Septin-2

Overview
NameSeptin-2
Smed IDSMED30013132
Length (bp)2406
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Septin-2 (SMED30013132) t-SNE clustered cells

Violin plots show distribution of expression levels for Septin-2 (SMED30013132) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Septin-2 (SMED30013132) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Septin-2 (SMED30013132) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Septin-2 vs. Ensembl Human
Match: SEPTIN10 (septin 10 [Source:HGNC Symbol;Acc:HGNC:14349])

HSP 1 Score: 451.055 bits (1159), Expect = 2.727e-151
Identity = 237/404 (58.66%), Postives = 322/404 (79.70%), Query Frame = 1
Query:   97 TTEVVKGLANE-IRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSD----NENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE 1293
            ++EV + L  E IR+L ++GHVGF++LP QLVN+++ QGF FNILC+GETG+GKSTL++TLF  NF+   S+H  P V LK   ++L+E NV+LKL+I+ + GFGDQINKE+   P++ YID +FE YLQEE+KIKR+L+ YHD+R+HVCLYFI+PTGH++K+LDL+ MK L+SKV+IIPVIAK+DT++K+E+QKFK K+M+E+ SN + IYQFPT DDT+ ++N  MN  LPFAVVGS DE K+ N K+ + RQYPWG VQ++N+NHCDF++LREML+ TNM+DLRE+TH  HYE YR+ +L EMGF+D    N+ +S+QETY+ +R     E ++KEEE++QMF  RVKEKE  LKE+++EL AKFE LK+ + EE+ KLEE+RR+LEE+I  F K+KA  E
Sbjct:    3 SSEVARHLKRENIRSLTMSGHVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGN-KMVKARQYPWGVVQVENENHCDFVKLREMLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEAKRHEFHGERQRKEEEMKQMFVQRVKEKEAILKEAERELQAKFEHLKRLHQEERMKLEEKRRLLEEEIIAFSKKKATSE 405          
BLAST of Septin-2 vs. Ensembl Human
Match: SEPTIN10 (septin 10 [Source:HGNC Symbol;Acc:HGNC:14349])

HSP 1 Score: 448.743 bits (1153), Expect = 4.130e-150
Identity = 233/392 (59.44%), Postives = 315/392 (80.36%), Query Frame = 1
Query:  130 IRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSD----NENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE 1293
            IR+L ++GHVGF++LP QLVN+++ QGF FNILC+GETG+GKSTL++TLF  NF+   S+H  P V LK   ++L+E NV+LKL+I+ + GFGDQINKE+   P++ YID +FE YLQEE+KIKR+L+ YHD+R+HVCLYFI+PTGH++K+LDL+ MK L+SKV+IIPVIAK+DT++K+E+QKFK K+M+E+ SN + IYQFPT DDT+ ++N  MN  LPFAVVGS DE K+ N K+ + RQYPWG VQ++N+NHCDF++LREML+ TNM+DLRE+TH  HYE YR+ +L EMGF+D    N+ +S+QETY+ +R     E ++KEEE++QMF  RVKEKE  LKE+++EL AKFE LK+ + EE+ KLEE+RR+LEE+I  F K+KA  E
Sbjct:   38 IRSLTMSGHVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGN-KMVKARQYPWGVVQVENENHCDFVKLREMLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEAKRHEFHGERQRKEEEMKQMFVQRVKEKEAILKEAERELQAKFEHLKRLHQEERMKLEEKRRLLEEEIIAFSKKKATSE 428          
BLAST of Septin-2 vs. Ensembl Human
Match: SEPTIN10 (septin 10 [Source:HGNC Symbol;Acc:HGNC:14349])

HSP 1 Score: 448.358 bits (1152), Expect = 5.211e-150
Identity = 233/392 (59.44%), Postives = 315/392 (80.36%), Query Frame = 1
Query:  130 IRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSD----NENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE 1293
            IR+L ++GHVGF++LP QLVN+++ QGF FNILC+GETG+GKSTL++TLF  NF+   S+H  P V LK   ++L+E NV+LKL+I+ + GFGDQINKE+   P++ YID +FE YLQEE+KIKR+L+ YHD+R+HVCLYFI+PTGH++K+LDL+ MK L+SKV+IIPVIAK+DT++K+E+QKFK K+M+E+ SN + IYQFPT DDT+ ++N  MN  LPFAVVGS DE K+ N K+ + RQYPWG VQ++N+NHCDF++LREML+ TNM+DLRE+TH  HYE YR+ +L EMGF+D    N+ +S+QETY+ +R     E ++KEEE++QMF  RVKEKE  LKE+++EL AKFE LK+ + EE+ KLEE+RR+LEE+I  F K+KA  E
Sbjct:   38 IRSLTMSGHVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGN-KMVKARQYPWGVVQVENENHCDFVKLREMLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEAKRHEFHGERQRKEEEMKQMFVQRVKEKEAILKEAERELQAKFEHLKRLHQEERMKLEEKRRLLEEEIIAFSKKKATSE 428          
BLAST of Septin-2 vs. Ensembl Human
Match: SEPTIN10 (septin 10 [Source:HGNC Symbol;Acc:HGNC:14349])

HSP 1 Score: 447.203 bits (1149), Expect = 3.487e-149
Identity = 233/392 (59.44%), Postives = 315/392 (80.36%), Query Frame = 1
Query:  130 IRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSD----NENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE 1293
            IR+L ++GHVGF++LP QLVN+++ QGF FNILC+GETG+GKSTL++TLF  NF+   S+H  P V LK   ++L+E NV+LKL+I+ + GFGDQINKE+   P++ YID +FE YLQEE+KIKR+L+ YHD+R+HVCLYFI+PTGH++K+LDL+ MK L+SKV+IIPVIAK+DT++K+E+QKFK K+M+E+ SN + IYQFPT DDT+ ++N  MN  LPFAVVGS DE K+ N K+ + RQYPWG VQ++N+NHCDF++LREML+ TNM+DLRE+TH  HYE YR+ +L EMGF+D    N+ +S+QETY+ +R     E ++KEEE++QMF  RVKEKE  LKE+++EL AKFE LK+ + EE+ KLEE+RR+LEE+I  F K+KA  E
Sbjct:   23 IRSLTMSGHVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGN-KMVKARQYPWGVVQVENENHCDFVKLREMLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEAKRHEFHGERQRKEEEMKQMFVQRVKEKEAILKEAERELQAKFEHLKRLHQEERMKLEEKRRLLEEEIIAFSKKKATSE 413          
BLAST of Septin-2 vs. Ensembl Human
Match: SEPTIN10 (septin 10 [Source:HGNC Symbol;Acc:HGNC:14349])

HSP 1 Score: 447.973 bits (1151), Expect = 1.594e-148
Identity = 233/392 (59.44%), Postives = 315/392 (80.36%), Query Frame = 1
Query:  130 IRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSD----NENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE 1293
            IR+L ++GHVGF++LP QLVN+++ QGF FNILC+GETG+GKSTL++TLF  NF+   S+H  P V LK   ++L+E NV+LKL+I+ + GFGDQINKE+   P++ YID +FE YLQEE+KIKR+L+ YHD+R+HVCLYFI+PTGH++K+LDL+ MK L+SKV+IIPVIAK+DT++K+E+QKFK K+M+E+ SN + IYQFPT DDT+ ++N  MN  LPFAVVGS DE K+ N K+ + RQYPWG VQ++N+NHCDF++LREML+ TNM+DLRE+TH  HYE YR+ +L EMGF+D    N+ +S+QETY+ +R     E ++KEEE++QMF  RVKEKE  LKE+++EL AKFE LK+ + EE+ KLEE+RR+LEE+I  F K+KA  E
Sbjct:   38 IRSLTMSGHVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGN-KMVKARQYPWGVVQVENENHCDFVKLREMLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEAKRHEFHGERQRKEEEMKQMFVQRVKEKEAILKEAERELQAKFEHLKRLHQEERMKLEEKRRLLEEEIIAFSKKKATSE 428          
BLAST of Septin-2 vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731095:14733877:-1 gene:WBGene00006795.1 transcript:Y50E8A.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 369.392 bits (947), Expect = 1.349e-119
Identity = 160/308 (51.95%), Postives = 232/308 (75.32%), Query Frame = 1
Query:  109 VKGLANEI-RTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNE 1029
            +K L++   R +++NGHVGFD+LP+QLV KAV  GF FN++C+GETG GK+TL+E+LF    DF P  H+L  V L+    D+ EG +++KL ++E+ GFGDQ++K+     ++ Y++ +FE YLQEE+K +R L  ++D+R+H CLYFI+PTGH +K+LDLV +++L  +V++IPVIAKSDT  K E+ +FKAKI++E++S KI+IY FPT D+TV   N +MN+ +PFAVVGS D  K  NG++ R RQYPWG V+++N++HCDF++LRE LLRTN+D++R+RTH   YE YR+ RL +M   D E
Sbjct:   63 IKSLSDHTGRVMQLNGHVGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDETVSTTNKEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRLRQMKIGDGE 370          
BLAST of Septin-2 vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731095:14733877:-1 gene:WBGene00006795.1 transcript:Y50E8A.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 369.007 bits (946), Expect = 1.380e-119
Identity = 160/308 (51.95%), Postives = 232/308 (75.32%), Query Frame = 1
Query:  109 VKGLANEI-RTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNE 1029
            +K L++   R +++NGHVGFD+LP+QLV KAV  GF FN++C+GETG GK+TL+E+LF    DF P  H+L  V L+    D+ EG +++KL ++E+ GFGDQ++K+     ++ Y++ +FE YLQEE+K +R L  ++D+R+H CLYFI+PTGH +K+LDLV +++L  +V++IPVIAKSDT  K E+ +FKAKI++E++S KI+IY FPT D+TV   N +MN+ +PFAVVGS D  K  NG++ R RQYPWG V+++N++HCDF++LRE LLRTN+D++R+RTH   YE YR+ RL +M   D E
Sbjct:   63 IKSLSDHTGRVMQLNGHVGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDETVSTTNKEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRLRQMKIGDGE 370          
BLAST of Septin-2 vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731136:14734237:-1 gene:WBGene00006795.1 transcript:Y50E8A.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 369.777 bits (948), Expect = 6.169e-119
Identity = 160/308 (51.95%), Postives = 232/308 (75.32%), Query Frame = 1
Query:  109 VKGLANEI-RTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNE 1029
            +K L++   R +++NGHVGFD+LP+QLV KAV  GF FN++C+GETG GK+TL+E+LF    DF P  H+L  V L+    D+ EG +++KL ++E+ GFGDQ++K+     ++ Y++ +FE YLQEE+K +R L  ++D+R+H CLYFI+PTGH +K+LDLV +++L  +V++IPVIAKSDT  K E+ +FKAKI++E++S KI+IY FPT D+TV   N +MN+ +PFAVVGS D  K  NG++ R RQYPWG V+++N++HCDF++LRE LLRTN+D++R+RTH   YE YR+ RL +M   D E
Sbjct:  132 IKSLSDHTGRVMQLNGHVGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDETVSTTNKEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRLRQMKIGDGE 439          
BLAST of Septin-2 vs. Ensembl Celegans
Match: unc-59 (pep chromosome:WBcel235:I:13629227:13633494:1 gene:WBGene00006793.1 transcript:W09C5.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-59)

HSP 1 Score: 219.164 bits (557), Expect = 4.764e-63
Identity = 111/287 (38.68%), Postives = 179/287 (62.37%), Query Frame = 1
Query:  154 HVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLF-----EQNFDFTPSTHDLPE-VSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDD--TVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYR 990
            + GF   P Q+  +AV  GF F ++ +G +GLGKST + TLF       N   +  TH  P  V ++     L E +V L L+++++ GFGD +N   C  P+++Y++ +F +   EE +I R      D  VH+CLYFI P+GH +K +D+  MK L  +V+I+PVI+K+D +T+ E+ +FK +I+ + ++ +I +Y+FP  +D  T +    ++ + LPFA++GSN   K  +GK  R R+YPWGTV+++N  H DF+ LR+M++RTN+ D+ + T  VHYE +R
Sbjct:   27 YWGFANFPNQVFRRAVKNGFDFTLMVVGRSGLGKSTFINTLFLAEINNLNEKESAPTHPHPSTVRVEEKLVKLVENSVSLNLTLVDTPGFGDAVNNSKCWEPIVNYVESKFFEQFCEETRIDRG-EKIVDKCVHLCLYFIEPSGHGLKPIDIELMKHLHGRVNIVPVISKADCLTRDELLRFKKQIVKDAETAEIKLYKFPELEDPYTDKVAIEKLRKALPFAIIGSN-MLKEKDGKKIRYREYPWGTVEVENMQHNDFLTLRDMIIRTNLIDMIDVTRNVHYENFR 311          
BLAST of Septin-2 vs. Ensembl Fly
Match: Sep2 (gene:FBgn0014029 transcript:FBtr0083945)

HSP 1 Score: 464.922 bits (1195), Expect = 2.827e-157
Identity = 244/404 (60.40%), Postives = 317/404 (78.47%), Query Frame = 1
Query:  130 IRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGNTIKKKK 1329
            +RTLK +GHVGFD+LP QLVNK+V  GF FN++C+GETGLGKSTLM+TLF  +F+ TPS H LP V LK   ++L+E NV+LKL+I ++ G+GDQINK+D    V+ YID +FE YLQEE+KIKR+L   HD+R+H+CLYFI PTGH +KSLDLV MKKL+SKV+IIPVIAK+DTI+K E+Q+FKAKI+ E+ +N ++IYQFPT D+TV E NT MN  +PFAVVGS +  K+ N K+ R RQYPWGTVQ++N+ HCDF++LREML+RTNM+D+RE+TH  HYE YR+ RL +MGF    SDN+ +S Q+T++ +R     EL+ KEEE+RQMF  RVKEKE +LKES+K+L AKFE LK+ +AEEKRKLEE R+ LEED  +F++RK  +  A    T+ K K
Sbjct:   15 LRTLKQSGHVGFDSLPDQLVNKSVQNGFVFNVMCIGETGLGKSTLMDTLFNTSFESTPSPHTLPSVKLKAHTYELQESNVRLKLTICDTVGYGDQINKDDSFKAVVDYIDAQFENYLQEELKIKRSLVTCHDSRIHICLYFICPTGHGLKSLDLVCMKKLDSKVNIIPVIAKADTISKVELQRFKAKIIQELNANGVHIYQFPTDDETVAETNTSMNSHIPFAVVGSTEFIKVGN-KLIRARQYPWGTVQVENETHCDFVKLREMLIRTNMEDMREKTHTRHYELYRQKRLEQMGFSDVDSDNKPISFQQTFEAKRSNHLAELQSKEEEVRQMFVQRVKEKEAELKESEKDLHAKFEKLKRDHAEEKRKLEESRKALEEDYLDFQRRKQQLATAHHTLTLGKSK 417          
BLAST of Septin-2 vs. Ensembl Fly
Match: Sep5 (gene:FBgn0026361 transcript:FBtr0088877)

HSP 1 Score: 428.713 bits (1101), Expect = 3.692e-143
Identity = 219/387 (56.59%), Postives = 296/387 (76.49%), Query Frame = 1
Query:  133 RTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRK 1281
            R L++ GHVGFDTLP QLVNK+V  GFSFNILC+GET LGKSTLM+TLF  +F  TPS H+LP V LK + ++L+E NV+LKL++ ++ G+GDQ+NK D    ++ Y+D +FE YLQEE+KI+R + + HD RVH CLYFI PTGH +K++DLV MK+L+++V+IIPVIAK+DTI+KSE+  FK +IM+E++ N ++IYQFP  D+TV E N  MN  LPFAVVGS +  K+  GK  R RQYPWG V I+N+ HCDF++LREML+RTNM+DLRE+TH  HYE +R+ RL +MGF    S+N+ +S Q+T++ +R      L+ KEEE+RQMF  RVK+KEN+LK+++KEL  KF+ LK+ + EEK +LEE RR LEED    ++R+
Sbjct:   19 RLLQLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSFGSTPSPHNLPNVKLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQRAMASAHDGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIMDELRRNNVSIYQFPMDDETVSETNAAMNGHLPFAVVGSTEFVKVA-GKQVRARQYPWGAVHIENEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMGFVDVDSNNQPVSFQQTFESKRSDHLACLQAKEEEVRQMFVQRVKQKENELKDNEKELHTKFDRLKREHLEEKAQLEEARRQLEEDCQELQRRR 404          
BLAST of Septin-2 vs. Ensembl Fly
Match: Sep5 (gene:FBgn0026361 transcript:FBtr0088876)

HSP 1 Score: 428.713 bits (1101), Expect = 3.692e-143
Identity = 219/387 (56.59%), Postives = 296/387 (76.49%), Query Frame = 1
Query:  133 RTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRK 1281
            R L++ GHVGFDTLP QLVNK+V  GFSFNILC+GET LGKSTLM+TLF  +F  TPS H+LP V LK + ++L+E NV+LKL++ ++ G+GDQ+NK D    ++ Y+D +FE YLQEE+KI+R + + HD RVH CLYFI PTGH +K++DLV MK+L+++V+IIPVIAK+DTI+KSE+  FK +IM+E++ N ++IYQFP  D+TV E N  MN  LPFAVVGS +  K+  GK  R RQYPWG V I+N+ HCDF++LREML+RTNM+DLRE+TH  HYE +R+ RL +MGF    S+N+ +S Q+T++ +R      L+ KEEE+RQMF  RVK+KEN+LK+++KEL  KF+ LK+ + EEK +LEE RR LEED    ++R+
Sbjct:   19 RLLQLGGHVGFDTLPDQLVNKSVQNGFSFNILCIGETALGKSTLMDTLFNTSFGSTPSPHNLPNVKLKANTYELQESNVRLKLTVCDTIGYGDQVNKADSYKALVEYVDSQFEAYLQEELKIQRAMASAHDGRVHACLYFICPTGHGLKAMDLVCMKQLDTRVNIIPVIAKADTISKSELSGFKERIMDELRRNNVSIYQFPMDDETVSETNAAMNGHLPFAVVGSTEFVKVA-GKQVRARQYPWGAVHIENEAHCDFVKLREMLIRTNMEDLREQTHTRHYELFRQRRLQQMGFVDVDSNNQPVSFQQTFESKRSDHLACLQAKEEEVRQMFVQRVKQKENELKDNEKELHTKFDRLKREHLEEKAQLEEARRQLEEDCQELQRRR 404          
BLAST of Septin-2 vs. Ensembl Fly
Match: Sep2 (gene:FBgn0014029 transcript:FBtr0334579)

HSP 1 Score: 391.349 bits (1004), Expect = 1.343e-129
Identity = 211/359 (58.77%), Postives = 277/359 (77.16%), Query Frame = 1
Query:  265 METLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGNTIKKKK 1329
            M+TLF  +F+ TPS H LP V LK   ++L+E NV+LKL+I ++ G+GDQINK+D    V+ YID +FE YLQEE+KIKR+L   HD+R+H+CLYFI PTGH +KSLDLV MKKL+SKV+IIPVIAK+DTI+K E+Q+FKAKI+ E+ +N ++IYQFPT D+TV E NT MN  +PFAVVGS +  K+ N K+ R RQYPWGTVQ++N+ HCDF++LREML+RTNM+D+RE+TH  HYE YR+ RL +MGF    SDN+ +S Q+T++ +R     EL+ KEEE+RQMF  RVKEKE +LKES+K+L AKFE LK+ +AEEKRKLEE R+ LEED  +F++RK  +  A    T+ K K
Sbjct:    1 MDTLFNTSFESTPSPHTLPSVKLKAHTYELQESNVRLKLTICDTVGYGDQINKDDSFKAVVDYIDAQFENYLQEELKIKRSLVTCHDSRIHICLYFICPTGHGLKSLDLVCMKKLDSKVNIIPVIAKADTISKVELQRFKAKIIQELNANGVHIYQFPTDDETVAETNTSMNSHIPFAVVGSTEFIKVGN-KLIRARQYPWGTVQVENETHCDFVKLREMLIRTNMEDMREKTHTRHYELYRQKRLEQMGFSDVDSDNKPISFQQTFEAKRSNHLAELQSKEEEVRQMFVQRVKEKEAELKESEKDLHAKFEKLKRDHAEEKRKLEESRKALEEDYLDFQRRKQQLATAHHTLTLGKSK 358          
BLAST of Septin-2 vs. Ensembl Fly
Match: pnut (gene:FBgn0013726 transcript:FBtr0088792)

HSP 1 Score: 278.485 bits (711), Expect = 5.713e-84
Identity = 148/369 (40.11%), Postives = 233/369 (63.14%), Query Frame = 1
Query:  133 RTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFT-----PSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTT-DDTVRELNTQMN--QLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNE----NMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKS 1203
            + ++I G+VGF  LP Q+  KAV +GF F ++ +G +GLGKSTL+ ++F  +         PS      V+++ +   LKE  V L L+++++ GFGD ++  +C  P++ Y+D ++E+YL  E ++ R   +  D+RVH CLYFIAP+GH +  LD+  M+ L  KV+++PVIAK+DT+T  E+  FK +I+NEI  +KI IY FP T +D   E  T  N    +PFAVVG+N   +  +GK  R R+YPWG V+++N  HCDFI LR M++RT++ DL++ T+ VHYE YR  +L E+G  D +    N +     ++ +    +++K+ E E+ Q+F M+VKEK  +L++S+ EL  + E  KK+
Sbjct:  115 KPMEIAGYVGFANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTIS--DSRVHCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFPATLEDAAEEAKTTQNLRSRVPFAVVGANTIIEQ-DGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKLSELGLVDGKARLSNKNPLTQMEEEKREHEQKMKKMEAEMEQVFDMKVKEKMQKLRDSELELARRHEERKKA 480          
BLAST of Septin-2 vs. Ensembl Zebrafish
Match: sept8b (septin 8b [Source:NCBI gene;Acc:571702])

HSP 1 Score: 449.129 bits (1154), Expect = 6.301e-151
Identity = 237/416 (56.97%), Postives = 320/416 (76.92%), Query Frame = 1
Query:   97 TTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE--QAKQGNTIKKK 1326
             TEV      E+R+L ++GHVGFD+LP QLV+K+V+QGFSFNILC+GETG+GKSTLM TLF   F+   ++H    V L+   + L+E NV L+L+I+++ GFGDQ+NKE+   P++ YID +FE +L+EE+KIKR+LYNYHD+R+H+CLYFIAP+GH++KSLDLV MKKL+SKV+IIP+IAK+DT++KSE+QKFK KIM+E+ SN + IYQFPT D+ V E+N+ MN  LPFAV+GS++E K+ N K+ R RQYPWG VQ++N++HCDF++LREML+R NM DLRE+TH  HYE YR+ +L EMGF    +D+E  SLQETY  +R     EL+ KEE++RQMF  +VKE E +LKE ++EL  +FE LK+++ EEKR LEE RR  EE++  F +RK   E  Q+ QG+T  KK
Sbjct:    3 ATEVNTYPTEEMRSLSLSGHVGFDSLPDQLVSKSVSQGFSFNILCVGETGIGKSTLMNTLFNTTFENEEASHFHNGVHLRPRTYSLQESNVDLQLTIVDTVGFGDQVNKEESYKPIVDYIDAQFENFLEEELKIKRSLYNYHDSRIHICLYFIAPSGHSLKSLDLVTMKKLDSKVNIIPIIAKADTVSKSELQKFKIKIMSELVSNGVQIYQFPTDDEAVAEINSSMNAHLPFAVIGSSEEVKIGN-KMVRARQYPWGVVQVENESHCDFVKLREMLIRVNMLDLREQTHARHYELYRRCKLEEMGFKDTDADSEPFSLQETYVAKRREFIGELQMKEEQMRQMFVNKVKETEAELKEKERELHERFEMLKRTHQEEKRSLEEMRRDFEEEMNTFNRRKVAAETLQSLQGSTGLKK 417          
BLAST of Septin-2 vs. Ensembl Zebrafish
Match: sept10 (septin 10 [Source:ZFIN;Acc:ZDB-GENE-050417-3])

HSP 1 Score: 446.817 bits (1148), Expect = 6.837e-150
Identity = 236/412 (57.28%), Postives = 321/412 (77.91%), Query Frame = 1
Query:   97 TTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNE----NMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE--QAKQGNT 1314
            +++V++      R L ++GHVGFD+LP QLVNK+ +QGF FNILC+GETG+GKSTLM+TLF  NF+   S+H  P+V L+   +DL+E NV+LKL+++ + GFGDQ+NK++    ++ YID +FE YLQEE+KIKR+L+NYHD+R+H CLYFIAP+GH++KSLDLV MKKL+SKV+IIPVIAK+DTI+KSE+ KFK KIM+E+ SN + IYQFP  D+TV ++NT MN  LPFAVVGS +E  + N K+ + RQYPWG VQ++N+NHCDF++LREML+  NM+DLRE+TH  HYE YR+ +L EMGF D +     +SLQ+TY+ +R+    EL+++EEE+RQ F  RVKEKE +LK++++EL  KFE LK+ +A+EK KLEE+RR LEE++  F KRKA  E  QA+  NT
Sbjct:    3 SSDVLRQPDKNARPLALSGHVGFDSLPDQLVNKSTSQGFCFNILCIGETGIGKSTLMDTLFNTNFENFESSHFEPKVKLRAQTYDLQESNVRLKLTVVNTVGFGDQMNKQESYQHIVDYIDTQFESYLQEELKIKRSLHNYHDSRIHACLYFIAPSGHSLKSLDLVTMKKLDSKVNIIPVIAKADTISKSELHKFKIKIMSELVSNGVQIYQFPIDDETVAKINTAMNGHLPFAVVGSTEEVNIGN-KMVKARQYPWGVVQVENENHCDFVKLREMLICVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPECKPVSLQQTYEAKRQEFLGELQRREEEMRQTFVQRVKEKEAELKDAERELQGKFEQLKRLHADEKSKLEEKRRSLEEEMSVFSKRKAATELLQAQSFNT 413          
BLAST of Septin-2 vs. Ensembl Zebrafish
Match: sept8a (septin 8a [Source:NCBI gene;Acc:321590])

HSP 1 Score: 439.884 bits (1130), Expect = 2.039e-147
Identity = 237/405 (58.52%), Postives = 311/405 (76.79%), Query Frame = 1
Query:  127 EIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGNTIKKKK 1329
            E R L + GHVGFD+LP QLV+K+V QGF FNILC+GETG+GKSTLM TLF   F+   ++H    V L+   +DL+E NV LKL+I+++ GFGDQINKE+   P++ YID +FE YLQEE+KIKR+L+NYHDTR+H+CLYFI+PTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI+KSE+ KFK KIM+E+ SN + IYQFPT D+ V E+N+ MN  LPFAVVGS +E K+ N K  R RQYPWG VQ++N++HCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R+    +L++KEEE+RQMF  +VKE E +LKE ++EL  KFE LK+ + EEKRK+EE+RR LEE++  F +RK   E       +KK K
Sbjct:   13 EKRNLSLGGHVGFDSLPDQLVSKSVTQGFCFNILCVGETGIGKSTLMNTLFNTMFENEEASHYQNGVYLRPRTYDLQESNVHLKLTIVDTVGFGDQINKEESYKPIVDYIDTQFENYLQEELKIKRSLFNYHDTRIHICLYFISPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMSELVSNGVQIYQFPTDDEAVTEINSSMNAHLPFAVVGSVEEVKVGN-KTVRARQYPWGVVQVENESHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSQPFSLQETYEAKRKEFLGDLQKKEEEMRQMFVNKVKETEAELKEKERELHEKFEQLKRMHQEEKRKVEEKRRELEEEMNAFNRRKVAAETLSLSQPLKKDK 416          
BLAST of Septin-2 vs. Ensembl Zebrafish
Match: sept6 (septin 6 [Source:ZFIN;Acc:ZDB-GENE-030131-1414])

HSP 1 Score: 433.335 bits (1113), Expect = 1.280e-144
Identity = 234/403 (58.06%), Postives = 315/403 (78.16%), Query Frame = 1
Query:   97 TTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE 1293
             TE+ +      R + ++GHVGFD++P QLVNK+VN GF FNILC+GETGLGKSTLM+TLF   F+  P+ H+ P V LK + ++L+E NV+LKL+++ + GFGDQINKED    ++ +ID +FE YLQEE+KIKR L++YHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAKSD I+KSE+ KFK KI +E+ SN + IYQFPT D+TV E+N+ MN  LPFAVVGS +E K+ N K+ R RQYPWGTVQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R     EL++KEEE+RQMF  RVKEKE +LKE++KEL  KF+ LKK + +EK+KLE++++ L++++  F+++K   E
Sbjct:    8 ATEIARQAGEGARAVPLSGHVGFDSMPDQLVNKSVNHGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPTQHNQPGVQLKSNTYELQESNVRLKLTVVNTVGFGDQINKEDSYKSIVEFIDAQFEAYLQEELKIKRTLHSYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDETVAEINSTMNGHLPFAVVGSTEEVKIGN-KMVRARQYPWGTVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFMGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDELNGFKQKKTAAE 409          
BLAST of Septin-2 vs. Ensembl Zebrafish
Match: sept6 (septin 6 [Source:ZFIN;Acc:ZDB-GENE-030131-1414])

HSP 1 Score: 433.335 bits (1113), Expect = 1.308e-144
Identity = 234/403 (58.06%), Postives = 314/403 (77.92%), Query Frame = 1
Query:   97 TTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNE----NMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE 1293
             TE+ +      R + ++GHVGFD++P QLVNK+VN GF FNILC+GETGLGKSTLM+TLF   F+  P+ H+ P V LK + ++L+E NV+LKL+++ + GFGDQINKED    ++ +ID +FE YLQEE+KIKR L++YHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAKSD I+KSE+ KFK KI +E+ SN + IYQFPT D+TV E+N+ MN  LPFAVVGS +E K+ N K+ R RQYPWGTVQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF D +      SLQETY+ +R     EL++KEEE+RQMF  RVKEKE +LKE++KEL  KF+ LKK + +EK+KLE++++ L++++  F+++K   E
Sbjct:    8 ATEIARQAGEGARAVPLSGHVGFDSMPDQLVNKSVNHGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPTQHNQPGVQLKSNTYELQESNVRLKLTVVNTVGFGDQINKEDSYKSIVEFIDAQFEAYLQEELKIKRTLHSYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDETVAEINSTMNGHLPFAVVGSTEEVKIGN-KMVRARQYPWGTVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFMGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEDKKKSLDDELNGFKQKKTAAE 409          
BLAST of Septin-2 vs. Ensembl Xenopus
Match: rag1 (recombination activating gene 1 [Source:Xenbase;Acc:XB-GENE-6087118])

HSP 1 Score: 445.277 bits (1144), Expect = 3.573e-149
Identity = 241/402 (59.95%), Postives = 327/402 (81.34%), Query Frame = 1
Query:   94 MTTEVVKGL-ANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKA 1284
            ++   VKGL +++IRTL ++GHVGFD+LP QLVNK+ +QGF FNILC+GETG+GKSTLM+T+F   F+  P +H  P V LK  +++L+E NV+LKL+I+++ GFGDQINKE+   P++ YID +FE YLQEE+KIKR+LYNYHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI K+E+ KFK+KIMNE+ SN + IYQFPT ++TV E+N  M+  LPFAVVGS +E K+ N K+++ RQYPWG VQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R     EL++KEEE+RQMF MRVKEKE +LKE++KEL  KF+ LK+++ EEK+KLE++++ +EE++  F+K+KA
Sbjct:    7 LSQHSVKGLPSDDIRTLSMSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTIFNTKFENEPVSHSEPAVQLKARSYELQESNVRLKLTIVDTVGFGDQINKEESYRPIVEYIDAQFEAYLQEELKIKRSLYNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMNELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGN-KMAKARQYPWGIVQVENENHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTAPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKLEDKKKEIEEEVNMFQKKKA 407          
BLAST of Septin-2 vs. Ensembl Xenopus
Match: rag1 (recombination activating gene 1 [Source:Xenbase;Acc:XB-GENE-6087118])

HSP 1 Score: 443.736 bits (1140), Expect = 1.296e-148
Identity = 238/399 (59.65%), Postives = 326/399 (81.70%), Query Frame = 1
Query:  100 TEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKA 1284
            +E+++  +++IRTL ++GHVGFD+LP QLVNK+ +QGF FNILC+GETG+GKSTLM+T+F   F+  P +H  P V LK  +++L+E NV+LKL+I+++ GFGDQINKE+   P++ YID +FE YLQEE+KIKR+LYNYHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI K+E+ KFK+KIMNE+ SN + IYQFPT ++TV E+N  M+  LPFAVVGS +E K+ N K+++ RQYPWG VQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R     EL++KEEE+RQMF MRVKEKE +LKE++KEL  KF+ LK+++ EEK+KLE++++ +EE++  F+K+KA
Sbjct:    1 SEILELPSDDIRTLSMSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTIFNTKFENEPVSHSEPAVQLKARSYELQESNVRLKLTIVDTVGFGDQINKEESYRPIVEYIDAQFEAYLQEELKIKRSLYNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMNELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGN-KMAKARQYPWGIVQVENENHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTAPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKLEDKKKEIEEEVNMFQKKKA 398          
BLAST of Septin-2 vs. Ensembl Xenopus
Match: rag1 (recombination activating gene 1 [Source:Xenbase;Acc:XB-GENE-6087118])

HSP 1 Score: 442.195 bits (1136), Expect = 4.599e-148
Identity = 238/397 (59.95%), Postives = 323/397 (81.36%), Query Frame = 1
Query:  106 VVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKA 1284
            V++   ++IRTL ++GHVGFD+LP QLVNK+ +QGF FNILC+GETG+GKSTLM+T+F   F+  P +H  P V LK  +++L+E NV+LKL+I+++ GFGDQINKE+   P++ YID +FE YLQEE+KIKR+LYNYHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI K+E+ KFK+KIMNE+ SN + IYQFPT ++TV E+N  M+  LPFAVVGS +E K+ N K+++ RQYPWG VQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R     EL++KEEE+RQMF MRVKEKE +LKE++KEL  KF+ LK+++ EEK+KLE++++ +EE++  F+K+KA
Sbjct:    6 VLEQTCDDIRTLSMSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTIFNTKFENEPVSHSEPAVQLKARSYELQESNVRLKLTIVDTVGFGDQINKEESYRPIVEYIDAQFEAYLQEELKIKRSLYNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMNELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGN-KMAKARQYPWGIVQVENENHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTAPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKLEDKKKEIEEEVNMFQKKKA 401          
BLAST of Septin-2 vs. Ensembl Xenopus
Match: rag1 (recombination activating gene 1 [Source:Xenbase;Acc:XB-GENE-6087118])

HSP 1 Score: 442.195 bits (1136), Expect = 5.574e-148
Identity = 237/392 (60.46%), Postives = 321/392 (81.89%), Query Frame = 1
Query:  121 ANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKA 1284
            +++IRTL ++GHVGFD+LP QLVNK+ +QGF FNILC+GETG+GKSTLM+T+F   F+  P +H  P V LK  +++L+E NV+LKL+I+++ GFGDQINKE+   P++ YID +FE YLQEE+KIKR+LYNYHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI K+E+ KFK+KIMNE+ SN + IYQFPT ++TV E+N  M+  LPFAVVGS +E K+ N K+++ RQYPWG VQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R     EL++KEEE+RQMF MRVKEKE +LKE++KEL  KF+ LK+++ EEK+KLE++++ +EE++  F+K+KA
Sbjct:   12 SDDIRTLSMSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTIFNTKFENEPVSHSEPAVQLKARSYELQESNVRLKLTIVDTVGFGDQINKEESYRPIVEYIDAQFEAYLQEELKIKRSLYNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMNELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGN-KMAKARQYPWGIVQVENENHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTAPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKLEDKKKEIEEEVNMFQKKKA 402          
BLAST of Septin-2 vs. Ensembl Xenopus
Match: rag1 (recombination activating gene 1 [Source:Xenbase;Acc:XB-GENE-6087118])

HSP 1 Score: 441.81 bits (1135), Expect = 6.841e-148
Identity = 237/392 (60.46%), Postives = 321/392 (81.89%), Query Frame = 1
Query:  121 ANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKA 1284
            +++IRTL ++GHVGFD+LP QLVNK+ +QGF FNILC+GETG+GKSTLM+T+F   F+  P +H  P V LK  +++L+E NV+LKL+I+++ GFGDQINKE+   P++ YID +FE YLQEE+KIKR+LYNYHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI K+E+ KFK+KIMNE+ SN + IYQFPT ++TV E+N  M+  LPFAVVGS +E K+ N K+++ RQYPWG VQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R     EL++KEEE+RQMF MRVKEKE +LKE++KEL  KF+ LK+++ EEK+KLE++++ +EE++  F+K+KA
Sbjct:   10 SDDIRTLSMSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTIFNTKFENEPVSHSEPAVQLKARSYELQESNVRLKLTIVDTVGFGDQINKEESYRPIVEYIDAQFEAYLQEELKIKRSLYNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMNELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGN-KMAKARQYPWGIVQVENENHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTAPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKLEDKKKEIEEEVNMFQKKKA 400          
BLAST of Septin-2 vs. Ensembl Mouse
Match: Sept11 (septin 11 [Source:MGI Symbol;Acc:MGI:1277214])

HSP 1 Score: 441.039 bits (1133), Expect = 9.476e-148
Identity = 238/400 (59.50%), Postives = 323/400 (80.75%), Query Frame = 1
Query:   94 MTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRK 1281
            M   V +    E+R L ++GHVGFD+LP QLVNK+ +QGF FNILC+GETG+GKSTLM+TLF   F+  P+TH+ P V LK  +++L+E NV+LKL+I+++ GFGDQINK+D   P++ YID +FE YLQEE+KIKR+L+NYHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI K+E+ KFK+KIM+E+ SN + IYQFPT ++TV E+N  M+  LPFAVVGS +E K+ N K+++ RQYPWG VQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R     EL++KEEE+RQMF MRVKEKE +LKE++KEL  KF+ LK+++ EEK+K+E++++ LEE++ NF+K+K
Sbjct:    1 MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGN-KMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVSNFQKKK 399          
BLAST of Septin-2 vs. Ensembl Mouse
Match: Sept11 (septin 11 [Source:MGI Symbol;Acc:MGI:1277214])

HSP 1 Score: 441.039 bits (1133), Expect = 1.044e-147
Identity = 238/400 (59.50%), Postives = 323/400 (80.75%), Query Frame = 1
Query:   94 MTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRK 1281
            M   V +    E+R L ++GHVGFD+LP QLVNK+ +QGF FNILC+GETG+GKSTLM+TLF   F+  P+TH+ P V LK  +++L+E NV+LKL+I+++ GFGDQINK+D   P++ YID +FE YLQEE+KIKR+L+NYHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI K+E+ KFK+KIM+E+ SN + IYQFPT ++TV E+N  M+  LPFAVVGS +E K+ N K+++ RQYPWG VQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R     EL++KEEE+RQMF MRVKEKE +LKE++KEL  KF+ LK+++ EEK+K+E++++ LEE++ NF+K+K
Sbjct:    1 MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGN-KMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVSNFQKKK 399          
BLAST of Septin-2 vs. Ensembl Mouse
Match: Sept11 (septin 11 [Source:MGI Symbol;Acc:MGI:1277214])

HSP 1 Score: 441.039 bits (1133), Expect = 1.159e-147
Identity = 238/400 (59.50%), Postives = 323/400 (80.75%), Query Frame = 1
Query:   94 MTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRK 1281
            M   V +    E+R L ++GHVGFD+LP QLVNK+ +QGF FNILC+GETG+GKSTLM+TLF   F+  P+TH+ P V LK  +++L+E NV+LKL+I+++ GFGDQINK+D   P++ YID +FE YLQEE+KIKR+L+NYHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI K+E+ KFK+KIM+E+ SN + IYQFPT ++TV E+N  M+  LPFAVVGS +E K+ N K+++ RQYPWG VQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R     EL++KEEE+RQMF MRVKEKE +LKE++KEL  KF+ LK+++ EEK+K+E++++ LEE++ NF+K+K
Sbjct:    1 MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGN-KMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVSNFQKKK 399          
BLAST of Septin-2 vs. Ensembl Mouse
Match: Sept11 (septin 11 [Source:MGI Symbol;Acc:MGI:1277214])

HSP 1 Score: 440.654 bits (1132), Expect = 1.930e-147
Identity = 238/400 (59.50%), Postives = 323/400 (80.75%), Query Frame = 1
Query:   94 MTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRK 1281
            M   V +    E+R L ++GHVGFD+LP QLVNK+ +QGF FNILC+GETG+GKSTLM+TLF   F+  P+TH+ P V LK  +++L+E NV+LKL+I+++ GFGDQINK+D   P++ YID +FE YLQEE+KIKR+L+NYHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI K+E+ KFK+KIM+E+ SN + IYQFPT ++TV E+N  M+  LPFAVVGS +E K+ N K+++ RQYPWG VQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R     EL++KEEE+RQMF MRVKEKE +LKE++KEL  KF+ LK+++ EEK+K+E++++ LEE++ NF+K+K
Sbjct:    1 MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGN-KMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVSNFQKKK 399          
BLAST of Septin-2 vs. Ensembl Mouse
Match: Sept11 (septin 11 [Source:MGI Symbol;Acc:MGI:1277214])

HSP 1 Score: 440.654 bits (1132), Expect = 1.954e-147
Identity = 238/400 (59.50%), Postives = 323/400 (80.75%), Query Frame = 1
Query:   94 MTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRK 1281
            M   V +    E+R L ++GHVGFD+LP QLVNK+ +QGF FNILC+GETG+GKSTLM+TLF   F+  P+TH+ P V LK  +++L+E NV+LKL+I+++ GFGDQINK+D   P++ YID +FE YLQEE+KIKR+L+NYHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI K+E+ KFK+KIM+E+ SN + IYQFPT ++TV E+N  M+  LPFAVVGS +E K+ N K+++ RQYPWG VQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R     EL++KEEE+RQMF MRVKEKE +LKE++KEL  KF+ LK+++ EEK+K+E++++ LEE++ NF+K+K
Sbjct:    1 MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGN-KMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVSNFQKKK 399          
BLAST of Septin-2 vs. UniProt/SwissProt
Match: sp|P54359|SEPT2_DROME (Septin-2 OS=Drosophila melanogaster OX=7227 GN=Sep2 PE=2 SV=2)

HSP 1 Score: 464.922 bits (1195), Expect = 2.834e-156
Identity = 244/404 (60.40%), Postives = 317/404 (78.47%), Query Frame = 1
Query:  130 IRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGNTIKKKK 1329
            +RTLK +GHVGFD+LP QLVNK+V  GF FN++C+GETGLGKSTLM+TLF  +F+ TPS H LP V LK   ++L+E NV+LKL+I ++ G+GDQINK+D    V+ YID +FE YLQEE+KIKR+L   HD+R+H+CLYFI PTGH +KSLDLV MKKL+SKV+IIPVIAK+DTI+K E+Q+FKAKI+ E+ +N ++IYQFPT D+TV E NT MN  +PFAVVGS +  K+ N K+ R RQYPWGTVQ++N+ HCDF++LREML+RTNM+D+RE+TH  HYE YR+ RL +MGF    SDN+ +S Q+T++ +R     EL+ KEEE+RQMF  RVKEKE +LKES+K+L AKFE LK+ +AEEKRKLEE R+ LEED  +F++RK  +  A    T+ K K
Sbjct:   15 LRTLKQSGHVGFDSLPDQLVNKSVQNGFVFNVMCIGETGLGKSTLMDTLFNTSFESTPSPHTLPSVKLKAHTYELQESNVRLKLTICDTVGYGDQINKDDSFKAVVDYIDAQFENYLQEELKIKRSLVTCHDSRIHICLYFICPTGHGLKSLDLVCMKKLDSKVNIIPVIAKADTISKVELQRFKAKIIQELNANGVHIYQFPTDDETVAETNTSMNSHIPFAVVGSTEFIKVGN-KLIRARQYPWGTVQVENETHCDFVKLREMLIRTNMEDMREKTHTRHYELYRQKRLEQMGFSDVDSDNKPISFQQTFEAKRSNHLAELQSKEEEVRQMFVQRVKEKEAELKESEKDLHAKFEKLKRDHAEEKRKLEESRKALEEDYLDFQRRKQQLATAHHTLTLGKSK 417          
BLAST of Septin-2 vs. UniProt/SwissProt
Match: sp|A4FUM1|SEP8B_DANRE (Septin-8-B OS=Danio rerio OX=7955 GN=sept8b PE=2 SV=1)

HSP 1 Score: 450.669 bits (1158), Expect = 1.145e-150
Identity = 238/416 (57.21%), Postives = 320/416 (76.92%), Query Frame = 1
Query:   97 TTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE--QAKQGNTIKKK 1326
             TEV      E+R+L ++GHVGFD+LP QLV+K+V+QGFSFNILC+GETG+GKSTLM TLF   F+   ++H    V L+   + L+E NV L+L+I+++ GFGDQ+NKE+   P++ YID +FE +L+EE+KIKR+LYNYHD+R+H+CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DT++KSE+QKFK KIM+E+ SN + IYQFPT D+ V E+N+ MN  LPFAV+GS++E K+ N K+ R RQYPWG VQ++N++HCDF++LREML+R NM DLRE+TH  HYE YR+ +L EMGF    +D+E  SLQETY  +R     EL+ KEE++RQMF  +VKE E +LKE ++EL  +FE LK+++ EEKR LEE RR  EE++  F +RK   E  Q+ QG+T  KK
Sbjct:    3 ATEVNTYPTEEMRSLSLSGHVGFDSLPDQLVSKSVSQGFSFNILCVGETGIGKSTLMNTLFNTTFENEEASHFHNGVHLRPRTYSLQESNVDLQLTIVDTVGFGDQVNKEESYKPIVDYIDAQFENFLEEELKIKRSLYNYHDSRIHICLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTVSKSELQKFKIKIMSELVSNGVQIYQFPTDDEAVAEINSSMNAHLPFAVIGSSEEVKIGN-KMVRARQYPWGVVQVENESHCDFVKLREMLIRVNMLDLREQTHARHYELYRRCKLEEMGFKDTDADSEPFSLQETYVAKRREFIVELQMKEEQMRQMFVNKVKETEAELKEKERELHERFEMLKRTHQEEKRSLEEMRRDFEEEMNTFNRRKVAAETLQSLQGSTGLKK 417          
BLAST of Septin-2 vs. UniProt/SwissProt
Match: sp|Q9P0V9|SEP10_HUMAN (Septin-10 OS=Homo sapiens OX=9606 GN=SEPTIN10 PE=1 SV=2)

HSP 1 Score: 448.358 bits (1152), Expect = 2.503e-149
Identity = 233/392 (59.44%), Postives = 315/392 (80.36%), Query Frame = 1
Query:  130 IRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSD----NENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE 1293
            IR+L ++GHVGF++LP QLVN+++ QGF FNILC+GETG+GKSTL++TLF  NF+   S+H  P V LK   ++L+E NV+LKL+I+ + GFGDQINKE+   P++ YID +FE YLQEE+KIKR+L+ YHD+R+HVCLYFI+PTGH++K+LDL+ MK L+SKV+IIPVIAK+DT++K+E+QKFK K+M+E+ SN + IYQFPT DDT+ ++N  MN  LPFAVVGS DE K+ N K+ + RQYPWG VQ++N+NHCDF++LREML+ TNM+DLRE+TH  HYE YR+ +L EMGF+D    N+ +S+QETY+ +R     E ++KEEE++QMF  RVKEKE  LKE+++EL AKFE LK+ + EE+ KLEE+RR+LEE+I  F K+KA  E
Sbjct:   38 IRSLTMSGHVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDYESSHFCPNVKLKAQTYELQESNVQLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKIKRSLFTYHDSRIHVCLYFISPTGHSLKTLDLLTMKNLDSKVNIIPVIAKADTVSKTELQKFKIKLMSELVSNGVQIYQFPTDDDTIAKVNAAMNGQLPFAVVGSMDEVKVGN-KMVKARQYPWGVVQVENENHCDFVKLREMLICTNMEDLREQTHTRHYELYRRCKLEEMGFTDVGPENKPVSVQETYEAKRHEFHGERQRKEEEMKQMFVQRVKEKEAILKEAERELQAKFEHLKRLHQEERMKLEEKRRLLEEEIIAFSKKKATSE 428          
BLAST of Septin-2 vs. UniProt/SwissProt
Match: sp|Q2KJB1|SEP10_BOVIN (Septin-10 OS=Bos taurus OX=9913 GN=SEPTIN10 PE=2 SV=1)

HSP 1 Score: 447.203 bits (1149), Expect = 6.737e-149
Identity = 232/391 (59.34%), Postives = 313/391 (80.05%), Query Frame = 1
Query:  133 RTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSD----NENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE 1293
            R+L ++GHVGF++LP QLVN+++ QGF FNILC+GETG+GKSTL++TLF  NF+   S+H  P V LK   ++L+E NV+LKL+I+ + GFGDQINKE+   P++ YID +FE YLQEE+KIKR+L+NYHD+RVHVCLYFI+PTGH++K+LDL+ MK L+SKV+IIPVIAK+D I+K+E+QKFK K+M+E+ SN + IYQFPT D+T+ ++N  MN  LPFAVVGS DE K+ N K+ + RQYPWG VQ++N+NHCDF++LREML+ TNM+DLR++TH  HYE YR+ +L EMGF D    N+ +SLQETY+ +R     E ++KEEE++Q+F  RVKEKE  LKE+++EL AKFE LK+ + EEK +LEE+RR+LEE+I  F K+KA  E
Sbjct:   38 RSLTMSGHVGFESLPDQLVNRSIQQGFCFNILCVGETGIGKSTLIDTLFNTNFEDHESSHFYPHVRLKAQTYELQESNVRLKLTIVNTVGFGDQINKEESYQPIVDYIDAQFEAYLQEELKIKRSLFNYHDSRVHVCLYFISPTGHSLKTLDLLTMKSLDSKVNIIPVIAKADAISKTELQKFKIKLMSELVSNGVQIYQFPTDDETIAKINASMNGHLPFAVVGSMDEVKVGN-KMVKARQYPWGVVQVENENHCDFVKLREMLICTNMEDLRDQTHTRHYELYRRRKLEEMGFMDVGPENQPLSLQETYEAKRHEFYGERQRKEEEMKQLFVQRVKEKEAILKEAERELQAKFEHLKRVHQEEKLRLEEKRRLLEEEIMAFSKKKATSE 427          
BLAST of Septin-2 vs. UniProt/SwissProt
Match: sp|Q6AXA6|SEP8A_XENLA (Septin-8-A OS=Xenopus laevis OX=8355 GN=sept8-a PE=2 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 4.211e-148
Identity = 239/422 (56.64%), Postives = 319/422 (75.59%), Query Frame = 1
Query:   97 TTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDN----ENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE-------QAKQGNTIKKKK 1329
             T+V +    E R+L ++GHVGFD+LP QLV+K+V QGF FNILC+GETG+GKSTLM TLF   F+   ++H    V L+   +DL+E NV LKL+I+++ GFGDQINK+D    V+ YID +FE YLQEE+KI+R+L+N+HD+R+HVCLYFI PTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI+KSE+ KFK KIM+E+ SN + IYQFPT DD V E+N+ MN  LPFAVVGS +E K+ N K+ R RQYPWG VQ++N++HCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF DN    +  SLQETY+ +R+    EL++KEEE+RQMF  +VKE E +LKE ++EL  KF  LK+ + EE +K+E++RR LEE++ +F +RKA +E       QA     +KK K
Sbjct:    3 ATDVQRASNEEKRSLAMSGHVGFDSLPDQLVSKSVTQGFCFNILCVGETGIGKSTLMNTLFNTTFETEEASHYENGVCLRPRTYDLQESNVHLKLTIVDTVGFGDQINKDDSYRSVVDYIDTQFENYLQEELKIRRSLFNFHDSRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMSELVSNGVQIYQFPTDDDAVAEINSVMNAHLPFAVVGSTEEVKVGN-KLVRARQYPWGVVQVENESHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDNDPDTQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETEAELKERERELQEKFMQLKRIHQEESKKVEDKRRDLEEEMNSFNRRKAAMEALQSQSFQATSQQPLKKDK 423          
BLAST of Septin-2 vs. TrEMBL
Match: A0A4E0RBQ8 (Septin-2 OS=Fasciola hepatica OX=6192 GN=D915_005619 PE=3 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 292/408 (71.57%), Postives = 363/408 (88.97%), Query Frame = 1
Query:  109 VKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGN-TIKKKK 1329
            VK +  E+RTLK++GHVGFD+LP QLVNKAV+QGFSFNILC+GETG+GKSTL+ETLF Q FDF PS HDLP   LK S F+LKEGNVKLKLS++E+CGFGDQ+NKED + PVI Y++ +FEKYLQEE+K+KR+L N+HDTR+HVCLYFIAPTGH++KSLD+VAMK LESKV++IP+IAKSDT+TK E+QKFKA+I++EIQSN+INIYQFPT D+TV ++NT+MNQ +PFAVVGS +E K+ NGK +RVRQYPWG VQ+DN++HCDF+RLREMLLR NM+DLRERTH V+YETYR+ RLIEMGF D+E MSLQETY++RRE Q KEL+QKEEE+RQ+F  RVKEKE  LKE+++EL AKFE+LKK++AEEK+KLE+++RILEE++  FE+RK + EQAKQGN T+KKKK
Sbjct:    5 VKAITGEVRTLKLSGHVGFDSLPNQLVNKAVSQGFSFNILCVGETGIGKSTLIETLFNQKFDFVPSLHDLPNPKLKESFFELKEGNVKLKLSVVETCGFGDQLNKEDNIKPVIDYVNSQFEKYLQEELKMKRSLQNFHDTRIHVCLYFIAPTGHSLKSLDVVAMKALESKVNVIPIIAKSDTVTKVELQKFKARILSEIQSNEINIYQFPTDDETVSDVNTKMNQHVPFAVVGSGEEIKI-NGKNARVRQYPWGAVQVDNESHCDFVRLREMLLRVNMEDLRERTHTVNYETYRRQRLIEMGFRDDEKMSLQETYEKRRELQRKELQQKEEEMRQLFVQRVKEKEQVLKEAERELQAKFEALKKNHAEEKKKLEDKKRILEEEMAAFERRKLLAEQAKQGNFTMKKKK 411          
BLAST of Septin-2 vs. TrEMBL
Match: G4VFI8 (Putative septin OS=Schistosoma mansoni OX=6183 GN=Smp_029890 PE=1 SV=1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 289/413 (69.98%), Postives = 361/413 (87.41%), Query Frame = 1
Query:   94 MTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGN-TIKKKK 1329
            MT +V+K L  ++RTLK++GHVGFD+LP QLVNKA++QGF FNILC+GETG+GKSTL+ETLF Q FDF+PSTHDL +  LK   +DLKE NVKLKL+++E+CG+GDQINKE+ + PV+ YID +FE YLQEE+K+KR++  +HDTRVHVCLYFIAPTGH++KS+DLVAMKKLE+KV++IPVIAKSDTITKSE+QKFKA+I++EIQSN+I IYQFPT D+ V E N+ MNQ +PFAVVGS++E K+ NGK  RVRQYPWG+VQ++N+NHCDF+RLREMLLR NM+DLRERTH VHYETYR+ RLIEMGF D+E MSLQETY++RRE Q KEL+QKEEE+RQMF  RVKEKE  LKE+++EL  KFESLKK++AEEK+KLEE++R LEE+I  FE+RK + EQA+QGN T+KK+K
Sbjct:    1 MTADVLKALPPDVRTLKLSGHVGFDSLPDQLVNKAISQGFVFNILCVGETGIGKSTLLETLFNQKFDFSPSTHDLTDPKLKAVTYDLKEANVKLKLTVVETCGYGDQINKENNIKPVVDYIDNQFENYLQEELKMKRSMQAFHDTRVHVCLYFIAPTGHSLKSIDLVAMKKLENKVNVIPVIAKSDTITKSELQKFKARILSEIQSNEIGIYQFPTDDEAVSETNSVMNQHIPFAVVGSSEEVKI-NGKTVRVRQYPWGSVQVENENHCDFVRLREMLLRVNMEDLRERTHGVHYETYRRQRLIEMGFRDDEKMSLQETYEKRRELQRKELQQKEEEMRQMFVQRVKEKEQVLKEAERELQTKFESLKKTHAEEKKKLEEKKRFLEEEIAAFERRKQLAEQARQGNLTMKKRK 412          
BLAST of Septin-2 vs. TrEMBL
Match: Q5DDA5 (SJCHGC01523 protein OS=Schistosoma japonicum OX=6182 GN=EWB00_003989 PE=2 SV=1)

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 289/413 (69.98%), Postives = 359/413 (86.92%), Query Frame = 1
Query:   94 MTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGN-TIKKKK 1329
            MT +V+K L  ++RTLK+ GHVGFD+LP QLVNKA++QGF FNILC+GETG+GKSTL+ETLF Q FDF+PSTHDL +  LK   +DLKE NVKLKL+++E+CG+GDQINKE+ + PVI YI  +FE YLQEE+K+KR++  +HDTRVH CLYFIAPTGH++KS+DLVAMKKLE+KV++IP+IAKSDTITKSE+QKFKA+I+NEIQSN+I IYQFPT D+ V E N+ MNQ +PFA+VGS++E K+ NGK  RVRQYPWG+VQ++N+NHCDF+RLREMLLR NM+DLRERTH VHYETYR+ RLIEMGF D+E MSLQETY++RRE Q KEL+QKEEE+RQMF  RVKEKE  LKE+++EL  KFE+LKK++AEEK+KLEE++RILEE+I  FE+RK + EQA+QGN TIKKKK
Sbjct:    1 MTADVLKSLPPDVRTLKLTGHVGFDSLPDQLVNKAISQGFVFNILCVGETGIGKSTLLETLFNQKFDFSPSTHDLADPKLKAVTYDLKEANVKLKLTVVETCGYGDQINKENNIKPVIDYISNQFENYLQEELKMKRSMQAFHDTRVHACLYFIAPTGHSLKSIDLVAMKKLENKVNVIPIIAKSDTITKSELQKFKARILNEIQSNEIGIYQFPTDDEAVSETNSAMNQHIPFAIVGSSEETKI-NGKTVRVRQYPWGSVQVENENHCDFVRLREMLLRVNMEDLRERTHGVHYETYRRQRLIEMGFRDDEKMSLQETYEKRRELQRKELQQKEEEMRQMFVQRVKEKEQVLKEAERELQTKFENLKKTHAEEKKKLEEKKRILEEEIAAFERRKQLAEQARQGNLTIKKKK 412          
BLAST of Septin-2 vs. TrEMBL
Match: A0A3Q0KDV9 (Putative septin; Septin-10 OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 288/413 (69.73%), Postives = 360/413 (87.17%), Query Frame = 1
Query:   94 MTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGN-TIKKKK 1329
            MT +V+K L  ++RTLK++GHVGFD+LP QLVNKA++QGF FNILC+GETG+GKSTL+ETLF Q FDF+PS HDL +  LK   +DLKE NVKLKL+++E+CG+GDQINKE+ + PV+ YID +FE YLQEE+K+KR++  +HDTRVHVCLYFIAPTGH++KS+DLVAMKKLE+KV++IPVIAKSDTITKSE+QKFKA+I++EIQSN+I IYQFPT D+ V E N+ MNQ +PFAVVGS++E K+ NGK  RVRQYPWG+VQ++N+NHCDF+RLREMLLR NM+DLRERTH VHYETYR+ RLIEMGF D+E MSLQETY++RRE Q KEL+QKEEE+RQMF  RVKEKE  LKE+++EL  KFESLKK++AEEK+KLEE++R LEE+I  FE+RK + EQA+QGN T+KK+K
Sbjct:    1 MTADVLKALPPDVRTLKLSGHVGFDSLPDQLVNKAISQGFVFNILCVGETGIGKSTLLETLFNQKFDFSPSNHDLTDPKLKAVTYDLKEANVKLKLTVVETCGYGDQINKENNIKPVVDYIDNQFENYLQEELKMKRSMQAFHDTRVHVCLYFIAPTGHSLKSIDLVAMKKLENKVNVIPVIAKSDTITKSELQKFKARILSEIQSNEIGIYQFPTDDEAVSETNSVMNQHIPFAVVGSSEEVKI-NGKTVRVRQYPWGSVQVENENHCDFVRLREMLLRVNMEDLRERTHGVHYETYRRQRLIEMGFRDDEKMSLQETYEKRRELQRKELQQKEEEMRQMFVQRVKEKEQVLKEAERELQTKFESLKKTHAEEKKKLEEKKRFLEEEIAAFERRKQLAEQARQGNLTMKKRK 412          
BLAST of Septin-2 vs. TrEMBL
Match: A0A504YUL9 (Septin-2 OS=Fasciola gigantica OX=46835 GN=FGIG_01793 PE=3 SV=1)

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 293/419 (69.93%), Postives = 364/419 (86.87%), Query Frame = 1
Query:  109 VKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILC-----------LGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGN-TIKKKK 1329
            VK +A E+RTLK++GHVGFD+LP QLVNKAV+QGFSFNILC           +GETG+GKSTL+ETLF Q FDF PS HDLP   LK S F+LKEGNVKLKLS++E+CGFGDQ+NKED + PVI Y++ +FEKYLQEE+K+KR+L N+HDTR+HVCLYFIAPTGH++KSLD+VAMK LESKV++IP+IAKSDT+TK E+QKFKA+I++EIQSN+INIYQFPT D+TV ++NT+MNQ +PFAVVGS +E K+ NGK +RVRQYPWG VQ+DN++HCDF+RLREMLLR NM+DLRERTH V+YETYR+ RLIEMGF D+E MSLQETY++RRE Q KEL+QKEEE+RQ+F  RVKEKE  LKE+++EL AKFE+LKK++AEEK+KLE+++RILEE++  FE+RK + EQAKQGN T+KKKK
Sbjct:    5 VKAIAGEVRTLKLSGHVGFDSLPNQLVNKAVSQGFSFNILCVGKVEFNTYSWIGETGIGKSTLIETLFNQKFDFVPSLHDLPNPKLKESFFELKEGNVKLKLSVVETCGFGDQLNKEDNIKPVIDYVNSQFEKYLQEELKMKRSLQNFHDTRIHVCLYFIAPTGHSLKSLDVVAMKALESKVNVIPIIAKSDTVTKVELQKFKARILSEIQSNEINIYQFPTDDETVSDVNTKMNQHVPFAVVGSGEEIKI-NGKNARVRQYPWGAVQVDNESHCDFVRLREMLLRVNMEDLRERTHTVNYETYRRQRLIEMGFRDDEKMSLQETYEKRRELQRKELQQKEEEMRQLFVQRVKEKEQVLKEAERELQAKFEALKKNHAEEKKKLEDKKRILEEEMAAFERRKLLAEQAKQGNFTMKKKK 422          
BLAST of Septin-2 vs. Ensembl Cavefish
Match: sept8a (septin-8-A [Source:NCBI gene;Acc:103023804])

HSP 1 Score: 446.432 bits (1147), Expect = 5.635e-150
Identity = 238/407 (58.48%), Postives = 314/407 (77.15%), Query Frame = 1
Query:  121 ANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGNTIKKKK 1329
            + E R+L + GHVGFD+LP QLV+K+V QGF FNILC+GETG+GKSTLM TLF   F+   ++H    V L+   +DL+E NV LKL+I+++ GFGDQINKE+   P++ YID +FE YLQEE+KIKR+L+NYHDTR+H+CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI+KSE+ KFK KIM+E+ SN + IYQFPT D+ V E+N+ MN  LPFAVVGS +E K+ N K  R RQYPWG VQ++N++HCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R+    +L++KEEE+RQMF  +VKE E++LKE ++EL  KFE LK+ + EEKRK+EE+RR LEE++  F +RK   E       +KK K
Sbjct:   11 SEEKRSLSLGGHVGFDSLPDQLVSKSVTQGFCFNILCVGETGIGKSTLMNTLFNTTFENEEASHYQNGVYLRPRTYDLQESNVHLKLTIVDTVGFGDQINKEESYKPIVDYIDTQFENYLQEELKIKRSLFNYHDTRIHICLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMSELVSNGVQIYQFPTDDEAVSEINSSMNAHLPFAVVGSVEEVKVGN-KTVRARQYPWGVVQVENESHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSQPFSLQETYEAKRKEFLSDLQRKEEEMRQMFVNKVKETESELKEKERELHDKFEQLKRMHQEEKRKVEEKRRDLEEEMNAFNRRKMAAETLSLSQPLKKDK 416          
BLAST of Septin-2 vs. Ensembl Cavefish
Match: sept8a (septin-8-A [Source:NCBI gene;Acc:103023804])

HSP 1 Score: 445.662 bits (1145), Expect = 7.157e-149
Identity = 238/407 (58.48%), Postives = 314/407 (77.15%), Query Frame = 1
Query:  121 ANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGNTIKKKK 1329
            + E R+L + GHVGFD+LP QLV+K+V QGF FNILC+GETG+GKSTLM TLF   F+   ++H    V L+   +DL+E NV LKL+I+++ GFGDQINKE+   P++ YID +FE YLQEE+KIKR+L+NYHDTR+H+CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI+KSE+ KFK KIM+E+ SN + IYQFPT D+ V E+N+ MN  LPFAVVGS +E K+ N K  R RQYPWG VQ++N++HCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R+    +L++KEEE+RQMF  +VKE E++LKE ++EL  KFE LK+ + EEKRK+EE+RR LEE++  F +RK   E       +KK K
Sbjct:   11 SEEKRSLSLGGHVGFDSLPDQLVSKSVTQGFCFNILCVGETGIGKSTLMNTLFNTTFENEEASHYQNGVYLRPRTYDLQESNVHLKLTIVDTVGFGDQINKEESYKPIVDYIDTQFENYLQEELKIKRSLFNYHDTRIHICLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMSELVSNGVQIYQFPTDDEAVSEINSSMNAHLPFAVVGSVEEVKVGN-KTVRARQYPWGVVQVENESHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSQPFSLQETYEAKRKEFLSDLQRKEEEMRQMFVNKVKETESELKEKERELHDKFEQLKRMHQEEKRKVEEKRRDLEEEMNAFNRRKMAAETLSLSQPLKKDK 416          
BLAST of Septin-2 vs. Ensembl Cavefish
Match: sept8a (septin-8-A [Source:NCBI gene;Acc:103023804])

HSP 1 Score: 442.195 bits (1136), Expect = 1.884e-148
Identity = 235/393 (59.80%), Postives = 309/393 (78.63%), Query Frame = 1
Query:  127 EIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE 1293
            E R+L + GHVGFD+LP QLV+K+V QGF FNILC+GETG+GKSTLM TLF   F+   ++H    V L+   +DL+E NV LKL+I+++ GFGDQINKE+   P++ YID +FE YLQEE+KIKR+L+NYHDTR+H+CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI+KSE+ KFK KIM+E+ SN + IYQFPT D+ V E+N+ MN  LPFAVVGS +E K+ N K  R RQYPWG VQ++N++HCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++  SLQETY+ +R+    +L++KEEE+RQMF  +VKE E++LKE ++EL  KFE LK+ + EEKRK+EE+RR LEE++  F +RK   E
Sbjct:   10 EKRSLSLGGHVGFDSLPDQLVSKSVTQGFCFNILCVGETGIGKSTLMNTLFNTTFENEEASHYQNGVYLRPRTYDLQESNVHLKLTIVDTVGFGDQINKEESYKPIVDYIDTQFENYLQEELKIKRSLFNYHDTRIHICLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMSELVSNGVQIYQFPTDDEAVSEINSSMNAHLPFAVVGSVEEVKVGN-KTVRARQYPWGVVQVENESHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSQPFSLQETYEAKRKEFLSDLQRKEEEMRQMFVNKVKETESELKEKERELHDKFEQLKRMHQEEKRKVEEKRRDLEEEMNAFNRRKMAAE 401          
BLAST of Septin-2 vs. Ensembl Cavefish
Match: sept8b (septin-8-A [Source:NCBI gene;Acc:103040455])

HSP 1 Score: 439.113 bits (1128), Expect = 4.288e-147
Identity = 230/416 (55.29%), Postives = 316/416 (75.96%), Query Frame = 1
Query:  115 GLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE-------QAKQGNTIKKKK 1329
             +  E RTL + GHVGFD+LP QLV+K+V+QGF FNILC+GETG+GKSTLM TLF   F+   ++H    V L+   ++L+E NV LKL+I+++ GFGDQINKE+   P++ YID +FE +LQEE+KIKR+L+NYHDTR+H+CLYFI+PTGH+++SLDLV MKKL+SKV++IP+IAK+DTI+K E+ KFK K+M+E+ SN + IYQFPT D+ V E+N+ MN  LPFAVVGS++E K+ N K+ R RQ+PWG VQ++N++HCDF++LREMLLR NM+DLRE+TH  HYE YR+ +L EMGF    +D +  SLQ+ Y  +R     EL++ EE++RQMF  +VKE E +LKE ++EL  +FE LK+ + EEKR LE++RR LEE++ +F +RK   E       Q+   +TIKK+K
Sbjct:   10 SVTEEKRTLTLCGHVGFDSLPDQLVSKSVSQGFCFNILCVGETGIGKSTLMNTLFNTTFENEEASHHQNTVYLRPRTYNLQESNVDLKLTIVDTVGFGDQINKEESYKPILDYIDNQFENFLQEELKIKRSLHNYHDTRIHICLYFISPTGHSLRSLDLVTMKKLDSKVNLIPLIAKADTISKCELHKFKIKVMSELVSNGVQIYQFPTDDEAVTEINSTMNAHLPFAVVGSSEEVKVGN-KMVRARQFPWGVVQVENESHCDFVKLREMLLRVNMEDLREQTHARHYELYRRCKLEEMGFKDSNTDAQPFSLQDVYVAKRREFVAELQRSEEDMRQMFVNKVKETEAELKERERELHERFEQLKRLHQEEKRSLEQKRRELEEEMNSFSRRKVAAEALQACTLQSSITHTIKKEK 424          
BLAST of Septin-2 vs. Ensembl Cavefish
Match: sept10 (septin-10 [Source:NCBI gene;Acc:103044988])

HSP 1 Score: 438.728 bits (1127), Expect = 6.494e-147
Identity = 225/391 (57.54%), Postives = 310/391 (79.28%), Query Frame = 1
Query:  133 RTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDN----ENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE 1293
            R+L ++GHVGFD+LP QLVNK+ NQGF FNILC+GETG+GKSTLM+TLF  NF+   S+H  P+V L+   +DL+E NV+LKL+++ + GFGDQ+NK++    ++ YID +FE +LQEE+KI+R+L+N+HD+R+H CLYFIAP+GH++KSLDLV MKKL+SKV+IIPVIAK+DTI+KSE+ KFK KIM+E+ SN + IYQFP  D+TV  +NT MN  LPFAVVGS +E  + N K+ + RQYPWG VQ++N++HCDF++LREML+  NM+DLRE+TH  HYE YR+ +L EMGF D     + +SLQETY+ +R+    +L+++EEE++Q F  +VKEKE +LKES+++L AKF+ LK+ +AEEK  LEE++R LEE+I +F  R+A  E
Sbjct:   15 RSLTLSGHVGFDSLPDQLVNKSTNQGFCFNILCIGETGIGKSTLMDTLFNTNFENFESSHFEPQVKLRAQTYDLQESNVRLKLTVVNTVGFGDQMNKKESYQHIVDYIDTQFESFLQEELKIRRSLHNFHDSRIHACLYFIAPSGHSLKSLDLVTMKKLDSKVNIIPVIAKADTISKSELHKFKMKIMSELVSNGVQIYQFPIDDETVATINTTMNGHLPFAVVGSTEEVNVGN-KMVKARQYPWGVVQVENESHCDFVKLREMLICINMEDLREQTHTRHYELYRRCKLEEMGFKDTNPECQPISLQETYEAKRKEFQADLQRQEEEMKQSFVQKVKEKEGELKESERQLQAKFDQLKRQHAEEKSVLEEKKRALEEEIFSFSNRRAAAE 404          
BLAST of Septin-2 vs. Ensembl Sea Lamprey
Match: SEPTIN9 (septin 9 [Source:HGNC Symbol;Acc:HGNC:7323])

HSP 1 Score: 248.44 bits (633), Expect = 6.088e-76
Identity = 139/319 (43.57%), Postives = 206/319 (64.58%), Query Frame = 1
Query:   94 MTTEVVK---GLANEIRTLKIN----GHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFD---FTPSTHD-LPE-VSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPT--TDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIE 1008
            MTTE      G+A     +K N    G+VG D +  Q+  KA+ QGF FNI+ +G++GLGKSTL+ TLF+        TP+  + +P+ V +K  +  ++E  VK+KL++I++ GFGDQIN  +C  PV+ YI+ ++EKYL EE+ I R      D+RVH C+YFI  TGH+++ LD+  MK+L   V+I+PVIAKSDT+T  E Q FK KI  ++++  I+IY       D+  R +N ++ +L+PFAVVGS D+  + NG+ +  R+  WG ++I+N  HC+F +LRE+L+R++  DL+E T  VHYE YR  RL E
Sbjct:   19 MTTETPGQDGGVARPPTRVKPNLDAFGYVGIDAVLEQMRRKAMKQGFEFNIMVVGQSGLGKSTLVNTLFKSPVSRKSCTPNHEEKIPKTVEIKSVSHVIEEKGVKMKLTVIDTPGFGDQINNNNCWEPVLKYINDQYEKYLAEEVNITRKKV-IPDSRVHCCIYFIPATGHSLRLLDIEFMKRLGKVVNIVPVIAKSDTLTLEERQAFKKKIREQLETQGISIYPHKEHDEDEEDRSVNNKIRELMPFAVVGS-DKDYLVNGRKTLGRKTKWGIIEIENVAHCEFSQLRELLIRSHTQDLKEVTSCVHYEGYRVLRLSE 335          
BLAST of Septin-2 vs. Ensembl Sea Lamprey
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 248.054 bits (632), Expect = 1.669e-74
Identity = 128/306 (41.83%), Postives = 194/306 (63.40%), Query Frame = 1
Query:  130 IRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNF---DFTPSTHDLPE-VSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTT-DDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNEN 1032
            ++T  + G+VGF  LP Q+  KA  +GF F ++ +GE+G+GKSTL+ ++F+ +    +F   T  + + V ++ S   ++E  V L L+I+++ G+GD IN  +CV PVI +ID +FE YL  E ++ R      D+RVH CLYFIAP+GH +K+LD+  MK+L +KV+IIP++AK+D    +E   FK +IM +I  N I IYQF  T D+   +L  ++ + LP AV+GSN    +  G+    R YPWG  ++DN  HCDF  LR ML+RT+M DL++ T+ VHYE +R  +L  +  +  EN
Sbjct:   25 LQTKPMEGYVGFANLPNQIYRKAAKRGFEFTLMVVGESGVGKSTLINSMFKTDLYSEEFPGPTKRIQKTVKVEQSKVVIREEGVHLTLTIVDTPGYGDFINNSECVQPVIDHIDSQFEDYLNAESRVNRR--PMPDSRVHACLYFIAPSGHGLKALDIEFMKRLHNKVNIIPLVAKADAFLPTECCAFKKQIMKDIHDNNIKIYQFTDTHDEEDNKLLNKIKERLPLAVIGSNVVVDV-GGRRVWGRHYPWGVAEVDNVEHCDFTTLRRMLIRTHMQDLKDVTNNVHYENFRSCKLAALTGNVAEN 327          
BLAST of Septin-2 vs. Ensembl Sea Lamprey
Match: zgc:162239 (zgc:162239 [Source:ZFIN;Acc:ZDB-GENE-070424-28])

HSP 1 Score: 239.965 bits (611), Expect = 4.212e-72
Identity = 120/293 (40.96%), Postives = 179/293 (61.09%), Query Frame = 1
Query:  154 HVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHD---LPEVSLKVSN-------FDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTT----DDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYR 990
            +VGF TLP Q+  K+V +GF F ++  GE+GLGKSTL+ +LF      T   HD   LP    +           +++E  V+L+LS++++ GF D I+  +C  PV+ Y++ +FE Y +EE  + R   N  DTRVH CLYFI+P GH +K LD+  MK L +KV+I+PVIAK+DT+T  E +  K ++  E+  N I IYQFP      DD  +  + ++   +PFAV+G +   +  +G+  R R YPWG  ++D+  HCD  +LR ML+RT+M DL++ T  +HYE +R
Sbjct:   24 YVGFATLPNQVHRKSVKKGFEFTLMVAGESGLGKSTLINSLF-----LTDLYHDRVLLPADGKRCDTTEILRRTLEIEEKGVRLRLSLVDTPGFADAIDNTECWQPVVEYVEEQFESYFREESGLDRK--NLQDTRVHCCLYFISPYGHGLKPLDVEFMKALHNKVNIVPVIAKADTLTMRERETLKRRVQEELSENDIKIYQFPECDSDEDDEFKRQDEELKASIPFAVIGGSAVVEA-SGRRVRGRLYPWGIAEVDSSEHCDLAKLRTMLIRTHMQDLKDVTRDLHYEEHR 308          
BLAST of Septin-2 vs. Ensembl Sea Lamprey
Match: SEPTIN9 (septin 9 [Source:HGNC Symbol;Acc:HGNC:7323])

HSP 1 Score: 210.305 bits (534), Expect = 2.496e-62
Identity = 110/266 (41.35%), Postives = 173/266 (65.04%), Query Frame = 1
Query:  235 GETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFD-----LKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIY---QFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIE 1008
            G++GLGKSTL+ TLF+        T +  E  LK          ++E  VK+KL++I++ GFGDQIN E+C  P++ YI  ++EKYL+EE++I R  +   DTRVH C+Y I P+GH+++ LD+  M+ L   VS++PVI K+DT+T  E   F+ +I  ++ ++ I++Y   +F   D+  R  N ++ + +PFAVVGS+ E +  NG+    R+  WG V+++N NHC+F  LR++L+R++M+DL++ TH + YETYR  RL E
Sbjct:    1 GQSGLGKSTLVNTLFKSRVSRKSCTPNYQERILKTVEIQSVSHVIEERGVKMKLTVIDTPGFGDQINNENCWEPILKYIGEQYEKYLREEVRITRKRH-IPDTRVHCCIYCIPPSGHSLRPLDVEFMQHLSKVVSVVPVITKADTLTLEERHLFRQRIQADLVAHGIDVYPQREF-DEDEQGRLENAEVREKIPFAVVGSDREYQ-ENGRRVLGRKTRWGLVEVENINHCEFALLRDLLIRSHMEDLKDVTHSILYETYRVRRLNE 263          
BLAST of Septin-2 vs. Ensembl Sea Lamprey
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 184.496 bits (467), Expect = 9.336e-54
Identity = 93/215 (43.26%), Postives = 138/215 (64.19%), Query Frame = 1
Query:  145 INGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFT----PSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQM 777
            + G+VGF  LP Q+  K+V +GF F ++ +GE+GLGKSTL+ +LF  +   +    PS      + ++ S   LKEG V+L L+I+++ GFGD ++   C   +I YID + E YL  E ++ R L    D+RVH CLYFI P+GH +K LD+  MK+L  KV+IIP+IAK+D++T  E Q+FK  IM EI  +KI IY+FP  +D   +L+ ++
Sbjct:   13 LEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYASEYPGPSQRVRKTLQVEQSKVVLKEGGVQLTLTIVDTPGFGDAVDNSSCWQSIIDYIDSKCEDYLNAEARVNRRLMP--DSRVHCCLYFIFPSGHQLKPLDIEFMKRLHDKVNIIPLIAKADSLTTEECQQFKKTIMKEILEHKIKIYEFPDVEDDDEKLSKKV 225          
BLAST of Septin-2 vs. Ensembl Yeast
Match: CDC3 (Component of the septin ring that is required for cytokinesis; septins are GTP-binding proteins that assemble with other septins into rod-like complexes that can associate with other rods to form filament polymers; septin rings at the mother-bud neck act as scaffolds for recruiting factors needed for cell division and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000004306])

HSP 1 Score: 237.269 bits (604), Expect = 8.292e-70
Identity = 143/387 (36.95%), Postives = 224/387 (57.88%), Query Frame = 1
Query:  142 KINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLF-----EQNF--DF-------------------TPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKED-CVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFP--TTDDTV-RELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNENM----SLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKK 1200
            +ING+VGF  LP Q   +++  GFSFN+LC+G  G+GK+TLM+TLF     E N   D+                     S     +V +K     ++E  VKL L++I++ GFGD +N +    +P+I  ID  F++YL  E KI R+  N  D R+H CLYFI PTGH +K LDL  M+ +  K ++IPVIAKSD +T  E+  FK  IMN++  + I +++ P  + DD     L+ ++   LP+AV+GSND  +  +G   R R YPWG +++DNDNH DF  L+ +L++  M++L+ERT  + YE YR  +L ++G   + ++          Q+ +     +L + E E++ +F  +V EKE +L++S+ EL A+ + +K+
Sbjct:   95 QINGYVGFANLPKQWHRRSIKNGFSFNLLCVGPDGIGKTTLMKTLFNNDDIEANLVKDYEEELANDQEEEEGQGEGHENQSQEQRHKVKIKSYESVIEENGVKLNLNVIDTEGFGDFLNNDQKSWDPIIKEIDSRFDQYLDAENKINRHSIN--DKRIHACLYFIEPTGHYLKPLDLKFMQSVYEKCNLIPVIAKSDILTDEEILSFKKTIMNQLIQSNIELFKPPIYSNDDAENSHLSERLFSSLPYAVIGSNDIVENYSGNQVRGRSYPWGVIEVDNDNHSDFNLLKNLLIKQFMEELKERTSKILYENYRSSKLAKLGIKQDNSVFKEFDPISKQQEEKTLHEAKLAKLEIEMKTVFQQKVSEKEKKLQKSETELFARHKEMKE 479          
BLAST of Septin-2 vs. Ensembl Yeast
Match: CDC10 (Component of the septin ring, required for cytokinesis; septins are GTP-binding proteins that assemble into rod-like hetero-oligomers that can associate to form filaments; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells; N-terminus interacts with phosphatidylinositol-4,5-bisphosphate; protein abundance increases under DNA damage stress [Source:SGD;Acc:S000000595])

HSP 1 Score: 211.075 bits (536), Expect = 2.559e-62
Identity = 112/304 (36.84%), Postives = 181/304 (59.54%), Query Frame = 1
Query:  151 GHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEV------SLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPT--TDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNENMS 1038
             +VGFDT+  Q+ ++ + +GF FNI+ +G++GLGKSTL+ TLF  +   + +  D+  +       +K+S   L E  V+L +++I++ GFGD I+      P++ YI  +  +YL++E+  +R  +   DTRVH  LYF+ P G  +  LD+ A+K+L    ++IPVI KSDT+T  E  +F+  I NE +     IY + +    D   ELN  +  ++PFAVVGS +E ++ NG+  R R+  W  + +++ N CDF+ LRE L+RT++ DL E T  +HYE +R  +LI +  + N   S
Sbjct:   11 SYVGFDTITNQIEHRLLKKGFQFNIMVVGQSGLGKSTLINTLFASHLIDSATGDDISALPVTKTTEMKISTHTLVEDRVRLNINVIDTPGFGDFIDNSKAWEPIVKYIKEQHSQYLRKELTAQRERF-ITDTRVHAILYFLQPNGKELSRLDVEALKRLTEIANVIPVIGKSDTLTLDERTEFRELIQNEFEKYNFKIYPYDSEELTDEELELNRSVRSIIPFAVVGSENEIEI-NGETFRGRKTRWSAINVEDINQCDFVYLREFLIRTHLQDLIETTSYIHYEGFRARQLIALKENANSRSS 312          
BLAST of Septin-2 vs. Ensembl Yeast
Match: CDC12 (Component of the septin ring that is required for cytokinesis; septins are GTP-binding proteins that assemble into rod-like hetero-oligomers that can associate with other rods to form filaments; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000001149])

HSP 1 Score: 199.519 bits (506), Expect = 3.848e-57
Identity = 125/364 (34.34%), Postives = 210/364 (57.69%), Query Frame = 1
Query:  160 GFDTLP---YQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPE-----VSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFP-------------TTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRV--RQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRL--IEMGFSDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELL 1176
            G   LP   Y++VN+   +G +F ++  GE+GLGK+T + TLF+             E     V + ++   L+E + +L++++I++ GFGD +N      P++ +ID + + Y+++E +  R      D RVH  LYFI PTGH +K +D+  MK+L ++ ++IPVIAK+DT+T  E+Q+FK++I   I++ +I I+  P               D    E   Q+ + +PFA+VGS  E K  NG+ ++V  R+YPWG V+I+ND+HCDF +LR +LLRT + DL   T  +HYETYR+ RL   E     NE+ +L      R+ +     K++E  +++ F  +VK +E + ++ ++ ++
Sbjct:   16 GISNLPNQRYKIVNE---EGGTFTVMLCGESGLGKTTFINTLFQTVLKRADGQQHRQEPIRKTVEIDITRALLEEKHFELRVNVIDTPGFGDNVNNNKAWQPLVDFIDDQHDSYMRQEQQPYRT--KKFDLRVHAVLYFIRPTGHGLKPIDIETMKRLSTRANLIPVIAKADTLTAQELQQFKSRIRQVIEAQEIRIFTPPLDADSKEDAKSGSNPDSAAVEHARQLIEAMPFAIVGS--EKKFDNGQGTQVVARKYPWGLVEIENDSHCDFRKLRALLLRTYLLDLISTTQEMHYETYRRLRLEGHENTGEGNEDFTLPAIAPARKLSHNPRYKEEENALKKYFTDQVKAEEQRFRQWEQNIV 372          
BLAST of Septin-2 vs. Ensembl Yeast
Match: CDC11 (Component of the septin ring that is required for cytokinesis; present at the ends of rod-like septin hetero-oligomers; C-terminal extension is important for recruitment of Bni5p to the mother-bud neck, which in turn is required for Myo1p recruitment and cytokinesis; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000003837])

HSP 1 Score: 184.111 bits (466), Expect = 1.400e-51
Identity = 103/284 (36.27%), Postives = 170/284 (59.86%), Query Frame = 1
Query:  193 KAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLP-------EVSLKVSNFDLKEG-NVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVR----ELNTQMNQLLPFAVVGSNDEAKMPNGKVS--RVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRL 1002
            K + +G +F ++ +G++G G+ST + TL  Q    T +T  LP       ++ L+    +L++   VK++L+II++ GFGD ++       +  YI  ++++ L EE +++RN   + D RVH CLY I PTGH +K +D+  +++L S V+IIPVI+KSD++T+ E++  K  IM +I    + IY FP  +D +     E N  +  LLPFA++GSN+  +M  G V   R R+YPWG + +++ +  DF+ LR  LL +++ DL+  TH + YE YR   L
Sbjct:   15 KHLKRGITFTVMIVGQSGSGRSTFINTLCGQQVVDTSTTILLPTDTSTEIDLQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSPSFEIISDYIRHQYDEILLEESRVRRN-PRFKDGRVHCCLYLINPTGHGLKEIDVEFIRQLGSLVNIIPVISKSDSLTRDELKLNKKLIMEDIDRWNLPIYNFPFDEDEISDEDYETNMYLRTLLPFAIIGSNEVYEM-GGDVGTIRGRKYPWGILDVEDSSISDFVILRNALLISHLHDLKNYTHEILYERYRTEAL 296          
BLAST of Septin-2 vs. Ensembl Yeast
Match: SPR3 (Sporulation-specific homolog of the CDC3/10/11/12 family of genes; septin protein involved in sporulation; regulated by ABFI; the yeast CDC3/10/11/12 family is a family of bud neck microfilament genes [Source:SGD;Acc:S000003291])

HSP 1 Score: 151.369 bits (381), Expect = 2.408e-39
Identity = 97/296 (32.77%), Postives = 153/296 (51.69%), Query Frame = 1
Query:  121 ANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGN-VKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYL-QEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRL 1002
            A EI T      +G   LP Q        G  F ++  G++GLGK+T + +LF  +        + P +  K     + EG+   L  ++I++ GFG+ ++       +++YID E   Y+ QEE   +  +    D RVH CLYF+ P+   + +LD+V MKKL  +V++IPVIAKSD +TK E++ FK ++   I+   I +  F    D V      + Q  PF+++ SN+      G+  + RQY WG V I+N+ +CDF  L++ +   N+ DL E T   +YE  R   L
Sbjct:   78 AQEINTNSHGQDIGIKNLPRQRELLNAKNGIDFTLMVAGQSGLGKTTFINSLFSTSLIDDDIKENKPIIRYK----SIVEGDGTHLNFNVIDTPGFGNNMDNAFTWRTMVNYIDEEIRSYIFQEEQPDRTKMV---DNRVHCCLYFLRPSNKGIDTLDVVTMKKLAKRVNLIPVIAKSDLLTKEELKNFKTQVREIIRVQDIPVCFF--FGDEVLNATQDIFQKYPFSIIASNEYIFNEKGEKVKGRQYKWGAVDIENEKYCDFKILQKTIFDWNLIDLVESTE-DYYEKCRSEML 363          
BLAST of Septin-2 vs. Ensembl Nematostella
Match: EDO37950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE59])

HSP 1 Score: 419.853 bits (1078), Expect = 6.524e-141
Identity = 201/367 (54.77%), Postives = 289/367 (78.75%), Query Frame = 1
Query:   85 LKNMTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSD----NENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKEL 1173
            + +  T+  + L  + R L++ GHVGFD+LP QLVNK+VN+GF+FNILC+GETG+GKSTLM+TLF+  F+  P +H LP V ++   +DL E NV LKL+I+++ G+GDQINKED  + +++YID +F+ YL +E+KIKR +  +HDTR+H CLYFI+PTGH++KSLDLV MK+L+ KV+IIP+IAK+DTI KSE+++FK KIM+E++SN + IY+FP  D+TV E+N+ MN  +PFAVVGS +E  M N   SR R YPWGTV+++N+NHCDF++LREML+RTNM  L ++TH VHYE +R+++L EMGF+D    N++ SLQETY++RR+    + + KEE++RQ F  +VK+KEN+LK++++E+
Sbjct:    1 MASAVTDYCRSLGADGRQLRLAGHVGFDSLPDQLVNKSVNRGFAFNILCIGETGIGKSTLMDTLFQTTFEGQPHSHHLPGVQIEHHTYDLNESNVMLKLTIVDTVGYGDQINKEDSSSSIVNYIDQQFDTYLHQELKIKRTMDTFHDTRIHACLYFISPTGHSLKSLDLVCMKQLDKKVNIIPIIAKADTIAKSELKQFKQKIMDELESNGVEIYRFPVDDETVAEMNSTMNNEIPFAVVGSREEV-MVNKTKSRARVYPWGTVEVENENHCDFVKLREMLIRTNMQSLIDKTHTVHYELFRRNKLEEMGFNDGDANNKSHSLQETYEERRKEYMSQFQDKEEKMRQRFVQKVKDKENELKKAEQEV 366          
BLAST of Septin-2 vs. Ensembl Nematostella
Match: EDO34522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP25])

HSP 1 Score: 276.944 bits (707), Expect = 4.318e-85
Identity = 138/297 (46.46%), Postives = 204/297 (68.69%), Query Frame = 1
Query:  145 INGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTH-DLPE-----VSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPT-TDDTVRELNT-QMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEM 1011
            + G+VGF  LP Q+  K+V +GF F ++ +GE+GLGKSTL+ +LF  +  +TPS++  + E     V +K    +LKEG V+L+L+++++ GFGD ++  DC  PVI YID +FE++L  E +++R+   + D RVH CLYFI+PTGH++K LD+  MKKL +KV+I+PVI+K+DT+T  E  +FK +I+ EI+ N I+IY+FP    +   EL+   M   +PFAVVGSN   ++ NGK  R R YPWG V+++N  HCDF+ LR ML+RT+M DL++ T+  HYE YR  +L  M
Sbjct:    1 MEGYVGFANLPNQVFRKSVKKGFEFTVMVVGESGLGKSTLLNSLFLTDL-YTPSSYPSIKEKLNKTVEVKPCTVELKEGGVRLRLTVVDTPGFGDAVDNTDCWKPVIKYIDSKFEEHLNAESRVQRS--PFPDNRVHCCLYFISPTGHSLKPLDIEFMKKLHNKVNIVPVISKADTLTTEECTRFKKQILQEIKENNISIYEFPDLGGEEDAELDAVNMRDKVPFAVVGSNTVLEV-NGKRVRARVYPWGVVEVENVEHCDFVALRNMLIRTHMQDLKDVTNDAHYENYRCDKLASM 293          
BLAST of Septin-2 vs. Ensembl Nematostella
Match: EDO47409 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLX3])

HSP 1 Score: 255.758 bits (652), Expect = 6.252e-78
Identity = 124/295 (42.03%), Postives = 193/295 (65.42%), Query Frame = 1
Query:  151 GHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNF----DFTPSTHDLPE-VSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRE----LNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIE 1008
             +VGF  LP Q+  K+V +GF F ++ +GE+GLGKSTL+++LF  +        P+   + + V ++ +  +++E  V+L+L+++++ GF D ++      P++ YID +FE YL++E  + R   N  DTRVH CLYFI P GH ++ +D+  MK L +KV+I+PVIAKSD++TK+E+ + K K+++EI  ++I IY FP  D    E    +N  +   LPFAV+GSN   ++   KV R R YPWG  +++N +HCDFI+LR ML+RT+M DL++ T  VHYE YR  RL++
Sbjct:   16 AYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYDDKSIPPAKGRIGQTVHIESNTVEIEEKGVRLRLTVVDTPGFADAVDNTYSWEPIVDYIDHQFESYLRDESGLNRR--NIMDTRVHCCLYFINPHGHGLRPVDVEFMKALHTKVNIVPVIAKSDSLTKTEISRLKRKVLDEIADHEIKIYSFPECDSEDDEEFLAINKDLKASLPFAVIGSNTVIEVKGRKV-RARWYPWGYAEVENPDHCDFIKLRNMLVRTHMQDLKDVTQDVHYENYRAQRLLD 307          
BLAST of Septin-2 vs. Ensembl Nematostella
Match: EDO33106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST61])

HSP 1 Score: 213.386 bits (542), Expect = 1.739e-63
Identity = 111/268 (41.42%), Postives = 168/268 (62.69%), Query Frame = 1
Query:  154 HVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPE-----VSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTD-DTVRELNTQMNQL---LPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLL 930
            +VGF  LP Q+  K+V +GF F ++ +GE+GLGKSTL+++LF  +           E     V ++ S  +++E  VKL+L+++++ G+GD IN ++   P++ Y + +FE YL++E  + R   +  D+RVH C YFIAPTGH +K LD+  MK L   V+I+PVI K+DT+T +E+++ K ++++EI    I IY+ P  D D   E   Q  QL   +PFAVVGSN    +  GK  R R YPWG V+++N  HCDF +LR ML+
Sbjct:    4 YVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYSDRKILSAEERIKKTVKIETSTVEIEERGVKLRLTVVDTPGYGDGINHKNSFKPILDYANNQFESYLKDESGLNRR--HIIDSRVHCCFYFIAPTGHGLKPLDIEFMKALHHIVNIVPVIGKADTLTPTELKEMKRRVLDEIDEYGIQIYELPQCDSDEDEEFIEQTRQLKEGMPFAVVGSNTLIDV-CGKKVRGRLYPWGVVEVENPIHCDFSKLRAMLM 268          
BLAST of Septin-2 vs. Ensembl Nematostella
Match: EDO47975 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKG1])

HSP 1 Score: 173.711 bits (439), Expect = 6.506e-50
Identity = 85/197 (43.15%), Postives = 136/197 (69.04%), Query Frame = 1
Query:  151 GHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHD---LPE-VSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIY 729
            G+VGFDT+  Q+  K++ +GF FN++ +G +GLGKST++ TLF+       ST     +P+ V +K  +  ++E  V+LKL+I ++ GFGDQIN + C  P++ YI+ +++K+L EE+ I+R      D+RVH CLYFIAPTGH +K +D+  MK+L+  V+I+PVIAK+D +T  E + F+ ++  +IQ++ INI+
Sbjct:    1 GYVGFDTVQEQIRRKSLKRGFEFNLMVVGASGLGKSTMVNTLFKGKLSRPTSTGKPTIIPKTVDVKSVSHVIEEKGVRLKLTITDTPGFGDQINNDKCWEPIMDYINSQYDKFLTEEVTIERKP-RIPDSRVHCCLYFIAPTGHRLKPIDVEFMKRLDKCVNIVPVIAKADNMTLEEREAFRRRLREDIQAHNINIH 196          
BLAST of Septin-2 vs. Ensembl Medaka
Match: sept6 (septin 6 [Source:NCBI gene;Acc:101158862])

HSP 1 Score: 433.335 bits (1113), Expect = 9.100e-145
Identity = 238/422 (56.40%), Postives = 323/422 (76.54%), Query Frame = 1
Query:   97 TTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNE----NMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE-------QAKQGNTIKKKK 1329
            +TE+ +      R + ++GHVGFD++P QLVNK+VN GF FNILC+GETGLGKSTLM+TLF   F+  P+ H+ P V+LK + ++L+E NV+LKL+++ + GFGDQINKED    ++ +ID +FE YLQEE+KIKR L++YHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAKSD I+KSE+ KFK KI +E+ SN + IYQFPT D++V E+N+ MN  LPFAVVGS +E K+ N K+ + RQYPWGTVQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF D +      SLQETY+ +R     EL++KEEE+RQMF  RVKEKE +LKE++KEL  KF+ LKK + +EK+KLEE+++ L++++  F+++K   E       QA    T+K+ K
Sbjct:    3 STEIARQAGEGARAVPLSGHVGFDSMPDQLVNKSVNHGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPTQHNQPGVTLKSNTYELQESNVRLKLTMVNTVGFGDQINKEDSYKSIVEFIDAQFEAYLQEELKIKRTLHSYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDESVAEINSTMNSHLPFAVVGSTEEVKIGN-KMVKARQYPWGTVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFMGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEEKKKALDDEVNTFKQKKTAAELLLNQAQQAGGSTTLKRDK 423          
BLAST of Septin-2 vs. Ensembl Medaka
Match: sept10 (septin 10 [Source:NCBI gene;Acc:101166511])

HSP 1 Score: 428.328 bits (1100), Expect = 7.942e-143
Identity = 230/403 (57.07%), Postives = 315/403 (78.16%), Query Frame = 1
Query:   97 TTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNE----NMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE 1293
            +++V +      R L + GHVGFD+LP QLVNK++ QGF FNILC+GETG+GKSTLM+TLF  NF+   S+H  P+V L+   +DL+E NV+L+L+++ + GFGDQ+NK+D   PV+ YID +FE YLQEE+KIKR+L+NYHD+RVH CLYFI+P+GH++KSLDLV MKKL+SKV+IIPVIAK+DTI+KSE+ KFK KIM+E+ SN + IYQFP  D+TV ++NT MN  LPFAVVGS +E  + N K+ + RQYPWG VQ++N+ HCDF++LREML+  NM+DLRE+TH  HYE YR+ +L EMGF D +     +SLQ+TY+ +R+    EL+++E+E+RQ+F  RVKEKE +LKE+++EL ++FE LK+ +AEEK  LEE++R+ EED  +F KRKA  +
Sbjct:    3 SSDVARQPDKGARPLSLAGHVGFDSLPDQLVNKSICQGFCFNILCIGETGIGKSTLMDTLFNTNFENFESSHFEPQVKLRAQTYDLQETNVRLRLTVVNTVGFGDQMNKQDSYQPVVDYIDKQFESYLQEELKIKRSLHNYHDSRVHACLYFISPSGHSLKSLDLVTMKKLDSKVNIIPVIAKADTISKSELHKFKIKIMSELVSNGVQIYQFPLDDETVAKVNTTMNGHLPFAVVGSTEEVCVGN-KMVKARQYPWGVVQVENEQHCDFVKLREMLICVNMEDLREQTHSRHYELYRRCKLEEMGFKDTDPECKPVSLQQTYEAKRQEFLLELQRREDEMRQIFVQRVKEKEAELKEAERELQSRFEQLKRRHAEEKATLEEKKRLFEEDQSSFNKRKAATQ 404          
BLAST of Septin-2 vs. Ensembl Medaka
Match: sept8a (septin-8-A [Source:NCBI gene;Acc:101166488])

HSP 1 Score: 422.165 bits (1084), Expect = 1.618e-140
Identity = 237/405 (58.52%), Postives = 312/405 (77.04%), Query Frame = 1
Query:  127 EIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGNTIKKKK 1329
            E R L + GHVGFD+LP QLV+K+V QGF FNILC+GETG+GKSTLM TLF   F+   ++H    V L+   +DL+E +V LKL+I+++ GFGDQINK++   P++ YID +FE YLQEE+KIKR+L+NYHDTR+H+CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI+KSE+ KFK KIM+E+ SN + IYQFPT D+ V E+N+ MN  LPFAVVGS +E K+ N K  R RQYPWG VQ++N++HCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++ +SLQETY+ +R+    +L++KEEE+RQMF  +VKE E +LKE +KEL  KFE LK+ + EEKRK+EE+RR LEE++  F +RK   E       +KK K
Sbjct:   13 EKRNLSLGGHVGFDSLPDQLVSKSVTQGFCFNILCVGETGIGKSTLMNTLFNTMFENEEASHYQNGVYLRPRTYDLQESSVHLKLTIVDTVGFGDQINKDESYKPIVDYIDTQFENYLQEELKIKRSLFNYHDTRIHICLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMSELVSNGVQIYQFPTDDEAVSEINSSMNAHLPFAVVGSVEEVKVGN-KTVRARQYPWGVVQVENESHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSQPISLQETYEAKRKEFLGDLQRKEEEMRQMFVNKVKETEAELKEKEKELHDKFEHLKRIHQEEKRKVEEKRRDLEEELNTFNRRKMAAETQSLSQPLKKDK 416          
BLAST of Septin-2 vs. Ensembl Medaka
Match: sept8a (septin-8-A [Source:NCBI gene;Acc:101166488])

HSP 1 Score: 421.779 bits (1083), Expect = 1.156e-139
Identity = 237/405 (58.52%), Postives = 312/405 (77.04%), Query Frame = 1
Query:  127 EIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGF----SDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGNTIKKKK 1329
            E R L + GHVGFD+LP QLV+K+V QGF FNILC+GETG+GKSTLM TLF   F+   ++H    V L+   +DL+E +V LKL+I+++ GFGDQINK++   P++ YID +FE YLQEE+KIKR+L+NYHDTR+H+CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAK+DTI+KSE+ KFK KIM+E+ SN + IYQFPT D+ V E+N+ MN  LPFAVVGS +E K+ N K  R RQYPWG VQ++N++HCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF     D++ +SLQETY+ +R+    +L++KEEE+RQMF  +VKE E +LKE +KEL  KFE LK+ + EEKRK+EE+RR LEE++  F +RK   E       +KK K
Sbjct:   13 EKRNLSLGGHVGFDSLPDQLVSKSVTQGFCFNILCVGETGIGKSTLMNTLFNTMFENEEASHYQNGVYLRPRTYDLQESSVHLKLTIVDTVGFGDQINKDESYKPIVDYIDTQFENYLQEELKIKRSLFNYHDTRIHICLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMSELVSNGVQIYQFPTDDEAVSEINSSMNAHLPFAVVGSVEEVKVGN-KTVRARQYPWGVVQVENESHCDFVKLREMLIRVNMEDLREQTHARHYELYRRCKLEEMGFKDTDPDSQPISLQETYEAKRKEFLGDLQRKEEEMRQMFVNKVKETEAELKEKEKELHDKFEHLKRIHQEEKRKVEEKRRDLEEELNTFNRRKMAAETQSLSQPLKKDK 416          
BLAST of Septin-2 vs. Ensembl Medaka
Match: sept6 (septin 6 [Source:NCBI gene;Acc:101158862])

HSP 1 Score: 409.453 bits (1051), Expect = 5.741e-136
Identity = 229/397 (57.68%), Postives = 307/397 (77.33%), Query Frame = 1
Query:  172 LPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNE----NMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVE-------QAKQGNTIKKKK 1329
            +P QLVNK+VN GF FNILC+GETGLGKSTLM+TLF   F+  P+ H+ P V+LK + ++L+E NV+LKL+++ + GFGDQINKED    ++ +ID +FE YLQEE+KIKR L++YHDTR+H CLYFIAPTGH++KSLDLV MKKL+SKV+IIP+IAKSD I+KSE+ KFK KI +E+ SN + IYQFPT D++V E+N+ MN  LPFAVVGS +E K+ N K+ + RQYPWGTVQ++N+NHCDF++LREML+R NM+DLRE+TH  HYE YR+ +L EMGF D +      SLQETY+ +R     EL++KEEE+RQMF  RVKEKE +LKE++KEL  KF+ LKK + +EK+KLEE+++ L++++  F+++K   E       QA    T+K+ K
Sbjct:    1 MPDQLVNKSVNHGFCFNILCVGETGLGKSTLMDTLFNTKFEGEPTQHNQPGVTLKSNTYELQESNVRLKLTMVNTVGFGDQINKEDSYKSIVEFIDAQFEAYLQEELKIKRTLHSYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKSDAISKSELAKFKIKITSELVSNGVQIYQFPTDDESVAEINSTMNSHLPFAVVGSTEEVKIGN-KMVKARQYPWGTVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFMGELQKKEEEMRQMFVQRVKEKEAELKEAEKELHEKFDRLKKLHQDEKKKLEEKKKALDDEVNTFKQKKTAAELLLNQAQQAGGSTTLKRDK 396          
BLAST of Septin-2 vs. Planmine SMEST
Match: SMESG000008815.1 (SMESG000008815.1)

HSP 1 Score: 770.385 bits (1988), Expect = 0.000e+0
Identity = 412/412 (100.00%), Postives = 412/412 (100.00%), Query Frame = 1
Query:   94 MTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNENMSLXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAXXXXXXXXXXXXXXXDIGNFEKRKAIVEQAKQGNTIKKKK 1329
            MTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNENMSLQETYQQRRETQTKELKQKEEEIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAEEKRKLEERRRILEEDIGNFEKRKAIVEQAKQGNTIKKKK
Sbjct:    1 MTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNENMSLQETYQQRRETQTKELKQKEEEIRQMFFMRVKEKENQLKESDKELLAKFESLKKSNAEEKRKLEERRRILEEDIGNFEKRKAIVEQAKQGNTIKKKK 412          
BLAST of Septin-2 vs. Planmine SMEST
Match: SMESG000076922.1 (SMESG000076922.1)

HSP 1 Score: 239.195 bits (609), Expect = 1.571e-70
Identity = 122/301 (40.53%), Postives = 189/301 (62.79%), Query Frame = 1
Query:  136 TLKINGH-------VGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFTP---STHDLPEVSLKVSN--FDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTT----DDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYR 990
            T++ NG        +GF  LP Q+  KAV +GF+F ++ +GE+GLGKST + +L  Q+    P   S+ D+   + K+     +L E  VKL+L+I+++ GFGD ++  +C  P++ YID  F +Y ++E  I R   N  D RVH CLYFI+PTGH +K +D+  MK L  KV+I+P+IAK+D++T+SE++ FK K+M++++  +IN YQ P      +D  R  + ++   LPF+VVGSN      +G+  R RQY WG  +++N  HC+F  LR  +LRT+M DL++ T+ + YE YR
Sbjct:   34 TIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDSSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRK--NIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 332          
BLAST of Septin-2 vs. Planmine SMEST
Match: SMESG000048968.1 (SMESG000048968.1)

HSP 1 Score: 230.72 bits (587), Expect = 9.913e-68
Identity = 114/293 (38.91%), Postives = 185/293 (63.14%), Query Frame = 1
Query:  157 VGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNF----DFTPSTHDLPEVSLKVSNF-DLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTTDD----TVRELNTQMNQLLPFAVVGSNDEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIE 1008
            +GF  +P Q+  KAV +GF+F+I+ +GE+GLGKST + +L   +     +  P+   +   +  V  F +L E  VKL+L+II++ GF D +N  +C  P+  YI+  F++Y +EE  + R   N  D R+H CLYF+ P G  +K LD+  +K+L+ K++IIPVI K+D++T  E++K K KI+N+I+  ++++Y+ P  +     ++R L++++   LPF+++GS D      G   R RQY WGT +++N+ HCDF RLR  LL+T+M DL++ T  V YE YR + + E
Sbjct:   41 LGFGQIPDQMHRKAVKKGFNFSIMVVGESGLGKSTFVNSLLMTDLYKDREILPAFESIAVTTKIVKRFIELDEKGVKLRLTIIDTPGFNDAVNCYNCWKPIEDYINDTFDQYFKEECGLNRK--NIQDNRIHCCLYFVNPFGRGLKPLDVEVIKRLQCKINIIPVIGKADSLTADELKKLKQKILNDIERYQLDVYRLPECESDEEASIRTLDSEIKACLPFSIIGSPDIIDNTRGPKIRGRQYIWGTSEVENNKHCDFSRLRLFLLKTHMQDLKDMTSDVLYENYRANCITE 331          
BLAST of Septin-2 vs. Planmine SMEST
Match: SMESG000064397.1 (SMESG000064397.1)

HSP 1 Score: 224.557 bits (571), Expect = 9.288e-65
Identity = 134/367 (36.51%), Postives = 219/367 (59.67%), Query Frame = 1
Query:  157 VGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFT----PSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTT---------DDTVRELNTQMNQLLPFAVVGSN---DEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNENMS----LXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLK 1197
            +GF +L  Q+  +A  +GF FN++ +G +GLGKST + +L   +F  T    PS      V ++ +   LKE +V LKL ++++ GFGD ++   C +P+I YID  F++++  E K+ R ++   D R+H C+YFI PTGH +K LD+  MK++  KV+IIPVI KSDT+T  E + FK  ++N++  +KI IY FP +         D  V +L  +  + +PF+V+GSN   D+    NGK  R R+YPWG V+++N  H DF+ L+ M++RT++ DL++ T    YE YR  ++ ++    N N+S         +  +  Q   +K+ EEE++Q+F  + +E+  +LKES+ +L  + E +K
Sbjct:   60 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVALKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIF--PDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLK-KCREKIPFSVIGSNIFIDK----NGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMK 419          
BLAST of Septin-2 vs. Planmine SMEST
Match: SMESG000064397.1 (SMESG000064397.1)

HSP 1 Score: 224.557 bits (571), Expect = 1.295e-64
Identity = 134/367 (36.51%), Postives = 219/367 (59.67%), Query Frame = 1
Query:  157 VGFDTLPYQLVNKAVNQGFSFNILCLGETGLGKSTLMETLFEQNFDFT----PSTHDLPEVSLKVSNFDLKEGNVKLKLSIIESCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVCLYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKIMNEIQSNKINIYQFPTT---------DDTVRELNTQMNQLLPFAVVGSN---DEAKMPNGKVSRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRKHRLIEMGFSDNENMS----LXXXXXXXXXXXXXXXXXXXXXIRQMFFMRVKEKENQLKESDKELLAKFESLK 1197
            +GF +L  Q+  +A  +GF FN++ +G +GLGKST + +L   +F  T    PS      V ++ +   LKE +V LKL ++++ GFGD ++   C +P+I YID  F++++  E K+ R ++   D R+H C+YFI PTGH +K LD+  MK++  KV+IIPVI KSDT+T  E + FK  ++N++  +KI IY FP +         D  V +L  +  + +PF+V+GSN   D+    NGK  R R+YPWG V+++N  H DF+ L+ M++RT++ DL++ T    YE YR  ++ ++    N N+S         +  +  Q   +K+ EEE++Q+F  + +E+  +LKES+ +L  + E +K
Sbjct:   75 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVALKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIF--PDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLK-KCREKIPFSVIGSNIFIDK----NGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMK 434          
The following BLAST results are available for this feature:
BLAST of Septin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEPTIN102.727e-15158.66septin 10 [Source:HGNC Symbol;Acc:HGNC:14349][more]
SEPTIN104.130e-15059.44septin 10 [Source:HGNC Symbol;Acc:HGNC:14349][more]
SEPTIN105.211e-15059.44septin 10 [Source:HGNC Symbol;Acc:HGNC:14349][more]
SEPTIN103.487e-14959.44septin 10 [Source:HGNC Symbol;Acc:HGNC:14349][more]
SEPTIN101.594e-14859.44septin 10 [Source:HGNC Symbol;Acc:HGNC:14349][more]
back to top
BLAST of Septin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
unc-611.349e-11951.95pep chromosome:WBcel235:V:14731095:14733877:-1 gen... [more]
unc-611.380e-11951.95pep chromosome:WBcel235:V:14731095:14733877:-1 gen... [more]
unc-616.169e-11951.95pep chromosome:WBcel235:V:14731136:14734237:-1 gen... [more]
unc-594.764e-6338.68pep chromosome:WBcel235:I:13629227:13633494:1 gene... [more]
back to top
BLAST of Septin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sep22.827e-15760.40gene:FBgn0014029 transcript:FBtr0083945[more]
Sep53.692e-14356.59gene:FBgn0026361 transcript:FBtr0088877[more]
Sep53.692e-14356.59gene:FBgn0026361 transcript:FBtr0088876[more]
Sep21.343e-12958.77gene:FBgn0014029 transcript:FBtr0334579[more]
pnut5.713e-8440.11gene:FBgn0013726 transcript:FBtr0088792[more]
back to top
BLAST of Septin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept8b6.301e-15156.97septin 8b [Source:NCBI gene;Acc:571702][more]
sept106.837e-15057.28septin 10 [Source:ZFIN;Acc:ZDB-GENE-050417-3][more]
sept8a2.039e-14758.52septin 8a [Source:NCBI gene;Acc:321590][more]
sept61.280e-14458.06septin 6 [Source:ZFIN;Acc:ZDB-GENE-030131-1414][more]
sept61.308e-14458.06septin 6 [Source:ZFIN;Acc:ZDB-GENE-030131-1414][more]
back to top
BLAST of Septin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rag13.573e-14959.95recombination activating gene 1 [Source:Xenbase;Ac... [more]
rag11.296e-14859.65recombination activating gene 1 [Source:Xenbase;Ac... [more]
rag14.599e-14859.95recombination activating gene 1 [Source:Xenbase;Ac... [more]
rag15.574e-14860.46recombination activating gene 1 [Source:Xenbase;Ac... [more]
rag16.841e-14860.46recombination activating gene 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of Septin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sept119.476e-14859.50septin 11 [Source:MGI Symbol;Acc:MGI:1277214][more]
Sept111.044e-14759.50septin 11 [Source:MGI Symbol;Acc:MGI:1277214][more]
Sept111.159e-14759.50septin 11 [Source:MGI Symbol;Acc:MGI:1277214][more]
Sept111.930e-14759.50septin 11 [Source:MGI Symbol;Acc:MGI:1277214][more]
Sept111.954e-14759.50septin 11 [Source:MGI Symbol;Acc:MGI:1277214][more]
back to top
BLAST of Septin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P54359|SEPT2_DROME2.834e-15660.40Septin-2 OS=Drosophila melanogaster OX=7227 GN=Sep... [more]
sp|A4FUM1|SEP8B_DANRE1.145e-15057.21Septin-8-B OS=Danio rerio OX=7955 GN=sept8b PE=2 S... [more]
sp|Q9P0V9|SEP10_HUMAN2.503e-14959.44Septin-10 OS=Homo sapiens OX=9606 GN=SEPTIN10 PE=1... [more]
sp|Q2KJB1|SEP10_BOVIN6.737e-14959.34Septin-10 OS=Bos taurus OX=9913 GN=SEPTIN10 PE=2 S... [more]
sp|Q6AXA6|SEP8A_XENLA4.211e-14856.64Septin-8-A OS=Xenopus laevis OX=8355 GN=sept8-a PE... [more]
back to top
BLAST of Septin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RBQ80.000e+071.57Septin-2 OS=Fasciola hepatica OX=6192 GN=D915_0056... [more]
G4VFI80.000e+069.98Putative septin OS=Schistosoma mansoni OX=6183 GN=... [more]
Q5DDA50.000e+069.98SJCHGC01523 protein OS=Schistosoma japonicum OX=61... [more]
A0A3Q0KDV90.000e+069.73Putative septin; Septin-10 OS=Schistosoma mansoni ... [more]
A0A504YUL90.000e+069.93Septin-2 OS=Fasciola gigantica OX=46835 GN=FGIG_01... [more]
back to top
BLAST of Septin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept8a5.635e-15058.48septin-8-A [Source:NCBI gene;Acc:103023804][more]
sept8a7.157e-14958.48septin-8-A [Source:NCBI gene;Acc:103023804][more]
sept8a1.884e-14859.80septin-8-A [Source:NCBI gene;Acc:103023804][more]
sept8b4.288e-14755.29septin-8-A [Source:NCBI gene;Acc:103040455][more]
sept106.494e-14757.54septin-10 [Source:NCBI gene;Acc:103044988][more]
back to top
BLAST of Septin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEPTIN96.088e-7643.57septin 9 [Source:HGNC Symbol;Acc:HGNC:7323][more]
SEPTIN71.669e-7441.83septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
zgc:1622394.212e-7240.96zgc:162239 [Source:ZFIN;Acc:ZDB-GENE-070424-28][more]
SEPTIN92.496e-6241.35septin 9 [Source:HGNC Symbol;Acc:HGNC:7323][more]
SEPTIN79.336e-5443.26septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
back to top
BLAST of Septin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC38.292e-7036.95Component of the septin ring that is required for ... [more]
CDC102.559e-6236.84Component of the septin ring, required for cytokin... [more]
CDC123.848e-5734.34Component of the septin ring that is required for ... [more]
CDC111.400e-5136.27Component of the septin ring that is required for ... [more]
SPR32.408e-3932.77Sporulation-specific homolog of the CDC3/10/11/12 ... [more]
back to top
BLAST of Septin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO379506.524e-14154.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345224.318e-8546.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474096.252e-7842.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331061.739e-6341.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479756.506e-5043.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Septin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept69.100e-14556.40septin 6 [Source:NCBI gene;Acc:101158862][more]
sept107.942e-14357.07septin 10 [Source:NCBI gene;Acc:101166511][more]
sept8a1.618e-14058.52septin-8-A [Source:NCBI gene;Acc:101166488][more]
sept8a1.156e-13958.52septin-8-A [Source:NCBI gene;Acc:101166488][more]
sept65.741e-13657.68septin 6 [Source:NCBI gene;Acc:101158862][more]
back to top
BLAST of Septin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008815.10.000e+0100.00SMESG000008815.1[more]
SMESG000076922.11.571e-7040.53SMESG000076922.1[more]
SMESG000048968.19.913e-6838.91SMESG000048968.1[more]
SMESG000064397.19.288e-6536.51SMESG000064397.1[more]
SMESG000064397.11.295e-6436.51SMESG000064397.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013132 ID=SMED30013132|Name=Septin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2406bp
CAGGGTCTAAGCTAAGGTTGTTTATTTGTTTTAAATAGAACTTTGAATCA
TTATTTTAATATTAATAATTTCTATTAGTAAACATTAAAAAATATGACTA
CTGAAGTTGTCAAAGGACTTGCCAATGAAATTCGAACTTTAAAAATAAAT
GGCCATGTAGGATTTGATACGCTACCCTATCAGTTAGTGAACAAAGCTGT
CAACCAAGGATTTTCTTTTAATATTCTATGTTTAGGTGAAACTGGTTTGG
GTAAATCAACTTTAATGGAAACTTTGTTTGAACAAAACTTCGATTTTACA
CCATCTACCCACGATTTGCCAGAAGTATCTCTAAAAGTTTCAAATTTCGA
TTTGAAGGAAGGCAATGTAAAATTAAAGTTATCAATAATTGAAAGCTGTG
GATTCGGCGATCAAATAAATAAAGAGGATTGTGTTAATCCTGTCATTTCA
TATATTGATGGAGAATTTGAAAAATATTTACAAGAAGAAATGAAAATAAA
GCGAAACCTTTACAATTACCATGATACTCGAGTTCATGTATGTCTGTATT
TTATTGCACCAACTGGCCATACTATGAAATCTTTGGATTTGGTAGCAATG
AAGAAGTTAGAAAGCAAAGTCAGTATAATTCCTGTGATTGCAAAATCAGA
CACGATTACGAAATCTGAAATGCAAAAATTTAAAGCTAAAATCATGAATG
AAATCCAATCAAACAAAATAAATATTTATCAATTCCCCACTACTGATGAC
ACCGTTCGGGAACTGAATACTCAAATGAATCAATTGCTTCCGTTTGCTGT
AGTTGGAAGCAATGATGAAGCCAAAATGCCTAACGGAAAAGTCTCTCGTG
TCCGCCAGTATCCCTGGGGTACTGTCCAAATCGATAATGATAATCACTGT
GATTTCATTCGACTGCGAGAAATGCTGCTGAGAACGAATATGGACGATTT
GCGAGAACGAACTCATCTCGTACATTACGAAACCTACAGAAAACATAGGC
TAATTGAAATGGGTTTCAGTGACAATGAGAATATGTCGCTCCAGGAGACC
TATCAACAGCGCCGAGAAACTCAAACCAAAGAACTCAAGCAAAAGGAAGA
AGAGATTCGACAAATGTTTTTCATGAGAGTAAAAGAAAAAGAAAATCAAT
TGAAAGAATCGGATAAAGAGTTGCTGGCGAAATTTGAATCGCTGAAAAAG
TCAAATGCTGAGGAGAAAAGAAAATTGGAAGAACGACGAAGAATTCTCGA
AGAAGATATTGGTAATTTTGAGAAAAGAAAGGCAATAGTCGAGCAAGCCA
AACAAGGCAACACCATCAAGAAGAAGAAATAATATATTGATTTTGTATTT
TGATAATTTTATTTGAATCTTGTTCTGTCAATTTTTTATGAATTTACTTT
CTGTGCTTATTGTTGAGATTATTACGGTGTATACATTTTATTATTGGATG
CTCCAATTAATGATTATGGCGATTGTTCTGTCTACTGACTAATTTGTCAG
CTACTGTACATCTTTTCAGTATTGACACATTTCTCGTGTTTTTGATTTTT
TTTATCGTGACTTATTCACATATTCTAATTTTGAATTTGTACTAGGGTAA
ACTTTAGGATTGGAATATAGTGATTTATGAAATATTCGAATTAAATAGGT
AAAATCTGAAATAATTATGTTGGTATAGGCGTAGATGCAATACTAGTCAC
AATATCAATAGAAATCTACTGCTTATATTTATATAATTCAGATTGGTATT
TATGAGTCAACGTTATACCGAGTTAGGGGCCGCCTATGAATGACGTCACG
CGATTGTTTAACCCCTCGTCACAAATCTTTGTTCCTCTCTTTAAAAGCCT
TATTTCATATTTGAAAATGAACATGTTTCAAATCACTTTTCAGTATGTAT
TTAGTGCAGGGGTCGGCAATCTTTTCCAATGCCAGAGCTACTTTTTAAAA
TCATGCGGCTTCAAGATCGACCTCTTATTTTAGAAAAAATACAGAAATAT
AACATTTATTAAAACAATTAATGTGATGAACGGAATTGTTTTTCATCCAA
TAGTTTCTTCATATCTCGAGAATCGTTTGTAACAGGCAATCTTAAACAAT
TATCCAGGTTTTCATTGGTAAGTTTTGTTCGATATTTATTCTTTATGAAT
TTCATATTTGAAAATACGGATTTTTAGCGTAACTTTTTAAAAAATTTTTA
AATTCACAAAAATATTTTTATACACAAAAAAAATTCTTCAAGTACTCCGC
GATTGACGTCGAAATCGTTCGCGATCCACCATTTGCCGACCTTTGACTTA
GTTTAATGCTGCAGTAATATCGTATGAGAAAACACGTATTAAAAAGGAGG
CCCTTAAAAGCTGAAATTAGTATTAAATTATGTTGAAAAAATACAAAATT
TAAGAT
back to top

protein sequence of SMED30013132-orf-1

>SMED30013132-orf-1 ID=SMED30013132-orf-1|Name=SMED30013132-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=413bp
MTTEVVKGLANEIRTLKINGHVGFDTLPYQLVNKAVNQGFSFNILCLGET
GLGKSTLMETLFEQNFDFTPSTHDLPEVSLKVSNFDLKEGNVKLKLSIIE
SCGFGDQINKEDCVNPVISYIDGEFEKYLQEEMKIKRNLYNYHDTRVHVC
LYFIAPTGHTMKSLDLVAMKKLESKVSIIPVIAKSDTITKSEMQKFKAKI
MNEIQSNKINIYQFPTTDDTVRELNTQMNQLLPFAVVGSNDEAKMPNGKV
SRVRQYPWGTVQIDNDNHCDFIRLREMLLRTNMDDLRERTHLVHYETYRK
HRLIEMGFSDNENMSLQETYQQRRETQTKELKQKEEEIRQMFFMRVKEKE
NQLKESDKELLAKFESLKKSNAEEKRKLEERRRILEEDIGNFEKRKAIVE
QAKQGNTIKKKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR012317Poly(ADP-ribose)pol_cat_dom
IPR030379G_SEPTIN_dom
IPR027417P-loop_NTPase
IPR016491Septin
Vocabulary: molecular function
TermDefinition
GO:0003950NAD+ ADP-ribosyltransferase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 317..337
NoneNo IPR availableCOILSCoilCoilcoord: 361..395
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 16..307
e-value: 3.2E-110
score: 369.8
NoneNo IPR availablePANTHERPTHR18884SEPTINcoord: 3..402
NoneNo IPR availablePANTHERPTHR18884:SF54SEPTIN-8coord: 3..402
IPR016491SeptinPIRSFPIRSF006698Septincoord: 3..412
e-value: 1.4E-130
score: 433.4
IPR016491SeptinCDDcd01850CDC_Septincoord: 38..307
e-value: 5.7439E-130
score: 373.419
IPR030379Septin-type guanine nucleotide-binding (G) domainPFAMPF00735Septincoord: 38..307
e-value: 1.7E-95
score: 319.6
IPR030379Septin-type guanine nucleotide-binding (G) domainPROSITEPS51719G_SEPTINcoord: 38..305
score: 93.908
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 23..278