MIEAP domain-containing protein

Overview
NameMIEAP domain-containing protein
Smed IDSMED30013149
Length (bp)1668
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MIEAP domain-containing protein (SMED30013149) t-SNE clustered cells

Violin plots show distribution of expression levels for MIEAP domain-containing protein (SMED30013149) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MIEAP domain-containing protein (SMED30013149) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MIEAP domain-containing protein (SMED30013149) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013149

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30013149SMESG000019081.1 SmedASXL_011076SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013149SMESG000019081.1 dd_Smed_v4_6321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013149SMESG000019081.1 dd_Smed_v4_6321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013149SMESG000019081.1 dd_Smed_v4_6321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013149SMESG000019081.1 dd_Smed_v6_6321_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013149SMESG000019081.1 dd_Smed_v6_6321_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013149SMESG000019081.1 dd_Smed_v4_6321_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30013149SMESG000019081.1 dd_Smed_v4_6321_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30013149SMESG000019081.1 dd_Smed_v4_6321_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30013149SMESG000019081.1 dd_Smed_v4_6321_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MIEAP domain-containing protein vs. Ensembl Human
Match: SPATA18 (spermatogenesis associated 18 [Source:HGNC Symbol;Acc:HGNC:29579])

HSP 1 Score: 214.157 bits (544), Expect = 4.327e-62
Identity = 163/493 (33.06%), Postives = 258/493 (52.33%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGF--FSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIK--------------SEN----------------NLLKTKAYKTDS-----YKHEIEHLKDDVAILASHRNP----HCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICH-----GKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLI-GHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E L+RLV+  +   LQ +L+ WL  Y  NTCDQN+    E+IE  AKVQGQLF +L+  A EGG   G   IK+RLLP L   F   S G S DS +  L+DT   +++     R  ++ +  L+++LN TR + N ++ +L E +  LE   ++SA   +  ++EI  LK QL+S++              SEN                N LK  A + D+     YK ++ +LK+++A+L++ ++              +P     S          + V    P         +   L+++ +D +S +RLDA   L R  D  E  Q+II+ + +E+F+ AK AFR +K  VR  L   +  S   E++V  Y+  H D+  D  S   +VIR+++   P I  P  + F ++  FI+E C IA+ M AL  P+D+ +  ++GE++++ +YRRSYDS+++A  + +HVWP L ++  VI KGEAVT
Sbjct:    1 MAENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTAAAQEGGRNDGVETIKSRLLPWLEASFTAASLGKSVDSKVPSLQDTFDRERHKDPSPR--DRDMQQLDSNLNSTRSQCNQVQDDLVETEKNLEESKNRSAISLLAAEEEINQLKKQLKSLQAQEDARHRNTDQRSSENRRSEPWSLEERKREQWNSLKQNADQQDTEAMSDYKKQLRNLKEEIAVLSAEKSALQGRSSRSRSPSPAPRSRSCSRSRSASPSTAVKVRRPSPNRSKLSNVARKAALLSRFSDSYSQARLDAQCLLRRCIDKAETVQRIIYIATVEAFHVAKMAFRHFKIHVRKSLTPSYVGSNDFENAVLDYVICHLDL-YDSQSSVNDVIRAMNVN-PKISFPPVVDFCLLSDFIQEICCIAFAMQALEPPLDIAY-GADGEVFNDCKYRRSYDSDFTAPLVLYHVWPALMENDCVIMKGEAVT 488          
BLAST of MIEAP domain-containing protein vs. Ensembl Human
Match: SPATA18 (spermatogenesis associated 18 [Source:HGNC Symbol;Acc:HGNC:29579])

HSP 1 Score: 213.772 bits (543), Expect = 9.388e-62
Identity = 163/493 (33.06%), Postives = 258/493 (52.33%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGF--FSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIK--------------SEN----------------NLLKTKAYKTDS-----YKHEIEHLKDDVAILASHRNP----HCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICH-----GKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLI-GHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E L+RLV+  +   LQ +L+ WL  Y  NTCDQN+    E+IE  AKVQGQLF +L+  A EGG   G   IK+RLLP L   F   S G S DS +  L+DT   +++     R  ++ +  L+++LN TR + N ++ +L E +  LE   ++SA   +  ++EI  LK QL+S++              SEN                N LK  A + D+     YK ++ +LK+++A+L++ ++              +P     S          + V    P         +   L+++ +D +S +RLDA   L R  D  E  Q+II+ + +E+F+ AK AFR +K  VR  L   +  S   E++V  Y+  H D+  D  S   +VIR+++   P I  P  + F ++  FI+E C IA+ M AL  P+D+ +  ++GE++++ +YRRSYDS+++A  + +HVWP L ++  VI KGEAVT
Sbjct:    1 MAENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTAAAQEGGRNDGVETIKSRLLPWLEASFTAASLGKSVDSKVPSLQDTFDRERHKDPSPR--DRDMQQLDSNLNSTRSQCNQVQDDLVETEKNLEESKNRSAISLLAAEEEINQLKKQLKSLQAQEDARHRNTDQRSSENRRSEPWSLEERKREQWNSLKQNADQQDTEAMSDYKKQLRNLKEEIAVLSAEKSALQGRSSRSRSPSPAPRSRSCSRSRSASPSTAVKVRRPSPNRSKLSNVARKAALLSRFSDSYSQARLDAQCLLRRCIDKAETVQRIIYIATVEAFHVAKMAFRHFKIHVRKSLTPSYVGSNDFENAVLDYVICHLDL-YDSQSSVNDVIRAMNVN-PKISFPPVVDFCLLSDFIQEICCIAFAMQALEPPLDIAY-GADGEVFNDCKYRRSYDSDFTAPLVLYHVWPALMENDCVIMKGEAVT 488          
BLAST of MIEAP domain-containing protein vs. Ensembl Human
Match: SPATA18 (spermatogenesis associated 18 [Source:HGNC Symbol;Acc:HGNC:29579])

HSP 1 Score: 211.46 bits (537), Expect = 3.545e-61
Identity = 156/467 (33.40%), Postives = 250/467 (53.53%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGF--FSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQ---LESIKSEN-NLLKTKAYKTDS-----YKHEIEHLKDDVAILASHRNP----HCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICH-----GKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLI-GHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E L+RLV+  +   LQ +L+ WL  Y  NTCDQN+    E+IE  AKVQGQLF +L+  A EGG   G   IK+RLLP L   F   S G S DS +  L+DT   +++     R  ++ +  L+++LN TR + N ++ EL+        Q  + A  +  D++   + +++   LE  K E  N LK  A + D+     YK ++ +LK+++A+L++ ++              +P     S          + V    P         +   L+++ +D +S +RLDA   L R  D  E  Q+II+ + +E+F+ AK AFR +K  VR  L   +  S   E++V  Y+  H D+  D  S   +VIR+++   P I  P  + F ++  FI+E C IA+ M AL  P+D+ +  ++GE++++ +YRRSYDS+++A  + +HVWP L ++  VI KGEAVT
Sbjct:    1 MAENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTAAAQEGGRNDGVETIKSRLLPWLEASFTAASLGKSVDSKVPSLQDTFDRERHKDPSPR--DRDMQQLDSNLNSTRSQCNQVQDELKSL------QAQEDARHRNTDQRSSENRRSEPWSLEERKREQWNSLKQNADQQDTEAMSDYKKQLRNLKEEIAVLSAEKSALQGRSSRSRSPSPAPRSRSCSRSRSASPSTAVKVRRPSPNRSKLSNVARKAALLSRFSDSYSQARLDAQCLLRRCIDKAETVQRIIYIATVEAFHVAKMAFRHFKIHVRKSLTPSYVGSNDFENAVLDYVICHLDL-YDSQSSVNDVIRAMNVN-PKISFPPVVDFCLLSDFIQEICCIAFAMQALEPPLDIAY-GADGEVFNDCKYRRSYDSDFTAPLVLYHVWPALMENDCVIMKGEAVT 456          
BLAST of MIEAP domain-containing protein vs. Ensembl Human
Match: SPATA18 (spermatogenesis associated 18 [Source:HGNC Symbol;Acc:HGNC:29579])

HSP 1 Score: 86.6557 bits (213), Expect = 4.906e-20
Identity = 49/103 (47.57%), Postives = 62/103 (60.19%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFF--STGLSSDSSLKVLE 362
            M+E L+RLV+  +   LQ +L+ WL  Y  NTCDQN+    E+IE  AKVQGQLF +L+  A EGG   G   IK+RLLP L   F   S G S DS +  L+
Sbjct:    1 MAENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTAAAQEGGRNDGVETIKSRLLPWLEASFTAASLGKSVDSKVPSLQ 103          
BLAST of MIEAP domain-containing protein vs. Ensembl Zebrafish
Match: spata18 (spermatogenesis associated 18 [Source:NCBI gene;Acc:497395])

HSP 1 Score: 277.33 bits (708), Expect = 1.395e-86
Identity = 166/449 (36.97%), Postives = 268/449 (59.69%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFF--STGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNPHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIG-HSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M++ LRRLVN+  +++LQ +L+ W  +Y   +CDQN+ R CE++EL +K+QGQLF +L+L A EGG Y G   +K+RLLP LG  F   ++ +SSD+SL +++++    + ++E+  ++E +L  +E  L  TR E +++K EL +  +EL+   ++SA+  +  + EI  LK++L   + + +L K K    D Y+ ++  L+D+V+ L + +           SP  P       +                 ++ +LV++ +DL++  RL++ + L +Y DD E  Q+I+F + +ESF AAK A+R +KSRVR  L   H    SLED+V  YI  + D+  DV +   +VI +++   P I  P  + F +I SFIREACRIA+ M  L  P+D+   +S+GELY + +YRRS+DSE++A  ++ HVWP L +   VI KGEAVT
Sbjct:    1 MADTLRRLVNSSPYSVLQDKLDAWYKDYHVYSCDQNLNRCCELVELTSKIQGQLFTILNLTAQEGGHYSGVDTLKSRLLPWLGSCFTIAASAVSSDTSLSLIQESVEKDRKIRELSSVHESNLQKIEDQLCSTRIELDSVKRELVDTHIELDSTKNKSATTLLATEDEILHLKSELRVAQDQLDLYKRKLDVLDDYERQVRILRDEVSFLNAEKTVLQDRLARSRSPS-PLLRRSRSVSPVRGESPTRAQLTSSSRHARLVSRFSDLYATERLESQSLLLKYIDDLETVQRILFIAAVESFQAAKLAYRQFKSRVRKTLSSTHIGPESLEDAVVDYIVRNLDL-YDVQTSINDVINAMNVN-PRISFPPEVDFVLISSFIREACRIAFAMQTLDPPLDLAF-SSDGELYSDVKYRRSFDSEFTAPLVAFHVWPALLEGDTVILKGEAVT 445          
BLAST of MIEAP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000051448.1 (spermatogenesis associated 18 [Source:NCBI gene;Acc:100379837])

HSP 1 Score: 260.381 bits (664), Expect = 1.044e-79
Identity = 168/450 (37.33%), Postives = 261/450 (58.00%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGF--FSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNPHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQ-QLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDL-IGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M++ LRRL N+    +LQ +L+ W  +Y  N+CD N+   CE++ELN+K+QGQLFK+LS+ A EGG Y G   +K+R LP LG  F   S G  S++S  +L ++   K +       +E+ L+++E+ L+ TR E N+++ EL E +++LE   ++SA+  +  ++EI  L+ +L + + +  L    +   D Y+ +I  L+D+++IL++  N              P                  C  I +   Q +L+++ ND+F+  RLDA T L RY DD E  Q+IIF + +ESF+AAK AFR ++ RVR  L   H    SLED+V  YI  + D+  DV S   EVI +++   P I  P  + F +I +FIRE CR+A+ M  L  P+D+   T +GEL+ E +YRR+YDSE++A  + +HVWP L ++  VI KGEA+T
Sbjct:   25 MADTLRRLANSEKCRVLQDKLDDWYKDYHINSCDSNLNVCCELLELNSKIQGQLFKILSVTAREGGQYAGVETLKSRFLPWLGTCFSASSPGSFSENSCSILNESMERKLSAS-----HERELNEVESKLSSTRIELNSVRQELLETQMDLEDTKNKSANTLLATEEEILQLRAELRAAREKLELRSLDS--IDDYEKQIRLLRDEISILSAE-NGILNSRVSRSRSPSPIRHSSRSSSPFPRSESPTCAKITNASRQARLISRFNDIFANDRLDAQTLLRRYIDDLEMVQRIIFIATVESFHAAKMAFRQFRLRVRKSLSPSHMGPESLEDTVIDYIVRNLDL-YDVQSSVNEVISAMNVN-PKISFPPDVDFILISAFIREVCRVAFAMQTLDPPLDIAF-TVDGELFTESKYRRTYDSEHTAPLVYYHVWPALMENDNVIVKGEALT 463          
BLAST of MIEAP domain-containing protein vs. Ensembl Xenopus
Match: itga8 (integrin subunit alpha 8 [Source:Xenbase;Acc:XB-GENE-961825])

HSP 1 Score: 248.44 bits (633), Expect = 1.988e-75
Identity = 164/449 (36.53%), Postives = 258/449 (57.46%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGF--FSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNPHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIGHSHSC-SLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M++ LRRL N+    +LQ +L++W  +Y  N+CD N+   CE++ELN+ VQGQLF++LS+ A EGG Y G   IK+R LP LG  F   S G  S++S  +L     N    +++   +E+ L ++E+ L+ TR + N+++ EL E +++LE   ++SA+  +  ++EI  L+ +L   + + +L    +   D Y+ +I  LKD+++IL+S  +          SP    HS         +            +  +L+ + N++F+  RLDA T L RY +D +  Q+IIF + +ESF AAK AFR ++ RVR  L        SLED+V  YI  + D+  DV S   EVI +++   P I  P  + F +I  FIRE CR+A+ M  L  P+D+   T++GEL+ + +YRR+YDSE++A  + +HVWP L ++  VI KGEAVT
Sbjct:    1 MADTLRRLANSEKCRVLQDKLDNWYKDYHINSCDSNLNVCCELLELNSNVQGQLFQILSVTAREGGQYAGVETIKSRFLPWLGTCFSTSSPGSFSENSFAIL-----NHSMQRKLSTSHERELIEVESKLSSTRIDLNSVRQELLETQMDLEDTKTKSANTLLATEEEILQLRAELRVAREKLDLKSLDS--IDDYERQIRLLKDEISILSSENSILKSRLSRSRSPSPIRHSSRSSSPFTRSESPTSAKLTSASRQARLIFRFNNIFANDRLDAQTLLRRYIEDLDMVQRIIFIATVESFRAAKMAFRQFRLRVRKSLSPSQMGPESLEDAVIDYIVRNLDL-FDVQSSVNEVIGAMNVN-PKISFPPEVDFILISGFIREVCRVAFAMQTLDPPLDIAF-TADGELFTDSKYRRTYDSEHTAPLVYYHVWPALMENDNVIVKGEAVT 439          
BLAST of MIEAP domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000051452.1 (spermatogenesis associated 18 [Source:NCBI gene;Acc:100379837])

HSP 1 Score: 245.743 bits (626), Expect = 1.578e-74
Identity = 163/452 (36.06%), Postives = 242/452 (53.54%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFF--STGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIK--SENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNPHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQ-QLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDL-IGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M++ LRRL N+    +LQ +L+ W  +Y  N+CD N+   CE++ELN+K+QGQLFK+LS+ A EGG Y G   +K+R LP LG  F   S G  S++S  +L ++   K +       +E+ L+++E+ L+ TR E N++                         +QE+ + +  LE  K  S N LL T+         EI  L+ +V+     R+P  +                             C  I +   Q +L+++ ND+F+  RLDA T L RY DD E  Q+IIF + +ESF+AAK AFR ++ RVR  L   H    SLED+V  YI  + D+  DV S   EVI +++   P I  P  + F +I +FIRE CR+A+ M  L  P+D+   T +GEL+ E +YRR+YDSE++A  + +HVWP L ++  VI KGEA+T
Sbjct:   25 MADTLRRLANSEKCRVLQDKLDDWYKDYHINSCDSNLNVCCELLELNSKIQGQLFKILSVTAREGGQYAGVETLKSRFLPWLGTCFSASSPGSFSENSCSILNESMERKLSAS-----HERELNEVESKLSSTRIELNSV-------------------------RQELLETQMDLEDTKNKSANTLLATE--------EEILQLRAEVS---RSRSPSPIRH------------SSRSSSPFPRSESPTCAKITNASRQARLISRFNDIFANDRLDAQTLLRRYIDDLEMVQRIIFIATVESFHAAKMAFRQFRLRVRKSLSPSHMGPESLEDTVIDYIVRNLDL-YDVQSSVNEVISAMNVN-PKISFPPDVDFILISAFIREVCRVAFAMQTLDPPLDIAF-TVDGELFTESKYRRTYDSEHTAPLVYYHVWPALMENDNVIVKGEALT 420          
BLAST of MIEAP domain-containing protein vs. Ensembl Xenopus
Match: itga8 (integrin subunit alpha 8 [Source:Xenbase;Acc:XB-GENE-961825])

HSP 1 Score: 245.358 bits (625), Expect = 2.695e-74
Identity = 163/461 (35.36%), Postives = 257/461 (55.75%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGF--FSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRN------------PHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIGHSHSC-SLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M++ LRRL N+    +LQ +L++W  +Y  N+CD N+   CE++ELN+ VQGQLF++LS+ A EGG Y G   IK+R LP LG  F   S G  S++S   ++         +++   +E+ L ++E+ L+ TR + N+++ EL E +++LE   ++SA+  +  ++EI  L+ +L   + + +L    +   D Y+ +I  LKD+++IL+S  +                HS    SP     S                      +  +L+ + N++F+  RLDA T L RY +D +  Q+IIF + +ESF AAK AFR ++ RVR  L        SLED+V  YI  + D+  DV S   EVI +++   P I  P  + F +I  FIRE CR+A+ M  L  P+D+   T++GEL+ + +YRR+YDSE++A  + +HVWP L ++  VI KGEAVT
Sbjct:    1 MADTLRRLANSEKCRVLQDKLDNWYKDYHINSCDSNLNVCCELLELNSNVQGQLFQILSVTAREGGQYAGVETIKSRFLPWLGTCFSTSSPGSFSENSFHSMQ---------RKLSTSHERELIEVESKLSSTRIDLNSVRQELLETQMDLEDTKTKSANTLLATEEEILQLRAELRVAREKLDLKSLDS--IDDYERQIRLLKDEISILSSENSILKSRLSRSRSPSPIRHSSRSSSPFTRSESPTS------------AKLTSASRQARLIFRFNNIFANDRLDAQTLLRRYIEDLDMVQRIIFIATVESFRAAKMAFRQFRLRVRKSLSPSQMGPESLEDAVIDYIVRNLDL-FDVQSSVNEVIGAMNVN-PKISFPPEVDFILISGFIREVCRVAFAMQTLDPPLDIAF-TADGELFTDSKYRRTYDSEHTAPLVYYHVWPALMENDNVIVKGEAVT 435          
BLAST of MIEAP domain-containing protein vs. Ensembl Mouse
Match: Spata18 (spermatogenesis associated 18 [Source:MGI Symbol;Acc:MGI:1920722])

HSP 1 Score: 196.823 bits (499), Expect = 1.594e-55
Identity = 150/496 (30.24%), Postives = 256/496 (51.61%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFST--GLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSAS--DKMFDKQEIRDLKTQLESIKSENNLL-------KTKAYKTD-----------------SYKHEIEHLKDDVAILASHRNPHCLHSPICHSPCDPCHSHGCLL-------------DSCCTLHVDHCDPICH-------GKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIGHS--HSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E L++L  + S   LQ ++ +W+++Y  N+CDQN+    E+IE  AKVQ QLF +L++ A EGG   G   IK RLLP+L   F S   G +++S +   +D     KN     R      D  ++D N +  E    +++ + A+     +G+++ S    +  ++EI  LK QL+S++++ +         +++A K+D                 +Y+  +++LK+++A+L++ ++     S    SP     SH                 +S CT       P  +        +   L+++ +D +S +RLDA   L R  D  E  Q+II+ + +E+F+ AK AFR +K RVR  L   +   +   E +V  YI  H D+  D  S   +VIR+++   P I  P  + F ++  FI+E C IA+ M +L  P+D+    ++GE++++ +YRRSYDS+++A  + +HVWP L ++  VI KGEAVT
Sbjct:    1 MAESLKKLAKSESLQALQDKVTYWVNDYNSNSCDQNLNYCIELIEQVAKVQAQLFGILTVTAQEGGNNEGVETIKCRLLPLLQTSFSSVNMGKTAESEMCATQDFQLRSKN-----RDNSPDQDQHQSD-NESFSETQPTQVQDDLAESGKSLEGAKNGSTISLLAAEEEINQLKKQLKSLQAQEDARHKTSENRRSEALKSDHRSTKRTQDQRPQDVVSNYEKHLQNLKEEIAVLSAEKSGLQGRSARSPSPSTGTRSHRRGRSRSHSRSRSHSRSNSPCTTVAKIRSPSPNRAKMSSVARKAALLSRFSDAYSQARLDAQCLLRRCIDRAETVQRIIYIATVEAFHVAKMAFRHFKIRVRKMLTPSNVGSNTDFETAVSEYIVCHLDL-YDSQSSVNDVIRAMNVN-PKISFPPEVDFCLLTDFIQEICCIAFAMQSLEPPLDIAF-GADGEIFNDCKYRRSYDSDFTAPLVFYHVWPALMENDCVIMKGEAVT 487          
BLAST of MIEAP domain-containing protein vs. Ensembl Mouse
Match: Spata18 (spermatogenesis associated 18 [Source:MGI Symbol;Acc:MGI:1920722])

HSP 1 Score: 191.045 bits (484), Expect = 6.663e-54
Identity = 143/470 (30.43%), Postives = 234/470 (49.79%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFST--GLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNPHCLHSPICHSPCDPCHSHGCLL-------------DSCCTLHVDHCDPICH-------GKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIGHS--HSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E L++L  + S   LQ ++ +W+++Y  N+CDQN+    E+IE  AKVQ QLF +L++ A EGG   G   IK RLLP+L   F S   G +++S +   +D     KN     R      D  ++D      E+ +     +        Q  + A  K  + +    LK+   S K   +          +Y+  +++LK+++A+L++ ++     S    SP     SH                 +S CT       P  +        +   L+++ +D +S +RLDA   L R  D  E  Q+II+ + +E+F+ AK AFR +K RVR  L   +   +   E +V  YI  H D+  D  S   +VIR+++   P I  P  + F ++  FI+E C IA+ M +L  P+D+    ++GE++++ +YRRSYDS+++A  + +HVWP L ++  VI KGEAVT
Sbjct:    1 MAESLKKLAKSESLQALQDKVTYWVNDYNSNSCDQNLNYCIELIEQVAKVQAQLFGILTVTAQEGGNNEGVETIKCRLLPLLQTSFSSVNMGKTAESEMCATQDFQLRSKN-----RDNSPDQDQHQSD-----NESFSETQPTQVQDELKSLQAQEDARHKTSENRRSEALKSDHRSTKRTQDQRPQDV--VSNYEKHLQNLKEEIAVLSAEKSGLQGRSARSPSPSTGTRSHRRGRSRSHSRSRSHSRSNSPCTTVAKIRSPSPNRAKMSSVARKAALLSRFSDAYSQARLDAQCLLRRCIDRAETVQRIIYIATVEAFHVAKMAFRHFKIRVRKMLTPSNVGSNTDFETAVSEYIVCHLDL-YDSQSSVNDVIRAMNVN-PKISFPPEVDFCLLTDFIQEICCIAFAMQSLEPPLDIAF-GADGEIFNDCKYRRSYDSDFTAPLVFYHVWPALMENDCVIMKGEAVT 455          
BLAST of MIEAP domain-containing protein vs. Ensembl Mouse
Match: Spata18 (spermatogenesis associated 18 [Source:MGI Symbol;Acc:MGI:1920722])

HSP 1 Score: 129.798 bits (325), Expect = 3.226e-34
Identity = 74/196 (37.76%), Postives = 118/196 (60.20%), Query Frame = 3
Query:  816 GKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIGHS--HSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
             +   L+++ +D +S +RLDA   L R  D  E  Q+II+ + +E+F+ AK AFR +K RVR  L   +   +   E +V  YI  H D+  D  S   +VIR+++   P I  P  + F ++  FI+E C IA+ M +L  P+D+    ++GE++++ +YRRSYDS+++A  + +HVWP L ++  VI KGEAVT
Sbjct:    5 ARKAALLSRFSDAYSQARLDAQCLLRRCIDRAETVQRIIYIATVEAFHVAKMAFRHFKIRVRKMLTPSNVGSNTDFETAVSEYIVCHLDL-YDSQSSVNDVIRAMNVN-PKISFPPEVDFCLLTDFIQEICCIAFAMQSLEPPLDIAF-GADGEIFNDCKYRRSYDSDFTAPLVFYHVWPALMENDCVIMKGEAVT 197          
BLAST of MIEAP domain-containing protein vs. Ensembl Mouse
Match: Spata18 (spermatogenesis associated 18 [Source:MGI Symbol;Acc:MGI:1920722])

HSP 1 Score: 129.798 bits (325), Expect = 3.870e-32
Identity = 74/191 (38.74%), Postives = 117/191 (61.26%), Query Frame = 3
Query:  831 LVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIGHS--HSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            L+++ +D +S +RLDA   L R  D  E  Q+II+ + +E+F+ AK AFR +K RVR  L   +   +   E +V  YI  H D+  D  S   +VIR+++   P I  P  + F ++  FI+E C IA+ M +L  P+D+    ++GE++++ +YRRSYDS+++A  + +HVWP L ++  VI KGEAVT
Sbjct:  186 LLSRFSDAYSQARLDAQCLLRRCIDRAETVQRIIYIATVEAFHVAKMAFRHFKIRVRKMLTPSNVGSNTDFETAVSEYIVCHLDL-YDSQSSVNDVIRAMNVN-PKISFPPEVDFCLLTDFIQEICCIAFAMQSLEPPLDIAF-GADGEIFNDCKYRRSYDSDFTAPLVFYHVWPALMENDCVIMKGEAVT 373          
BLAST of MIEAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q503Q1|MIEAP_DANRE (Mitochondria-eating protein OS=Danio rerio OX=7955 GN=spata18 PE=2 SV=2)

HSP 1 Score: 277.33 bits (708), Expect = 1.053e-85
Identity = 166/449 (36.97%), Postives = 268/449 (59.69%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFF--STGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNPHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIG-HSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M++ LRRLVN+  +++LQ +L+ W  +Y   +CDQN+ R CE++EL +K+QGQLF +L+L A EGG Y G   +K+RLLP LG  F   ++ +SSD+SL +++++    + ++E+  ++E +L  +E  L  TR E +++K EL +  +EL+   ++SA+  +  + EI  LK++L   + + +L K K    D Y+ ++  L+D+V+ L + +           SP  P       +                 ++ +LV++ +DL++  RL++ + L +Y DD E  Q+I+F + +ESF AAK A+R +KSRVR  L   H    SLED+V  YI  + D+  DV +   +VI +++   P I  P  + F +I SFIREACRIA+ M  L  P+D+   +S+GELY + +YRRS+DSE++A  ++ HVWP L +   VI KGEAVT
Sbjct:    1 MADTLRRLVNSSPYSVLQDKLDAWYKDYHVYSCDQNLNRCCELVELTSKIQGQLFTILNLTAQEGGHYSGVDTLKSRLLPWLGSCFTIAASAVSSDTSLSLIQESVEKDRKIRELSSVHESNLQKIEDQLCSTRIELDSVKRELVDTHIELDSTKNKSATTLLATEDEILHLKSELRVAQDQLDLYKRKLDVLDDYERQVRILRDEVSFLNAEKTVLQDRLARSRSPS-PLLRRSRSVSPVRGESPTRAQLTSSSRHARLVSRFSDLYATERLESQSLLLKYIDDLETVQRILFIAAVESFQAAKLAYRQFKSRVRKTLSSTHIGPESLEDAVVDYIVRNLDL-YDVQTSINDVINAMNVN-PRISFPPEVDFVLISSFIREACRIAFAMQTLDPPLDLAF-SSDGELYSDVKYRRSFDSEFTAPLVAFHVWPALLEGDTVILKGEAVT 445          
BLAST of MIEAP domain-containing protein vs. UniProt/SwissProt
Match: sp|E1BW58|MIEAP_CHICK (Mitochondria-eating protein OS=Gallus gallus OX=9031 GN=SPATA18 PE=3 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 1.709e-74
Identity = 165/456 (36.18%), Postives = 255/456 (55.92%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGF--FSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKS-ENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNPHCLHSPICHSPC-DPCHSHGCLLDSCCTLHVDHCDP-----ICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDL-IGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+  L++L    S  ++Q +LE W  +Y+ N+CDQN+ + CE+IE+ + +QGQLF +L+  + E G Y G   IK RLLP LG  F   ++G   ++ L + +D+   ++ ++++       L DL+ +L  TR E N ++ +L + +L LE   +Q A+  +    EI  L+  L++ ++ E + L+   +  D  + +IE L+D+++IL + ++   L S I  S    P         S   L +  C P         ++  LV +  D++S  R DA   L  Y  D E  Q+II+ + +ESF+AAK A+R +K RVR  L IGHS   SLED+V  YI  H D+  DV +   EVIRS++   P I       F VI SFIRE CR+A+ M  L  P+DV     +GE + E +Y RS DS+Y+AA +++HVWP L ++ +VI KGEAVT
Sbjct:    1 MAGSLKKLAKAESCRLMQEKLESWSKDYEINSCDQNLNQCCELIEMTSVIQGQLFTILNETSRESGHYAGVDTIKTRLLPWLGTWFSHATSGRLFETGLFLNQDSTETERKLRQLATSQTLQLQDLQEELTSTRLELNHVQQDLAQTQLALEDTKTQLATTLLTAADEIIQLRAVLKASRAQEEDSLRRLDHLNDC-EQQIERLRDELSILDAQKS--VLQSRIARSRSPSPRRIRS---RSPSPLPLRSCSPGRARSTNASRHAFLVARFGDIYSKDRFDAERILRTYISDMEMVQRIIYTAAVESFHAAKMAYRQFKMRVRKTLSIGHSGPESLEDTVMDYIVRHEDL-YDVQASVNEVIRSMNIN-PKISSTPECDFAVISSFIRELCRVAFSMQTLTPPLDVAFGM-DGEFFSETKYHRSVDSDYTAALVAYHVWPALMENDVVIVKGEAVT 447          
BLAST of MIEAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q498J5|MIEAP_XENLA (Mitochondria-eating protein OS=Xenopus laevis OX=8355 GN=spata18 PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 9.426e-72
Identity = 166/449 (36.97%), Postives = 258/449 (57.46%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGF--FSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNPHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDL-IGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M++ LRRL N+    +LQ +L+ W  +Y  N+CD N+   CE++ELN+KVQGQLFK+LS+ A EGG Y G   IK+R LP LG  F   S G  S++S   L ++   K +       +E+ L+++E+ L+ TR E N+++ EL E +++LE   ++SA+  +  ++EI  L+ +L + + +  L    +   D Y+ +I  LKD+++IL+S  +          SP    HS         +            +  +L+++ ND+F+  RLDA T L RY  D +  Q+IIF + +ESF++AK AFR ++ RV   L   H    SLED+V  YI  + D+  DV S   EVI +++   P I  P  + F +I  FI+E CR+A+ M  L  P+D+   T +GEL+ + +YRR+YDSE++A  + +HVWP L ++  VI KGEAVT
Sbjct:    1 MADILRRLTNSERCRLLQDKLDDWYKDYHINSCDSNLNVCCELLELNSKVQGQLFKILSVTAQEGGQYAGVETIKSRFLPWLGTCFSTASPGSFSENSFVTLNESMERKLSTS-----HERELNEVESKLSSTRIELNSVRQELLETQMDLEDTKTKSANTLLATEEEILQLRAELRAAREKLELRSLDS--IDEYERQIRLLKDEISILSSESSILKSRLSRSRSPSPIRHSSRSSSPFARSESPTSAKLTSASRQARLISRFNDIFANDRLDAQTLLRRYIQDLDMVQRIIFIATVESFHSAKMAFRQFRLRVCKSLSPSHMGPESLEDAVIDYIVGNLDL-YDVQSSVNEVISAMNVN-PKISFPPEVDFILISGFIQEVCRVAFTMQTLDPPLDIAF-TVDGELFTDSKYRRTYDSEHTAPLVYYHVWPALMENDNVIVKGEAVT 439          
BLAST of MIEAP domain-containing protein vs. UniProt/SwissProt
Match: sp|E1BLK7|MIEAP_BOVIN (Mitochondria-eating protein OS=Bos taurus OX=9913 GN=SPATA18 PE=3 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 4.553e-64
Identity = 161/494 (32.59%), Postives = 254/494 (51.42%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFSTGLSS--DSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSEN-----NLLKTKAYKTDS--------------------------------YKHEIEHLKDDVAILASHRNPHCLHSPICHSPCD-PCHSHGCLLDSCCTLHVDHCDPICH-------GKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIGH-SHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M++ LRRLV+  +   LQ +LE WL  Y  N+CDQN+    E+IE  AKVQGQLF +L++ A EGG Y G   IK+RLLP L   F +  L    DS +  L+DT    ++    K    + +  L+ DL+ TR + N ++ ++ E +  LE   ++SA   +  ++EI  LK QL+S++++      N  + ++ K  S                                Y+ ++  LKD++A+L++ ++     S    SP   PC        S          P  +        +   L+++ +D +S  RLDA   L R  D  E  Q+II+ + +E+F+ AK AFR +K RVR  L    + S   ED+V  YI  H D+  D  S   +VIR+++   P I  P  + F ++ +FI+E C IA+ M  L  P+D+    ++GE++++ +YRRSYDS+++A  + +HVWP L ++  VI KGEAVT
Sbjct:    1 MADNLRRLVSNEALRSLQDKLESWLREYNANSCDQNLNHCLELIEQVAKVQGQLFGILTIAAQEGGHYDGVETIKSRLLPWLEASFTAASLGKPVDSKVPSLQDTFDKDRH----KESGTRDIQQLDADLSATRNQLNQVQDDMAETEKTLEEPKNRSAISLLAAEEEINQLKKQLKSLQAQEESRHRNSDRRRSEKRGSERRRVELRGSEQRVSDLDRRSANQRNAEAVCDYEKQLRTLKDEIAVLSAEKSVLQGRSARSRSPSPAPCSRSHSRSRSTSPSSAKARTPSPNRAKLSSVARKAALLSRFSDAYSQGRLDAQCLLRRCIDKAETVQRIIYIATVEAFHVAKMAFRHFKIRVRKSLTPSCAGSNDFEDAVSDYIICHLDL-YDSQSSVNDVIRAMNVN-PKISFPPEVDFCLLSNFIQEICCIAFAMQTLEPPLDIAF-GADGEIFNDCKYRRSYDSDFTAPLVFYHVWPALMENDCVIMKGEAVT 487          
BLAST of MIEAP domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8TC71|MIEAP_HUMAN (Mitochondria-eating protein OS=Homo sapiens OX=9606 GN=SPATA18 PE=1 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 4.509e-61
Identity = 163/493 (33.06%), Postives = 258/493 (52.33%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGF--FSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIK--------------SEN----------------NLLKTKAYKTDS-----YKHEIEHLKDDVAILASHRNP----HCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICH-----GKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLI-GHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E L+RLV+  +   LQ +L+ WL  Y  NTCDQN+    E+IE  AKVQGQLF +L+  A EGG   G   IK+RLLP L   F   S G S DS +  L+DT   +++     R  ++ +  L+++LN TR + N ++ +L E +  LE   ++SA   +  ++EI  LK QL+S++              SEN                N LK  A + D+     YK ++ +LK+++A+L++ ++              +P     S          + V    P         +   L+++ +D +S +RLDA   L R  D  E  Q+II+ + +E+F+ AK AFR +K  VR  L   +  S   E++V  Y+  H D+  D  S   +VIR+++   P I  P  + F ++  FI+E C IA+ M AL  P+D+ +  ++GE++++ +YRRSYDS+++A  + +HVWP L ++  VI KGEAVT
Sbjct:    1 MAENLKRLVSNETLRTLQEKLDFWLKEYNTNTCDQNLNHCLELIEQVAKVQGQLFGILTAAAQEGGRNDGVETIKSRLLPWLEASFTAASLGKSVDSKVPSLQDTFDRERHKDPSPR--DRDMQQLDSNLNSTRSQCNQVQDDLVETEKNLEESKNRSAISLLAAEEEINQLKKQLKSLQAQEDARHRNTDQRSSENRRSEPWSLEERKREQWNSLKQNADQQDTEAMSDYKKQLRNLKEEIAVLSAEKSALQGRSSRSRSPSPAPRSRSCSRSRSASPSTAVKVRRPSPNRSKLSNVARKAALLSRFSDSYSQARLDAQCLLRRCIDKAETVQRIIYIATVEAFHVAKMAFRHFKIHVRKSLTPSYVGSNDFENAVLDYVICHLDL-YDSQSSVNDVIRAMNVN-PKISFPPVVDFCLLSDFIQEICCIAFAMQALEPPLDIAY-GADGEVFNDCKYRRSYDSDFTAPLVLYHVWPALMENDCVIMKGEAVT 488          
BLAST of MIEAP domain-containing protein vs. TrEMBL
Match: A0A1S3K2R8 (mitochondria-eating protein isoform X1 OS=Lingula unguis OX=7574 GN=LOC106169214 PE=4 SV=1)

HSP 1 Score: 405.601 bits (1041), Expect = 3.156e-132
Identity = 220/461 (47.72%), Postives = 317/461 (68.76%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFSTG--LSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNP---HCLHSPI---CHSPC------DPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIG-HSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E LRRLVN  SF+ILQ +LE WLD+Y  N+CDQNVAR CEIIELNAKVQGQ+FKLLSLCASEGG+YGGA  IK+RLLP LG+ FF++G  +++D+SL VL + AS  + + E++  YE+S+ DLE +L +T  EN+ L+ +L EA+ EL+R   +S S+KMF++ EIRDL+ +L   + EN  L+ K+   D Y+ ++  L++++AIL   RN    H  H P+    HS        D   ++  L      L  D  D     + Q L+T+ ND+F+  RLDAM  L RYSDDHENNQ+I+F +++E+F +AK AFR +K +VR++L   H    +LE++VQ YIN + D+  D+ SL  +V+R+L+  + +   PA +S+++IG+FIREAC++AW+MSAL  P+D+   +S+ EL+D+ +YRRSYDSEY+A  ++HH+W CL++   VI KGEA T
Sbjct:    1 MAESLRRLVNIASFSILQEKLERWLDDYHVNSCDQNVARCCEIIELNAKVQGQIFKLLSLCASEGGMYGGAGAIKSRLLPWLGQSFFASGGSVTADTSLSVLAEAASKDREINELQDQYERSIVDLEDNLRVTNIENDNLRTDLAEAQDELDRTKRESTSEKMFNESEIRDLRNKLALAEDENRNLREKSGLLDDYERQLRILREEIAILTGERNSVLKHRSHVPLYQHTHSSTQSIVNGDMSDTYRSLPRVSSPLSPD--DVTQRVRQQNLITRFNDMFAQDRLDAMDILRRYSDDHENNQRIVFAALVEAFASAKLAFRQFKLKVRSNLAATHVGPDTLEEAVQDYINRNTDL-YDLPSLQADVVRALNRNIKIFL-PADISYNIIGTFIREACKLAWQMSALAHPLDI-AVSSDAELFDDYKYRRSYDSEYTAPLVNHHIWACLQQGTKVIVKGEACT 456          
BLAST of MIEAP domain-containing protein vs. TrEMBL
Match: A0A1S3K339 (mitochondria-eating protein isoform X2 OS=Lingula unguis OX=7574 GN=LOC106169214 PE=4 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 6.450e-132
Identity = 220/461 (47.72%), Postives = 317/461 (68.76%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFSTG--LSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNP---HCLHSPI---CHSPC------DPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIG-HSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E LRRLVN  SF+ILQ +LE WLD+Y  N+CDQNVAR CEIIELNAKVQGQ+FKLLSLCASEGG+YGGA  IK+RLLP LG+ FF++G  +++D+SL VL + AS  + + E++  YE+S+ DLE +L +T  EN+ L+ +L EA+ EL+R   +S S+KMF++ EIRDL+ +L   + EN  L+ K+   D Y+ ++  L++++AIL   RN    H  H P+    HS        D   ++  L      L  D  D     + Q L+T+ ND+F+  RLDAM  L RYSDDHENNQ+I+F +++E+F +AK AFR +K +VR++L   H    +LE++VQ YIN + D+  D+ SL  +V+R+L+  + +   PA +S+++IG+FIREAC++AW+MSAL  P+D+   +S+ EL+D+ +YRRSYDSEY+A  ++HH+W CL++   VI KGEA T
Sbjct:    1 MAESLRRLVNIASFSILQEKLERWLDDYHVNSCDQNVARCCEIIELNAKVQGQIFKLLSLCASEGGMYGGAGAIKSRLLPWLGQSFFASGGSVTADTSLSVLAEAASKDREINELQDQYERSIVDLEDNLRVTNIENDNLRTDLAEAQDELDRTKRESTSEKMFNESEIRDLRNKLALAEDENRNLREKSGLLDDYERQLRILREEIAILTGERNSVLKHRSHVPLYQHTHSSTQSIVNGDMSDTYRSLPRVSSPLSPD--DVTQRVRQQNLITRFNDMFAQDRLDAMDILRRYSDDHENNQRIVFAALVEAFASAKLAFRQFKLKVRSNLAATHVGPDTLEEAVQDYINRNTDL-YDLPSLQADVVRALNRNIKIFL-PADISYNIIGTFIREACKLAWQMSALAHPLDI-AVSSDAELFDDYKYRRSYDSEYTAPLVNHHIWACLQQGTKVIVKGEACT 456          
BLAST of MIEAP domain-containing protein vs. TrEMBL
Match: A0A267GZM3 (MIEAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011670g2 PE=4 SV=1)

HSP 1 Score: 399.823 bits (1026), Expect = 4.999e-130
Identity = 221/474 (46.62%), Postives = 313/474 (66.03%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYG-GASVIKNRLLPILGKGFFSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILAS-------------HRNPHCLHSPICHSPCDPCHSHGCLLDSCCT---LHVDHC--------DPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTD-LIGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSL--DFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E LRRLV+ GSF+ILQ +LE W  +Y+ NT D+NVA  CEI+ELNA+VQGQLFKLLSLCASEGG+YG GA+ I++RLLP+LG GFF++GLSSD+SL V+ D A+ ++ + +++R YE+SLD+LE +L   + EN  ++ ELE+ K EL+RQ   SAS+KMF + EIRDLK +L   ++EN+ L+ +    D Y+ ++ HL+++VAIL                  P     P   +P +   S G + +S  +    H  H         DP+   + Q LV + ND FS+SRL+AM +L RY DD  NNQKI++ +V+E+F+AAK AFR +KS+VR+  LI H    +LE++VQ YIN H D+  D++ + ++ IR L  ++++ L   P G+ +DV+  F+RE C +AW MSAL  P+D      EGEL+DE RYRRSYDSE+SA  +SHH+WP L +   V+ KGEA T
Sbjct:    1 MAESLRRLVDIGSFSILQEKLEKWSRDYRRNTSDENVATACEIVELNARVQGQLFKLLSLCASEGGLYGTGAAAIRSRLLPLLGHGFFASGLSSDASLSVIADAANRERELGDVRRSYEQSLDELEAELGKFKAENEDIRAELEDTKQELDRQSRASASEKMFSEAEIRDLKLKLSESEAENDRLRARVRVLDDYERQVRHLREEVAILQGRPPSLYPPPPLLPPPPPPPASRPRTPTPKEAPISDGEIAESVSSHLAYHGRHGPLSPLSPHDPVQRSRQQTLVARFNDAFSVSRLEAMETLRRYYDDQVNNQKIVYAAVLEAFSAAKLAFRAFKSKVRSQLLISHVGPDTLEEAVQDYINCHTDM-FDLHLMVQDAIRGLTRNYRLYL---PPGIGYDVLTPFLREMCHLAWGMSALAHPVDA-AVGYEGELFDEFRYRRSYDSEFSATLVSHHIWPALVQGTAVLVKGEACT 469          
BLAST of MIEAP domain-containing protein vs. TrEMBL
Match: A0A267DZK1 (MIEAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011670g3 PE=4 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 3.854e-129
Identity = 219/474 (46.20%), Postives = 312/474 (65.82%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYG-GASVIKNRLLPILGKGFFSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILAS-------------HRNPHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHC-----------DPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTD-LIGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSL--DFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E LRRLV+ GSF+ILQ +LE W  +Y+ NT D+NVA  CEI+ELNA+VQGQLFKLLSLCASEGG+YG GA+ I++RLLP+LG GFF++GLSSD+SL V+ D A+ ++ + +++R YE+SLD+LE +L   + EN  ++ ELE+ K EL+RQ   SAS+KMF + EIRDLK +L   ++EN+ L+ +    D Y+ ++ HL+++VAIL                  P     P   +P +   S G + +S  +    H            DP+   + Q LV + ND FS+SRL+AM +L RY DD  NNQKI++ +V+E+F+AAK AFR +KS+VR+  LI H    +LE++VQ YIN H D+  D++ + ++ IR L  ++++ L   P G+ +DV+  F+RE C +AW MSAL  P+D      +GEL+DE RYRRSYDSE+SA  +SHH+WP L +   V+ KGEA T
Sbjct:    1 MAESLRRLVDIGSFSILQEKLEKWSRDYRRNTSDENVATACEIVELNARVQGQLFKLLSLCASEGGLYGTGAAAIRSRLLPLLGHGFFASGLSSDASLSVIADAANRERELGDVRRSYEQSLDELEAELGKFKAENEDIRAELEDTKQELDRQSRASASEKMFSEAEIRDLKLKLSGSEAENDRLRARVRVLDDYERQVRHLREEVAILQGRPPSLYPPPPLLPPPPPPPASRPRTPTPKEAPISDGEIAESVSSHLAYHGRPGPLSPLSPHDPVQRSRQQTLVARFNDAFSVSRLEAMETLRRYYDDQVNNQKIVYAAVLEAFSAAKLAFRAFKSKVRSQLLISHVGPDTLEEAVQDYINCHTDM-FDLHLMVQDAIRGLTRNYRLYL---PPGIGYDVLTPFLREMCHLAWGMSALAHPVDA-AVGYDGELFDEFRYRRSYDSEFSATLVSHHIWPALVQGTAVLVKGEACT 469          
BLAST of MIEAP domain-containing protein vs. TrEMBL
Match: A0A267GXL8 (MIEAP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011670g1 PE=4 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 1.425e-128
Identity = 218/474 (45.99%), Postives = 312/474 (65.82%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYG-GASVIKNRLLPILGKGFFSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILAS-------------HRNPHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHC-----------DPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTD-LIGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSL--DFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E LRRLV+ GSF+ILQ +LE W  +Y+ NT D+NVA  CEI+ELNA+VQGQLFKLLSLCASEGG+YG GA+ I++RLLP+LG GFF++GLSSD+SL V+ D A+ ++ + +++R YE+SLD+LE +L   + EN  ++ ELE+ K EL+RQ   SAS+KMF + EIRDLK +L   +++N+ L+ +    D Y+ ++ HL+++VAIL                  P     P   +P +   S G + +S  +    H            DP+   + Q LV + ND FS+SRL+AM +L RY DD  NNQKI++ +V+E+F+AAK AFR +KS+VR+  LI H    +LE++VQ YIN H D+  D++ + ++ IR L  ++++ L   P G+ +DV+  F+RE C +AW MSAL  P+D      +GEL+DE RYRRSYDSE+SA  +SHH+WP L +   V+ KGEA T
Sbjct:    1 MAESLRRLVDIGSFSILQEKLEKWSRDYRRNTSDENVATACEIVELNARVQGQLFKLLSLCASEGGLYGTGAAAIRSRLLPLLGHGFFASGLSSDASLSVIADAANRERELGDVRRSYEQSLDELEAELGKFKAENEDIRAELEDTKQELDRQSRASASEKMFSEAEIRDLKLKLSGSEADNDRLRARVRVLDDYERQVRHLREEVAILQGRPPSLYPPPPLLPPPPPPPASRPRTPTPKEAPISDGEIAESVSSHLAYHGRPGPLSPLSPHDPVQRSRQQTLVARFNDAFSVSRLEAMETLRRYYDDQVNNQKIVYAAVLEAFSAAKLAFRAFKSKVRSQLLISHMGPDTLEEAVQDYINCHTDM-FDLHLMVQDAIRGLTRNYRLYL---PPGIGYDVLTPFLREMCHLAWGMSALAHPVDA-AVGYDGELFDEFRYRRSYDSEFSATLVSHHIWPALVQGTAVLVKGEACT 469          
BLAST of MIEAP domain-containing protein vs. Ensembl Cavefish
Match: spata18 (spermatogenesis associated 18 [Source:NCBI gene;Acc:103047636])

HSP 1 Score: 276.174 bits (705), Expect = 3.098e-86
Identity = 171/451 (37.92%), Postives = 265/451 (58.76%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFF--STGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRN--PHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDL-IGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M++ LRRLVNT S+++LQ +LE W  +Y   +CDQN+ R CE++EL +K+QGQLF +L+L A EGG Y GA  +K+RLLP L   F   S+ +S D+SL +++D    ++ ++E+   +E  +  +E  L  TR E +++K EL EAK++L+   ++S +  +  + EI  LK +L +   + ++ K K    + Y+ ++  L+D+V  L + +      L      SP  P  S         +            ++ +LV++ +DL++  RL+A + L RY DD E  Q+IIF + +ESF AAK A+R +K RVR  L   H    +LED+V  YI  + D+  DV +   +VI S++   P I  P  + F +I SFIRE CRIA+ M  L   +D+   +S+GELY + +YRRSYDSE++A  +++HVWP L +   VI KGEAVT
Sbjct:    1 MADTLRRLVNTSSYSVLQQKLEAWYKDYHVISCDQNLNRCCELVELTSKIQGQLFTILNLTAQEGGHYAGADTLKSRLLPWLSTCFTMASSSVSPDTSLNLIQDNVEKERKIRELSLSHESDMQKIEDQLCSTRIELSSVKQELTEAKVQLDSTKNKSVTTLLATEDEILHLKAELRAAYEQVDVYKRKLDVLEDYERQVRLLRDEVTFLTAEKTMLQERLVRSRSPSPILPRRSRTS--SPVRSESPTRAQLTNSSRHARLVSRFSDLYATERLEAQSFLRRYIDDLETVQRIIFIAAVESFQAAKLAYRQFKLRVRKTLSPTHVGPETLEDAVVDYIVRNLDL-YDVQTSVNDVINSMNVN-PRISFPPEVDFVLISSFIREMCRIAFAMQTLDPTLDLAF-SSDGELYSDMKYRRSYDSEFTAPLVAYHVWPALMEGDAVIVKGEAVT 446          
BLAST of MIEAP domain-containing protein vs. Ensembl Cavefish
Match: spata18 (spermatogenesis associated 18 [Source:NCBI gene;Acc:103047636])

HSP 1 Score: 276.174 bits (705), Expect = 3.432e-86
Identity = 171/451 (37.92%), Postives = 265/451 (58.76%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFF--STGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRN--PHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDL-IGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M++ LRRLVNT S+++LQ +LE W  +Y   +CDQN+ R CE++EL +K+QGQLF +L+L A EGG Y GA  +K+RLLP L   F   S+ +S D+SL +++D    ++ ++E+   +E  +  +E  L  TR E +++K EL EAK++L+   ++S +  +  + EI  LK +L +   + ++ K K    + Y+ ++  L+D+V  L + +      L      SP  P  S         +            ++ +LV++ +DL++  RL+A + L RY DD E  Q+IIF + +ESF AAK A+R +K RVR  L   H    +LED+V  YI  + D+  DV +   +VI S++   P I  P  + F +I SFIRE CRIA+ M  L   +D+   +S+GELY + +YRRSYDSE++A  +++HVWP L +   VI KGEAVT
Sbjct:    1 MADTLRRLVNTSSYSVLQQKLEAWYKDYHVISCDQNLNRCCELVELTSKIQGQLFTILNLTAQEGGHYAGADTLKSRLLPWLSTCFTMASSSVSPDTSLNLIQDNVEKERKIRELSLSHESDMQKIEDQLCSTRIELSSVKQELTEAKVQLDSTKNKSVTTLLATEDEILHLKAELRAAYEQVDVYKRKLDVLEDYERQVRLLRDEVTFLTAEKTMLQERLVRSRSPSPILPRRSRTS--SPVRSESPTRAQLTNSSRHARLVSRFSDLYATERLEAQSFLRRYIDDLETVQRIIFIAAVESFQAAKLAYRQFKLRVRKTLSPTHVGPETLEDAVVDYIVRNLDL-YDVQTSVNDVINSMNVN-PRISFPPEVDFVLISSFIREMCRIAFAMQTLDPTLDLAF-SSDGELYSDMKYRRSYDSEFTAPLVAYHVWPALMEGDAVIVKGEAVT 446          
BLAST of MIEAP domain-containing protein vs. Ensembl Sea Lamprey
Match: spata18 (spermatogenesis associated 18 [Source:NCBI gene;Acc:497395])

HSP 1 Score: 117.472 bits (293), Expect = 6.095e-29
Identity = 70/213 (32.86%), Postives = 127/213 (59.62%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGF-FSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHR 695
            M+E LRRL N+G++  LQ RL+ W D++  NTC++N++R CE+IE+ +KVQ QLF ++S  A+ GG   GA  IK+R LP L   F  S  +S D+SL ++ + A  ++ ++++   + + +  LE++L  T +  +  K  L+E   +LE   ++SA+  +  ++EI  L+  L++ + E  L   +  + DS + +  +L+ ++A L   +
Sbjct:    1 MAESLRRLANSGAYGALQDRLDSWQDDFHLNTCNENLSRCCELIEMTSKVQNQLFNIMSSTANRGGPTAGAETIKSRFLPWLSSSFTVSPCVSPDTSLTLIREAAEKERQLQDLSTRHMREVGSLESELQSTHQALSNAKHRLQETTYDLEDAKTKSATTLLASEEEILQLRADLQAAREEAEL--NRREREDSER-QARYLQAEMATLQQEK 210          

HSP 2 Score: 57.7658 bits (138), Expect = 3.327e-9
Identity = 36/92 (39.13%), Postives = 54/92 (58.70%), Query Frame = 3
Query: 1017 HSHSCSLEDSVQHYINTHADIDV-DVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKR 1289
            H+   S+E++V  YI    ++D+ DV S   +VIR L    P I  P  + F ++  F+RE CR+A+EM AL   +DV     EGELY+E++
Sbjct:  318 HTGPESMEEAVLDYI---VNLDLYDVQSSVADVIRELHAD-PRISFPPEVEFALLAGFVRELCRVAFEMQALEPTLDVALAV-EGELYNERK 404          
BLAST of MIEAP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010651.1 (pep scaffold:Pmarinus_7.0:GL488477:857:6764:1 gene:ENSPMAG00000009645.1 transcript:ENSPMAT00000010651.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 2.544e-10
Identity = 49/178 (27.53%), Postives = 99/178 (55.62%), Query Frame = 3
Query:  150 NTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAIL 683
            N+ ++N++  CE+IE  +KVQ QL  ++S   ++GG    A   K+RLLP+      S  +S ++SL ++ +TA  ++ ++++   + + +  LE++L  TR+  +  K  L++   ELE   + SAS  +  ++EI  L+  L++ + E  +   +  + DS +    +L+ ++A L
Sbjct:    1 NSSNENLSHCCELIERTSKVQNQLLNMMSNKTNQGGPTASA---KSRLLPLQSSVAVSPCVSPNASLTLIRETAQKERQLQDLCARHVREVGSLESELRSTRQSLSNAKQRLKDMADELEASKANSASTYLASEEEILQLRADLQAAREEAEV--NRREREDSERQ-ARYLQAEMATL 172          
BLAST of MIEAP domain-containing protein vs. Ensembl Nematostella
Match: EDO49651 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFS0])

HSP 1 Score: 159.073 bits (401), Expect = 8.220e-43
Identity = 130/454 (28.63%), Postives = 211/454 (46.48%), Query Frame = 3
Query:   72 LRRLVNTGSFNILQSRLEHWLD-NYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNL-LKTKAYKTDSYKHEIEHLKDDVAILASHRNPHCL---HSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVR-------TDLIGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            L  ++ +    +L  RL    D +Y+Y T D++    CEIIE N ++Q +LF+LL LC  EGG YGG   +KN+L+P+L  G   + +     +K++ D              YE  +  LE DL   +RE             E  +   +   D  F  +++ +L+ +L    S+ NL L+    +    + E   LK + + L +      L    S        P +++G L             P+ H +  +LV +  +L+   RL+ M +L R   D   N+++ F  V E F   K+  R  + +VR         LI  S +  + DS   Y++ + + + DV +L  E+++ L      + +       +I  FIR   R+ W M AL  P+D+     +G++ +E RYRRSY+SE+SA  + H VWP L +DG V+AKGE VT
Sbjct:    9 LSNIIASADLKVLHERLITLFDESYRYTT-DESTTVCCEIIEENLRIQAKLFRLLQLCCDEGGTYGGFQPLKNKLMPLLCNGLVMSHIGGSEDVKLVRDK-------------YEHMVSRLEDDLKSAQREVG-ELRLKLSENEEDVKCIRRQLKDSYFADRQVTELQKRL----SDANLELEASELEIRKVREETGQLKKENSDLHARLQKQMLVENESEPVRMITKP-YANGIL-------------PL-HARAPRLVERFAELYGGERLELMDAL-RPMGDRAENERLSFCIVEECFMVCKTEQRRMRKKVRHALQPPNGSLIDASQTAEIVDS---YMSRNTE-NFDVETLIPEILKCLHRNAS-VNQSIPYKEKLILPFIRACVRVVWSMVALQPPIDIAIAL-DGDIINEARYRRSYNSEFSATVVEHFVWPALMRDGKVVAKGEVVT 421          
BLAST of MIEAP domain-containing protein vs. Ensembl Medaka
Match: spata18 (spermatogenesis associated 18 [Source:NCBI gene;Acc:101174412])

HSP 1 Score: 262.307 bits (669), Expect = 7.536e-81
Identity = 170/463 (36.72%), Postives = 261/463 (56.37%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFSTG--LSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKD-------DVAILASH--RNPHCLHSPICHSPCDPCHS----HGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDL-IGHSHSCSLEDSVQHYINTHADI-DVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E LRRL  T SF +LQ +LE W  +Y+  +CDQN+ R CE+IEL AK+Q QLF +L+L A+EGG Y G   +K RLLP LG  F   G  +S+D+SL++++D+A   + ++++   +   +  +ET L+ TR +  +++ +L   + ELE   S+SA+  +  ++EI  LK  L S   +  + K +    D Y+ +I  L++       + A+L     R+P  L  P    P  P  S       L DS               +   LV++ + L+++ RL+A   L RY  D E  QKIIF +V+ESF +AK A+R +K RV+T L   H    SLED+   YI  + D+ DV  N    +VI +++   P I  P  + F +I + IRE CR+A+ M  L  P+D+    S+GEL+++ +YRRS+DS+++A  ++ HVWP L +   VI KGEAVT
Sbjct:    1 MAESLRRLTQTASFRVLQDKLESWHRDYRTISCDQNLNRCCELIELTAKLQSQLFAILNLAAAEGGHYAGVDTLKTRLLPWLGTSFSIVGPSVSADTSLQLMQDSAEKDRKIRDLSLSHGSDMQKMETQLSSTRLQLESVRAQLLHVQKELEETKSRSATTLLATEEEILQLKADLHSAYEQVEIYKRRIRAPDDYERQIRLLREELLHLNMEKAMLQDRLVRSPSPL--PRLSRPSSPLRSESPTRAQLSDSS--------------RRAGLVSRFSGLYAVERLEAQNLLRRYITDLEMVQKIIFIAVVESFRSAKLAYRQFKLRVKTTLSSSHFGPESLEDAAVDYIVRNLDLYDVQNN----DVINAMNVN-PQISFPPEVDFSLISALIRETCRLAFAMQTLDPPLDLAF-ASDGELFNDTKYRRSFDSDFTAPLVTFHVWPALMEGNGVIVKGEAVT 441          
BLAST of MIEAP domain-containing protein vs. Ensembl Medaka
Match: spata18 (spermatogenesis associated 18 [Source:NCBI gene;Acc:101174412])

HSP 1 Score: 261.922 bits (668), Expect = 1.682e-80
Identity = 170/463 (36.72%), Postives = 261/463 (56.37%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFSTG--LSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKD-------DVAILASH--RNPHCLHSPICHSPCDPCHS----HGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDL-IGHSHSCSLEDSVQHYINTHADI-DVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            M+E LRRL  T SF +LQ +LE W  +Y+  +CDQN+ R CE+IEL AK+Q QLF +L+L A+EGG Y G   +K RLLP LG  F   G  +S+D+SL++++D+A   + ++++   +   +  +ET L+ TR +  +++ +L   + ELE   S+SA+  +  ++EI  LK  L S   +  + K +    D Y+ +I  L++       + A+L     R+P  L  P    P  P  S       L DS               +   LV++ + L+++ RL+A   L RY  D E  QKIIF +V+ESF +AK A+R +K RV+T L   H    SLED+   YI  + D+ DV  N    +VI +++   P I  P  + F +I + IRE CR+A+ M  L  P+D+    S+GEL+++ +YRRS+DS+++A  ++ HVWP L +   VI KGEAVT
Sbjct:    1 MAESLRRLTQTASFRVLQDKLESWHRDYRTISCDQNLNRCCELIELTAKLQSQLFAILNLAAAEGGHYAGVDTLKTRLLPWLGTSFSIVGPSVSADTSLQLMQDSAEKDRKIRDLSLSHGSDMQKMETQLSSTRLQLESVRAQLLHVQKELEETKSRSATTLLATEEEILQLKADLHSAYEQVEIYKRRIRAPDDYERQIRLLREELLHLNMEKAMLQDRLVRSPSPL--PRLSRPSSPLRSESPTRAQLSDS--------------SRRAGLVSRFSGLYAVERLEAQNLLRRYITDLEMVQKIIFIAVVESFRSAKLAYRQFKLRVKTTLSSSHFGPESLEDAAVDYIVRNLDLYDVQNN----DVINAMNVN-PQISFPPEVDFSLISALIRETCRLAFAMQTLDPPLDLAF-ASDGELFNDTKYRRSFDSDFTAPLVTFHVWPALMEGNGVIVKGEAVT 441          
BLAST of MIEAP domain-containing protein vs. Planmine SMEST
Match: SMESG000019081.1 (SMESG000019081.1)

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 445/446 (99.78%), Postives = 445/446 (99.78%), Query Frame = 3
Query:   60 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFSTGLSSDSSLKVLEDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTXXXXXXXXXXXXXRQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNPHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFSTGLSSDSSLKVLED ASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTLKLELEEAKLELERQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNPHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT
Sbjct:    1 MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFSTGLSSDSSLKVLEDAASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTLKLELEEAKLELERQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEHLKDDVAILASHRNPHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPICHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRTDLIGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 446          
BLAST of MIEAP domain-containing protein vs. Planmine SMEST
Match: SMESG000057251.1 (SMESG000057251.1)

HSP 1 Score: 117.472 bits (293), Expect = 3.556e-28
Identity = 71/193 (36.79%), Postives = 106/193 (54.92%), Query Frame = 3
Query:  825 QQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFNAAKSAFRLYKSRVRT--DLIGHSHSCSLEDSVQHYINTHADIDVDVNSLSREVIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPTSEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVT 1397
            Q LV + NDLFS SR+ AM  L  Y+DDHENNQ+I+F  VM S        R +++R+R   +LI H    ++  SV   I T    D+  N  S        F++P       LSF  +   I    ++ W        +++ +  ++GE++DE +YRRSYDS+++A  +SHH+WPCL ++  V+ KGEA T
Sbjct:  213 QGLVGRYNDLFSESRITAMDHLRLYNDDHENNQRILFALVMISAKCVSEFQRCHRNRIRNKNELI-HQFRETISRSVLKNIRTQIIYDLINNRGS-----YYRFQIP-----QNLSFVELEGLINNTIQLFWNFGGAQYNLELLN-AADGEMFDEHKYRRSYDSDFTAPLVSHHIWPCLIQNHRVLVKGEACT 393          

HSP 2 Score: 99.3673 bits (246), Expect = 4.104e-22
Identity = 45/106 (42.45%), Postives = 66/106 (62.26%), Query Frame = 3
Query:   66 EPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKVQGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFSTGLSSDSSLKVLEDTASNKK 383
            E L    NT  F ILQ +L +W   +K+N  + N+++ CE+IELNA++Q QLFKLL  C   GG+ G    +KN+L+P LGK +F  GL+S+  + +L D   + K
Sbjct:    2 ESLNSFANTNCFYILQEKLNNWKHEFKHNCTEANISKCCELIELNARIQTQLFKLLGFCGIYGGLEGSEIKLKNQLIPYLGKDYFDNGLTSNVVMNILNDVKKHTK 107          
The following BLAST results are available for this feature:
BLAST of MIEAP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SPATA184.327e-6233.06spermatogenesis associated 18 [Source:HGNC Symbol;... [more]
SPATA189.388e-6233.06spermatogenesis associated 18 [Source:HGNC Symbol;... [more]
SPATA183.545e-6133.40spermatogenesis associated 18 [Source:HGNC Symbol;... [more]
SPATA184.906e-2047.57spermatogenesis associated 18 [Source:HGNC Symbol;... [more]
back to top
BLAST of MIEAP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MIEAP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MIEAP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spata181.395e-8636.97spermatogenesis associated 18 [Source:NCBI gene;Ac... [more]
back to top
BLAST of MIEAP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000051448.11.044e-7937.33spermatogenesis associated 18 [Source:NCBI gene;Ac... [more]
itga81.988e-7536.53integrin subunit alpha 8 [Source:Xenbase;Acc:XB-GE... [more]
ENSXETT00000051452.11.578e-7436.06spermatogenesis associated 18 [Source:NCBI gene;Ac... [more]
itga82.695e-7435.36integrin subunit alpha 8 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of MIEAP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Spata181.594e-5530.24spermatogenesis associated 18 [Source:MGI Symbol;A... [more]
Spata186.663e-5430.43spermatogenesis associated 18 [Source:MGI Symbol;A... [more]
Spata183.226e-3437.76spermatogenesis associated 18 [Source:MGI Symbol;A... [more]
Spata183.870e-3238.74spermatogenesis associated 18 [Source:MGI Symbol;A... [more]
back to top
BLAST of MIEAP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q503Q1|MIEAP_DANRE1.053e-8536.97Mitochondria-eating protein OS=Danio rerio OX=7955... [more]
sp|E1BW58|MIEAP_CHICK1.709e-7436.18Mitochondria-eating protein OS=Gallus gallus OX=90... [more]
sp|Q498J5|MIEAP_XENLA9.426e-7236.97Mitochondria-eating protein OS=Xenopus laevis OX=8... [more]
sp|E1BLK7|MIEAP_BOVIN4.553e-6432.59Mitochondria-eating protein OS=Bos taurus OX=9913 ... [more]
sp|Q8TC71|MIEAP_HUMAN4.509e-6133.06Mitochondria-eating protein OS=Homo sapiens OX=960... [more]
back to top
BLAST of MIEAP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K2R83.156e-13247.72mitochondria-eating protein isoform X1 OS=Lingula ... [more]
A0A1S3K3396.450e-13247.72mitochondria-eating protein isoform X2 OS=Lingula ... [more]
A0A267GZM34.999e-13046.62MIEAP domain-containing protein OS=Macrostomum lig... [more]
A0A267DZK13.854e-12946.20MIEAP domain-containing protein OS=Macrostomum lig... [more]
A0A267GXL81.425e-12845.99MIEAP domain-containing protein OS=Macrostomum lig... [more]
back to top
BLAST of MIEAP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spata183.098e-8637.92spermatogenesis associated 18 [Source:NCBI gene;Ac... [more]
spata183.432e-8637.92spermatogenesis associated 18 [Source:NCBI gene;Ac... [more]
back to top
BLAST of MIEAP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spata186.095e-2932.86spermatogenesis associated 18 [Source:NCBI gene;Ac... [more]
ENSPMAT00000010651.12.544e-1027.53pep scaffold:Pmarinus_7.0:GL488477:857:6764:1 gene... [more]
back to top
BLAST of MIEAP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MIEAP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO496518.220e-4328.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MIEAP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spata187.536e-8136.72spermatogenesis associated 18 [Source:NCBI gene;Ac... [more]
spata181.682e-8036.72spermatogenesis associated 18 [Source:NCBI gene;Ac... [more]
back to top
BLAST of MIEAP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000019081.10.000e+099.78SMESG000019081.1[more]
SMESG000057251.13.556e-2836.79SMESG000057251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013149 ID=SMED30013149|Name=MIEAP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1668bp
AATTACCTTAGTAATTAAACCAAGTTCATTTCAAATTATTTAACAACAAC
TGTTTAGATATGAGTGAACCTCTTAGAAGACTGGTAAATACTGGCTCATT
TAATATTCTTCAAAGTAGACTAGAGCATTGGTTAGATAATTATAAGTATA
ATACATGTGATCAGAATGTTGCCCGCGGCTGTGAAATAATTGAATTAAAT
GCAAAGGTTCAAGGACAACTCTTTAAACTGTTGAGTCTATGTGCTTCTGA
AGGTGGAGTTTATGGAGGGGCAAGCGTGATTAAAAATCGGTTGCTTCCAA
TTTTGGGCAAAGGATTTTTCTCTACTGGATTGAGTTCTGACAGCAGTTTA
AAGGTATTGGAAGACACAGCATCAAATAAAAAAAATGTTAAGGAAATTAA
AAGAATTTACGAGAAATCTCTCGATGATTTAGAAACTGATTTAAATTTAA
CAAGACGAGAAAATAACACATTAAAACTCGAATTGGAAGAGGCAAAGCTG
GAATTGGAGCGTCAAGGCAGCCAATCAGCAAGCGATAAAATGTTTGATAA
GCAAGAAATTAGAGATTTAAAAACTCAATTGGAAAGCATTAAATCAGAAA
ACAATCTATTGAAAACAAAAGCTTACAAGACAGACTCATACAAGCATGAA
ATTGAACACTTAAAAGATGACGTTGCAATCCTTGCATCCCATAGAAATCC
CCATTGTTTGCATTCACCAATATGCCATTCTCCATGTGATCCCTGCCATT
CTCATGGTTGTTTGTTAGATTCGTGTTGCACTCTTCACGTAGATCATTGT
GATCCGATTTGCCATGGAAAGTACCAACAACTAGTCACAAAAATTAATGA
TCTATTTTCAATTTCCCGACTTGATGCCATGACTTCTCTCAGCCGATATA
GTGATGACCATGAAAATAACCAGAAAATTATATTCCATTCTGTCATGGAA
TCATTCAATGCCGCAAAATCTGCTTTCAGATTATACAAATCTCGAGTGAG
AACTGACCTAATTGGTCATTCACATAGTTGCAGTTTGGAAGACTCGGTGC
AACATTATATTAATACTCATGCTGACATTGATGTCGATGTGAACAGCTTG
AGTCGGGAAGTTATAAGATCTTTAGATTTCAAAGTTCCTTTAATTAAAAG
ACCAGCTGGATTAAGTTTTGATGTTATTGGTTCATTTATTAGAGAAGCAT
GCCGAATTGCATGGGAAATGTCCGCTTTACCTATACCTATGGACGTTCAC
CACCCTACCTCCGAAGGTGAATTGTATGATGAAAAAAGATATCGAAGAAG
TTATGATTCTGAATACAGTGCTGCTTTTATTTCACATCATGTTTGGCCTT
GTCTCGAAAAGGATGGAATCGTAATTGCTAAAGGCGAGGCTGTTACAAAA
CGATCTGGATCTCTAACAAAGTCACTGAGATCTAGTCGGAGTCCAACAAG
ATCACCGACGAGAATTAGTGGAAGATCTCCTTCTCCAATTTTCCAAAAAA
GTAGATCTCCAACGAGTTTTCGATCAACAAGTCCAACTGCCAGAAGGTCA
AAACTGTTTTGAAATGGGTTTTCCTAATAGACTTTGCTAACTTTTCAAAA
CAATTTTAGACTTTAATGTTCAGCATATGAAATAATTATTATTTGCGAAT
CCAATCCATATTATTAGC
back to top

protein sequence of SMED30013149-orf-1

>SMED30013149-orf-1 ID=SMED30013149-orf-1|Name=SMED30013149-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=501bp
MSEPLRRLVNTGSFNILQSRLEHWLDNYKYNTCDQNVARGCEIIELNAKV
QGQLFKLLSLCASEGGVYGGASVIKNRLLPILGKGFFSTGLSSDSSLKVL
EDTASNKKNVKEIKRIYEKSLDDLETDLNLTRRENNTLKLELEEAKLELE
RQGSQSASDKMFDKQEIRDLKTQLESIKSENNLLKTKAYKTDSYKHEIEH
LKDDVAILASHRNPHCLHSPICHSPCDPCHSHGCLLDSCCTLHVDHCDPI
CHGKYQQLVTKINDLFSISRLDAMTSLSRYSDDHENNQKIIFHSVMESFN
AAKSAFRLYKSRVRTDLIGHSHSCSLEDSVQHYINTHADIDVDVNSLSRE
VIRSLDFKVPLIKRPAGLSFDVIGSFIREACRIAWEMSALPIPMDVHHPT
SEGELYDEKRYRRSYDSEYSAAFISHHVWPCLEKDGIVIAKGEAVTKRSG
SLTKSLRSSRSPTRSPTRISGRSPSPIFQKSRSPTSFRSTSPTARRSKLF
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0035694mitochondrial protein catabolic process
GO:0033554cellular response to stress
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR026169MIEAP
IPR031981MIEAP_C
Vocabulary: cellular component
TermDefinition
GO:0005741mitochondrial outer membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 107..155
NoneNo IPR availableCOILSCoilCoilcoord: 160..187
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 450..500
NoneNo IPR availablePANTHERPTHR21771:SF0MITOCHONDRIA-EATING PROTEINcoord: 1..490
IPR031981Mitochondria-eating protein, C-terminal domainPFAMPF16026MIEAPcoord: 256..444
e-value: 2.8E-37
score: 128.9
IPR026169Mitochondria-eating proteinPANTHERPTHR21771FAMILY NOT NAMEDcoord: 1..490