protein PLANT CADMIUM RESISTANCE 2-like

Overview
Nameprotein PLANT CADMIUM RESISTANCE 2-like
Smed IDSMED30013131
Length (bp)339
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protein PLANT CADMIUM RESISTANCE 2-like (SMED30013131) t-SNE clustered cells

Violin plots show distribution of expression levels for protein PLANT CADMIUM RESISTANCE 2-like (SMED30013131) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protein PLANT CADMIUM RESISTANCE 2-like (SMED30013131) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protein PLANT CADMIUM RESISTANCE 2-like (SMED30013131) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013131

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013131 dd_Smed_v4_4778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30013131 dd_Smed_v4_4778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30013131 dd_Smed_v4_4778_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013131 dd_Smed_v4_4778_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30013131 dd_Smed_v4_4778_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. TrEMBL
Match: A0A1I8GYB9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.700e-12
Identity = 34/80 (42.50%), Postives = 51/80 (63.75%), Query Frame = 2
Query:   11 PSVLTNQLTMGQWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFNCLVSXXXXXXXXXXXXXXXRTKVRSRAHIGGS 250
            P+      +M  + HGLCGCF+DCG CI+ + +PCY  GK+AEAVG +C++  + F F   C+ + +R K+R +  I GS
Sbjct:   27 PATHEGPRSMADFKHGLCGCFDDCGLCIITYFVPCYTFGKNAEAVGDSCVLCGLAFLFVSPCVGAIVRGKIREKQGINGS 106          
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. TrEMBL
Match: A0A1I8GZL5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033858g1 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.477e-11
Identity = 45/97 (46.39%), Postives = 59/97 (60.82%), Query Frame = 2
Query:   38 MGQWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFNCLVSXXXXXXXXXXXXXXXRTKVRSRAHIGGSXXXXXXXXXXXXXXVIAQFHQEILAM 328
            M Q+ HGLCGCF+DCG CI+A+ +PCY  GK AEAVG +C++  I + F   C+ + IR KVR +  I G    D    L CP C + Q  QE+  M
Sbjct:    1 MSQYRHGLCGCFDDCGICIVAYFLPCYTHGKTAEAVGDSCVLCAIGYLFVAPCVGAVIRGKVRDKQGIAGGFVGDFFTYLCCPLCALVQDAQEVKDM 97          
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. TrEMBL
Match: A0A267F6N5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018526g1 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.944e-11
Identity = 42/97 (43.30%), Postives = 60/97 (61.86%), Query Frame = 2
Query:   38 MGQWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFNCLVSXXXXXXXXXXXXXXXRTKVRSRAHIGGSXXXXXXXXXXXXXXVIAQFHQEILAM 328
            M  + HGLCGCF+DCG CI+ + +PCY  GK+AEAVG +C++  + F F   C+ + +R K+R +  I GS   D  + L CP C + Q  QE+  M
Sbjct:    1 MADFKHGLCGCFDDCGLCIITYFVPCYTFGKNAEAVGDSCVLCGLAFLFVSPCVGAIVRGKIREKQGINGSFIGDFFVHLCCPLCALVQDAQEVKEM 97          
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. TrEMBL
Match: A0A1I8HVT9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016327g1 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.995e-11
Identity = 32/72 (44.44%), Postives = 47/72 (65.28%), Query Frame = 2
Query:   38 MGQWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFNCLV-SXXXXXXXXXXXXXXXRTKVRSRAHIGGS 250
            MG++ HGLCGCF+DCG CI+ + +PCY  GK+AEAVG +C++ +  +       +   +R K+R R  I GS
Sbjct:    1 MGEFQHGLCGCFDDCGLCIITYFVPCYTFGKNAEAVGDSCMLCALGMACGLGFILGPIVRGKIRERQGIDGS 72          
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. TrEMBL
Match: A0A1I8FPH0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 5.842e-10
Identity = 25/42 (59.52%), Postives = 35/42 (83.33%), Query Frame = 2
Query:   38 MGQWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFNCLV 163
            MG++ HGLCGCF+DCG CI+ + +PCY  GK+AEAVG +C++
Sbjct:    1 MGEFQHGLCGCFDDCGLCIITYFVPCYTFGKNAEAVGDSCML 42          
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Nematostella
Match: EDO50068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFB0])

HSP 1 Score: 57.3806 bits (137), Expect = 4.248e-12
Identity = 31/71 (43.66%), Postives = 43/71 (60.56%), Query Frame = 2
Query:   44 QWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFNCLVS--XXXXXXXXXXXXXXXRTKVRSRAHIGGS 250
             W +GL GCFNDCGTC++ +  PCY  GK+AEAVG +CL+             ++S +R K+R +  I GS
Sbjct:    4 DWNNGLFGCFNDCGTCLITYIAPCYTFGKNAEAVGDSCLLCGLAFFVPVVDLIVMSSVRGKIREQHGISGS 74          
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Nematostella
Match: EDO36116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJK5])

HSP 1 Score: 53.9138 bits (128), Expect = 1.008e-10
Identity = 32/73 (43.84%), Postives = 43/73 (58.90%), Query Frame = 2
Query:   38 MGQWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFNCLVSXXXXXX--XXXXXXXXXRTKVRSRAHIGGS 250
            MGQ+ +GL GCF+D   C+  +C+PCY  GK AEAVG +CL+  I+           + IR KVR +  I GS
Sbjct:    1 MGQFSNGLFGCFSDIPLCLTTYCVPCYTFGKTAEAVGEDCLMCGIVLMVPCANIWFATQIRGKVREQKGIEGS 73          
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Nematostella
Match: EDO44794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR8])

HSP 1 Score: 48.9062 bits (115), Expect = 7.259e-9
Identity = 21/40 (52.50%), Postives = 26/40 (65.00%), Query Frame = 2
Query:   44 QWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFNCLV 163
             W  G+CGCF D  TC L +  PC + GK+AEAVG NC +
Sbjct:    2 SWSSGICGCFEDINTCALTYFCPCVVAGKNAEAVGENCFL 41          
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Planmine SMEST
Match: SMESG000023846.1 (SMESG000023846.1)

HSP 1 Score: 85.8853 bits (211), Expect = 5.845e-23
Identity = 52/100 (52.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:   38 MGQWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFNCLVSXXXXXXXXXXXXXXXRTKVRSRAHIGGSXXXXXXXXXXXXXXVIAQFHQEILAMRST 337
            M +W HGLCGCF+DCGTC+L++ +PCYLVGKDAEAVG +C +  + +     C+ + +R KVR +  I G+ C DL+ S  CPCC +AQ HQE+LAM + 
Sbjct:    1 MAEWQHGLCGCFSDCGTCLLSYFVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVGAIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAA 100          
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Planmine SMEST
Match: SMESG000023831.1 (SMESG000023831.1)

HSP 1 Score: 69.707 bits (169), Expect = 1.065e-16
Identity = 54/100 (54.00%), Postives = 65/100 (65.00%), Query Frame = 2
Query:   38 MGQWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFNCLVSXXXXXXXXXXXXXXXRTKVRSRAHIGGSXXXXXXXXXXXXXXVIAQFHQEILAMRST 337
            M  W  G+CGCF D GTC+LA+  PCYLVG DAE V  NC++ CI F FFP CI   IR KVRS+ +I G  C D ++SL  PCC +AQ H E+  M  T
Sbjct:    1 MSDWQQGICGCFGDLGTCVLAYFAPCYLVGLDAETVDKNCVLCCIAFLFFPPCITCHIRGKVRSKRNIPGGSCNDCVVSLFLPCCTVAQMHHEVKHMSGT 100          
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Planmine SMEST
Match: SMESG000023836.1 (SMESG000023836.1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.724e-15
Identity = 47/100 (47.00%), Postives = 65/100 (65.00%), Query Frame = 2
Query:   38 MGQWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFNCLVSXXXXXXXXXXXXXXXRTKVRSRAHIGGSXXXXXXXXXXXXXXVIAQFHQEILAMRST 337
            M +W  G+CGCF D GTC+L++ +PCYL+G DAEAV  +C++  +I  FFP CII  +R K+R + +I G CC D L S    CC +AQ H E+  M+  
Sbjct:    1 MSEWQQGICGCFGDIGTCLLSYFVPCYLIGLDAEAVDNSCILCGVISIFFPPCIICYVRGKIREKQNIDGGCCTDCLCSFFLGCCAVAQMHHEVKHMQGN 100          
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Planmine SMEST
Match: SMESG000060403.1 (SMESG000060403.1)

HSP 1 Score: 65.0846 bits (157), Expect = 9.874e-15
Identity = 44/96 (45.83%), Postives = 52/96 (54.17%), Query Frame = 2
Query:   44 QWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFN-CLVSXXXXXXXXXXXXXXXRTKVRSRAHIGGSXXXXXXXXXXXXXXVIAQFHQEILAM 328
             W HGLC CF+DCG C++A   PCY VG DAEAVG N CL    +        +  IR+ +R R  I GS C D  +   CPCC  AQ HQE    
Sbjct:   10 DWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVFFWCPCCTTAQMHQETYEF 105          
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Planmine SMEST
Match: SMESG000023842.1 (SMESG000023842.1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.800e-14
Identity = 54/97 (55.67%), Postives = 70/97 (72.16%), Query Frame = 2
Query:   38 MGQWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGFNCLVSXXXXXXXXXXXXXXXRTKVRSRAHIGGSXXXXXXXXXXXXXXVIAQFHQEILAM 328
            MG+W HGLCGC +DCGTC+L + +PCYL+GKDAEAVG +C +      F   CII+ +R+KVR R +I GS   DLL +  C CCV+AQ HQE++AM
Sbjct:    1 MGEWEHGLCGCCDDCGTCLLTYFVPCYLIGKDAEAVGDSCFLCGCGSLFAGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAM 97          
The following BLAST results are available for this feature:
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GYB96.700e-1242.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GZL51.477e-1146.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F6N52.944e-1143.30Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HVT93.995e-1144.44Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FPH05.842e-1059.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO500684.248e-1243.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361161.008e-1043.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447947.259e-952.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein PLANT CADMIUM RESISTANCE 2-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023846.15.845e-2352.00SMESG000023846.1[more]
SMESG000023831.11.065e-1654.00SMESG000023831.1[more]
SMESG000023836.11.724e-1547.00SMESG000023836.1[more]
SMESG000060403.19.874e-1545.83SMESG000060403.1[more]
SMESG000023842.13.800e-1455.67SMESG000023842.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013131 ID=SMED30013131|Name=protein PLANT CADMIUM RESISTANCE 2-like|organism=Schmidtea mediterranea sexual|type=transcript|length=339bp
GTTGAAAATACCGTCAGTTTTGACAAACCAATTAACAATGGGTCAATGGC
TCCATGGACTCTGTGGATGTTTCAATGACTGTGGGACTTGCATCTTGGCA
CATTGTATCCCATGCTATTTGGTAGGAAAAGATGCTGAGGCAGTAGGATT
CAATTGTCTTGTATCTTGTATTATATTCTTCTTTTTTCCAACTTGCATCA
TTTCCTGCATTCGGACCAAAGTAAGAAGTAGAGCTCATATTGGAGGTTCA
TGTTGTTGTGATTTGCTTTTGTCTCTTATGTGTCCATGCTGTGTTATCGC
CCAATTTCATCAAGAAATTCTAGCCATGCGTTCTACGGG
back to top

protein sequence of SMED30013131-orf-1

>SMED30013131-orf-1 ID=SMED30013131-orf-1|Name=SMED30013131-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=112bp
LKIPSVLTNQLTMGQWLHGLCGCFNDCGTCILAHCIPCYLVGKDAEAVGF
NCLVSCIIFFFFPTCIISCIRTKVRSRAHIGGSCCCDLLLSLMCPCCVIA
QFHQEILAMRST
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR006461PLAC_motif_containing
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006461PLAC8 motif-containing proteinPFAMPF04749PLAC8coord: 16..105
e-value: 1.3E-15
score: 58.2
IPR006461PLAC8 motif-containing proteinTIGRFAMTIGR01571TIGR01571coord: 15..106
e-value: 5.1E-18
score: 63.7
IPR006461PLAC8 motif-containing proteinPANTHERPTHR15907FAMILY NOT NAMEDcoord: 12..108
NoneNo IPR availablePANTHERPTHR15907:SF102coord: 12..108
NoneNo IPR availableTMHMMTMhelixcoord: 47..69