Identity = 55/101 (54.46%), Postives = 72/101 (71.29%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV  YP  NFVGKLLGP G ++K +QE+T  KMSILG GS+R+ EKE+EL   GD KY HL + LH+ I+    P EAY  +S+AL E+KK ++PD N++
Sbjct:   66 IPVRQYPKFNFVGKLLGPRGNSMKRLQEETGVKMSILGKGSMRDKEKEEELRKGGDAKYAHLSNDLHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDE 166          
BLAST of KHD-1 vs. Ensembl Medaka
Match: KHDRBS3 (KH RNA binding domain containing, signal transduction associated 3 [Source:NCBI gene;Acc:101171680])

HSP 1 Score: 116.701 bits (291), Expect = 2.157e-28
Identity = 56/101 (55.45%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ +P  NFVGKLLGP G +LK +QE T TKMSILG GS+R+ EKE+EL  SG+ KY HL + LH+ I+    P+EAY  + +AL E+KK +IPD N++
Sbjct:   63 IPVKQFPKFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKEKEEELRQSGEAKYQHLNEDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDE 163          
BLAST of KHD-1 vs. Ensembl Medaka
Match: KHDRBS3 (KH RNA binding domain containing, signal transduction associated 3 [Source:NCBI gene;Acc:101171680])

HSP 1 Score: 116.701 bits (291), Expect = 2.397e-28
Identity = 56/101 (55.45%), Postives = 74/101 (73.27%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQ 674
            IPV+ +P  NFVGKLLGP G +LK +QE T TKMSILG GS+R+ EKE+EL  SG+ KY HL + LH+ I+    P+EAY  + +AL E+KK +IPD N++
Sbjct:   63 IPVKQFPKFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKEKEEELRQSGEAKYQHLNEDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDE 163          
BLAST of KHD-1 vs. Ensembl Medaka
Match: khdrbs1a (KH domain-containing, RNA-binding, signal transduction-associated protein 1 [Source:NCBI gene;Acc:101175524])

HSP 1 Score: 110.923 bits (276), Expect = 3.680e-26
Identity = 52/103 (50.49%), Postives = 71/103 (68.93%), Query Frame = 3
Query:  372 IPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAP 680
            IP++ YP VNFVGKLLGP G T+K +QE+T  K+S+LG GS+R+  KE+EL   G+ KY HL   LH+ I+      EAY  +++A+ EVKK +IP+P E  P
Sbjct:   66 IPIKQYPRVNFVGKLLGPQGSTIKRLQEETGAKISVLGKGSMRDKNKEEELRKGGEAKYAHLAMELHVFIEVTAPIPEAYMRMAHAMDEVKKFLIPEPGEHEP 168          
BLAST of KHD-1 vs. Planmine SMEST
Match: SMESG000070471.1 (SMESG000070471.1)

HSP 1 Score: 366.311 bits (939), Expect = 8.305e-124
Identity = 306/306 (100.00%), Postives = 306/306 (100.00%), Query Frame = 3
Query:   87 MDGQSQDYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLIDAYENELHGVDEATCPNIAMLVRNELFRLRGGXXXXXXXXXXXXXXXXXXXXIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAPGQMPMVTPLMXXXXXXXXXMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINNFNPMFMNGANDTGFTDDYPTMGFDNSFESXXXXXXXXXXXXXXXXXXNAPYSRPM 1004
            MDGQSQDYTQNADAQFQPAAQQNQQGNQQQQQPKRENQFQGLIDAYENELHGVDEATCPNIAMLVRNELFRLRGGVIDTVDVLTTKKTKVRTKVDIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAPGQMPMVTPLMGGPNGGFGGMRNQPMNQQRGGRGRGGNRGSNRGGVGGPPRINNFNPMFMNGANDTGFTDDYPTMGFDNSFESGRGGGKMMRGGGMDRMNRNAPYSRPM
Sbjct:    1 MDGQSQDYTQNADAQFQPAAQQNQQGNQQQQQPKRENQFQGLIDAYENELHGVDEATCPNIAMLVRNELFRLRGGVIDTVDVLTTKKTKVRTKVDIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAPGQMPMVTPLMGGPNGGFGGMRNQPMNQQRGGRGRGGNRGSNRGGVGGPPRINNFNPMFMNGANDTGFTDDYPTMGFDNSFESGRGGGKMMRGGGMDRMNRNAPYSRPM 306          
BLAST of KHD-1 vs. Planmine SMEST
Match: SMESG000004103.1 (SMESG000004103.1)

HSP 1 Score: 166.007 bits (419), Expect = 5.285e-47
Identity = 91/155 (58.71%), Postives = 117/155 (75.48%), Query Frame = 3
Query:  207 GLIDAYENELHGVDEATCPNIAMLVRNELFRLRGGXXXXXXXXXXXXXXXXXXXXIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNE 671
             LI+AYE EL  +D   CPN+   +R E+ RLR G+IDT+D L+ KK K+RTK+D PVE YP VNF GK++GP GKTLK +QEQT T+MS+LG+GS+RN  KE EL+ +GDPKY HL +R+HLQ+D +  PSEAY  IS AL E+KK + PDP+E
Sbjct:   13 ALIEAYEQELLTIDAVACPNVHSQIRMEIRRLREGIIDTIDTLSNKKVKIRTKIDFPVEQYPGVNFPGKIIGPGGKTLKELQEQTETRMSVLGAGSMRNRNKEMELIQTGDPKYQHLNERMHLQVDCLALPSEAYEKISKALIEIKKALTPDPSE 167          
BLAST of KHD-1 vs. Planmine SMEST
Match: SMESG000057199.1 (SMESG000057199.1)

HSP 1 Score: 126.716 bits (317), Expect = 5.512e-33
Identity = 80/147 (54.42%), Postives = 102/147 (69.39%), Query Frame = 3
Query:  213 IDAYENELHGVDEATCPNIAMLVRNELFRLRGGXXXXXXXXXXXXXXXXXXXXIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVM 653
            ID  E EL  +D+   P +A L   EL RLRGG+ D+VD+ + KK K+R KV IPV+ YP+VNFVGKLLGP   TLK +Q QTNTKM+ILG G L+N  K++E  N  D K    + +LHLQIDS+G P+EAYY +S+AL EV+  M
Sbjct:   16 IDILEQELKEIDDKY-PYLASLGEAELHRLRGGIADSVDLFSNKKVKIRAKVHIPVDQYPSVNFVGKLLGPGASTLKGIQGQTNTKMTILGVGVLKN--KKEEFQNKIDKKNISTKQKLHLQIDSLGTPAEAYYRLSHALVEVQNCM 159          
BLAST of KHD-1 vs. Planmine SMEST
Match: SMESG000057199.1 (SMESG000057199.1)

HSP 1 Score: 126.716 bits (317), Expect = 6.370e-33
Identity = 80/147 (54.42%), Postives = 102/147 (69.39%), Query Frame = 3
Query:  213 IDAYENELHGVDEATCPNIAMLVRNELFRLRGGXXXXXXXXXXXXXXXXXXXXIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVM 653
            ID  E EL  +D+   P +A L   EL RLRGG+ D+VD+ + KK K+R KV IPV+ YP+VNFVGKLLGP   TLK +Q QTNTKM+ILG G L+N  K++E  N  D K    + +LHLQIDS+G P+EAYY +S+AL EV+  M
Sbjct:   16 IDILEQELKEIDDK-YPYLASLGEAELHRLRGGIADSVDLFSNKKVKIRAKVHIPVDQYPSVNFVGKLLGPGASTLKGIQGQTNTKMTILGVGVLKN--KKEEFQNKIDKKNISTKQKLHLQIDSLGTPAEAYYRLSHALVEVQNCM 159          
BLAST of KHD-1 vs. Planmine SMEST
Match: SMESG000057199.1 (SMESG000057199.1)

HSP 1 Score: 123.635 bits (309), Expect = 6.604e-32
Identity = 80/147 (54.42%), Postives = 102/147 (69.39%), Query Frame = 3
Query:  213 IDAYENELHGVDEATCPNIAMLVRNELFRLRGGXXXXXXXXXXXXXXXXXXXXIPVEAYPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSGDPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVM 653
            ID  E EL  +D+   P +A L   EL RLRGG+ D+VD+ + KK K+R KV IPV+ YP+VNFVGKLLGP   TLK +Q QTNTKM+ILG G L+N  K++E  N  D K    + +LHLQIDS+G P+EAYY +S+AL EV+  M
Sbjct:   16 IDILEQELKEIDDKY-PYLASL---ELHRLRGGIADSVDLFSNKKVKIRAKVHIPVDQYPSVNFVGKLLGPGASTLKGIQGQTNTKMTILGVGVLKN--KKEEFQNKIDKKNISTKQKLHLQIDSLGTPAEAYYRLSHALVEVQNCM 156          
The following BLAST results are available for this feature:
BLAST of KHD-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KHDRBS32.046e-3055.45KH RNA binding domain containing, signal transduct... [more]
KHDRBS26.018e-2955.45KH RNA binding domain containing, signal transduct... [more]
KHDRBS37.762e-2955.45KH RNA binding domain containing, signal transduct... [more]
KHDRBS34.432e-2855.45KH RNA binding domain containing, signal transduct... [more]
KHDRBS14.883e-2653.61KH RNA binding domain containing, signal transduct... [more]
back to top
BLAST of KHD-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
E02D9.17.596e-1834.91pep chromosome:WBcel235:I:6800386:6803841:1 gene:W... [more]
E02D9.17.753e-1834.91pep chromosome:WBcel235:I:6800386:6801970:1 gene:W... [more]
asd-29.406e-1736.73RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
asd-22.455e-1636.73RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
asd-24.419e-1636.73RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of KHD-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qkr58E-18.301e-2952.00gene:FBgn0022986 transcript:FBtr0339537[more]
qkr58E-11.348e-2852.00gene:FBgn0022986 transcript:FBtr0346637[more]
qkr58E-11.510e-2852.00gene:FBgn0022986 transcript:FBtr0071843[more]
qkr58E-34.223e-2745.54gene:FBgn0022984 transcript:FBtr0339538[more]
qkr58E-34.223e-2745.54gene:FBgn0022984 transcript:FBtr0307214[more]
back to top
BLAST of KHD-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
khdrbs24.437e-2853.47KH domain containing, RNA binding, signal transduc... [more]
KHDRBS31.349e-2556.52KH domain containing, RNA binding, signal transduc... [more]
khdrbs1b4.176e-2448.45KH domain containing, RNA binding, signal transduc... [more]
khdrbs1a1.857e-2348.96KH domain containing, RNA binding, signal transduc... [more]
khdrbs1a2.449e-2348.96KH domain containing, RNA binding, signal transduc... [more]
back to top
BLAST of KHD-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KHDRBS31.052e-2754.46KH domain containing, RNA binding, signal transduc... [more]
pdc9.732e-2752.58phosducin [Source:Xenbase;Acc:XB-GENE-983832][more]
khdrbs21.061e-2652.48KH domain containing, RNA binding, signal transduc... [more]
pdc3.326e-2652.08phosducin [Source:Xenbase;Acc:XB-GENE-983832][more]
spsb32.033e-1538.54splA/ryanodine receptor domain and SOCS box contai... [more]
back to top
BLAST of KHD-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Khdrbs34.235e-3155.45KH domain containing, RNA binding, signal transduc... [more]
Khdrbs25.366e-2955.45KH domain containing, RNA binding, signal transduc... [more]
Khdrbs32.191e-2855.45KH domain containing, RNA binding, signal transduc... [more]
Khdrbs32.191e-2855.45KH domain containing, RNA binding, signal transduc... [more]
Khdrbs32.191e-2855.45KH domain containing, RNA binding, signal transduc... [more]
back to top
BLAST of KHD-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q920F3|KHDR2_RAT2.182e-2855.45KH domain-containing, RNA-binding, signal transduc... [more]
sp|P13230|GRP33_ARTSA2.864e-2854.46Glycine-rich protein GRP33 OS=Artemia salina OX=85... [more]
sp|Q5VWX1|KHDR2_HUMAN2.890e-2855.45KH domain-containing, RNA-binding, signal transduc... [more]
sp|Q9WU01|KHDR2_MOUSE3.753e-2855.45KH domain-containing, RNA-binding, signal transduc... [more]
sp|Q9R226|KHDR3_MOUSE1.533e-2755.45KH domain-containing, RNA-binding, signal transduc... [more]
back to top
BLAST of KHD-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXT92.986e-120100.00KHD-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A4S2M5942.008e-4654.71KH domain-containing protein OS=Opisthorchis felin... [more]
A0A4S2M5972.544e-4654.71KH domain-containing protein OS=Opisthorchis felin... [more]
A0A564YXH53.909e-4658.33KH domain-containing protein OS=Hymenolepis diminu... [more]
A0A4S2M5E94.080e-4654.71KH domain-containing protein OS=Opisthorchis felin... [more]
back to top
BLAST of KHD-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
khdrbs22.788e-2853.47KH domain containing, RNA binding, signal transduc... [more]
khdrbs24.016e-2853.47KH domain containing, RNA binding, signal transduc... [more]
khdrbs25.064e-2853.47KH domain containing, RNA binding, signal transduc... [more]
khdrbs29.260e-2853.47KH domain containing, RNA binding, signal transduc... [more]
khdrbs21.311e-2753.47KH domain containing, RNA binding, signal transduc... [more]
back to top
BLAST of KHD-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
KHDRBS34.191e-2849.52KH RNA binding domain containing, signal transduct... [more]
khdrbs22.308e-2752.48KH domain containing, RNA binding, signal transduc... [more]
khdrbs1a2.520e-2348.51KH domain containing, RNA binding, signal transduc... [more]
sf14.486e-641.86splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
back to top
BLAST of KHD-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MSL58.926e-1044.29Component of commitment complex; which defines fir... [more]
back to top
BLAST of KHD-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO441275.698e-2750.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302977.430e-1331.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454841.765e-741.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286413.388e-639.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of KHD-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
khdrbs23.674e-2954.46KH RNA binding domain containing, signal transduct... [more]
khdrbs24.934e-2954.46KH RNA binding domain containing, signal transduct... [more]
KHDRBS32.157e-2855.45KH RNA binding domain containing, signal transduct... [more]
KHDRBS32.397e-2855.45KH RNA binding domain containing, signal transduct... [more]
khdrbs1a3.680e-2650.49KH domain-containing, RNA-binding, signal transduc... [more]
back to top
BLAST of KHD-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070471.18.305e-124100.00SMESG000070471.1[more]
SMESG000004103.15.285e-4758.71SMESG000004103.1[more]
SMESG000057199.15.512e-3354.42SMESG000057199.1[more]
SMESG000057199.16.370e-3354.42SMESG000057199.1[more]
SMESG000057199.16.604e-3254.42SMESG000057199.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30013157
GenBankAFD29610.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013157 ID=SMED30013157|Name=KHD-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1677bp
TTCAAAATAAGTTTTAAAATATTTTGTTTAAAAGCATTACTTTATTTATT
TCAACGTGAAAGTTTTGGTTTCATATTCTTTTCAAAATGGATGGTCAAAG
TCAAGATTATACCCAAAATGCTGATGCGCAATTTCAACCTGCAGCACAAC
AAAATCAACAAGGTAATCAACAACAACAACAACCTAAACGTGAAAATCAA
TTCCAAGGACTAATTGATGCCTATGAAAATGAATTACATGGAGTTGATGA
AGCAACTTGCCCAAATATCGCCATGCTTGTTCGAAATGAACTTTTTAGAC
TTCGTGGAGGAGTTATTGATACTGTCGATGTACTAACTACTAAGAAAACT
AAAGTGCGTACAAAAGTTGATATTCCAGTTGAAGCATACCCAAATGTTAA
CTTTGTTGGAAAACTTTTGGGCCCAGCTGGTAAAACTCTAAAAACAGTTC
AAGAGCAAACTAACACTAAAATGTCAATATTGGGATCCGGTTCTTTAAGA
AATCCAGAAAAAGAACAGGAATTGTTAAACTCTGGTGATCCTAAATACAA
TCACTTGCGAGATCGTTTACATTTGCAAATCGATTCCATTGGCAATCCGT
CTGAAGCTTATTATAATATATCTTATGCACTAGCTGAAGTTAAAAAGGTC
ATGATTCCCGATCCTAACGAACAAGCTCCAGGGCAAATGCCAATGGTTAC
ACCTTTAATGGGAGGTCCTAATGGTGGTTTTGGTGGAATGAGAAATCAAC
CGATGAACCAACAACGAGGCGGTAGAGGTCGTGGAGGTAATCGAGGATCA
AATAGGGGTGGTGTTGGAGGTCCCCCAAGAATTAACAATTTTAACCCAAT
GTTTATGAATGGTGCAAATGACACCGGATTTACTGATGATTATCCAACCA
TGGGATTTGATAATAGTTTTGAATCGGGACGAGGAGGCGGGAAAATGATG
CGAGGTGGTGGTATGGATAGAATGAATCGAAATGCACCGTATTCTCGACC
CATGTGAAACATTCATTAACGTAGGTGCTGCTTTGTTAAAATAGCATCTA
TTTATCAAAAATGCATTTCATATTGACTTTAGAATATCGTATTGAAAAAT
CCAAAAAAAATCAAAACATTCAATGATAATAAGTATTTGTTAAACTCGTC
AATAGCAGCATGATTGTTAAAATTTGTATTTAATAATAAAATTTATATTC
ATGTATAAAATCGTTATTTAATTTTAATTTAATTACTTCAGCAAATTATT
TTAATATTTGAAATTTATTTTGATAATCTATGATGTTTGAGCACTGAGAG
CGGAAAAATGATTTTAATAACTGCGACAAAATATTTAAAATTCCAAATTT
CAGAAAACTAAACGAAAAATCTTTTCTAAAAAGTGGGTGAGTTATTAAAA
TTTAAATGTAGTGTAAATTTCATACTAATAACACATTTTTATGCTATTAT
CATTTTATTATTGCAGATTTTTGACTTGGACGGTTATGAAAACAATGGGG
AATGTTTGGACTTAGAAAAGATTGAGTAAGTCGTTAACTTAGAGATTAAG
TGGCCTTAATTCTCTATTACTCATCTAATGTTTATGTTTCTGAGACATGT
TAGTATTACATAACCCAATTGATTATTATTTTTGATAATATTGTGTTTAT
TTAAATAAATTTATTTGTTGAAAAAAA
back to top

protein sequence of SMED30013157-orf-1

>SMED30013157-orf-1 ID=SMED30013157-orf-1|Name=SMED30013157-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=307bp
MDGQSQDYTQNADAQFQPAAQQNQQGNQQQQQPKRENQFQGLIDAYENEL
HGVDEATCPNIAMLVRNELFRLRGGVIDTVDVLTTKKTKVRTKVDIPVEA
YPNVNFVGKLLGPAGKTLKTVQEQTNTKMSILGSGSLRNPEKEQELLNSG
DPKYNHLRDRLHLQIDSIGNPSEAYYNISYALAEVKKVMIPDPNEQAPGQ
MPMVTPLMGGPNGGFGGMRNQPMNQQRGGRGRGGNRGSNRGGVGGPPRIN
NFNPMFMNGANDTGFTDDYPTMGFDNSFESGRGGGKMMRGGGMDRMNRNA
PYSRPM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002013Category 1 cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR004087KH_dom
IPR004088KH_dom_type_1
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding