Gamma-aminobutyric acid receptor subunit beta A

Overview
NameGamma-aminobutyric acid receptor subunit beta A
Smed IDSMED30013129
Length (bp)1889
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gamma-aminobutyric acid receptor subunit beta A (SMED30013129) t-SNE clustered cells

Violin plots show distribution of expression levels for Gamma-aminobutyric acid receptor subunit beta A (SMED30013129) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gamma-aminobutyric acid receptor subunit beta A (SMED30013129) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gamma-aminobutyric acid receptor subunit beta A (SMED30013129) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013129

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30013129SMESG000026005.1 SmedASXL_008288SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30013129SMESG000026005.1 dd_Smed_v6_25116_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30013129SMESG000026005.1 SMED30013129smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Human
Match: GABRB1 (gamma-aminobutyric acid type A receptor beta1 subunit [Source:HGNC Symbol;Acc:HGNC:4081])

HSP 1 Score: 353.214 bits (905), Expect = 6.367e-115
Identity = 214/504 (42.46%), Postives = 301/504 (59.72%), Query Frame = 3
Query:  357 HSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENS--ERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMST-STENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            HS+NE   +     T+  L+K YD RLRP FG  P+ + M + VAS D +SEVNMDYT+T+Y  Q W+D+RL++  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W  G  AV  +  I + QF+IV+Y + +     +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTIST +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G+  ++K    ++ S  E++++   K+                   + H   +      R  N  S  +     + P    K ++Y+  S       AS  YRK                    P+S+     R + ++  PSK R    +R    + K K +  + D+  IDK+SR+ FPI+F LFN+ Y+  Y
Sbjct:   26 HSTNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSY--SGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQ-----------------VDAHGNILLSTLEIR--NETSGSEVLTSVSDP----KATMYSYDS-------ASIQYRK--------------------PLSSREAYGRALDRHGVPSKGR----IRRRASQLKVK-IPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYY 472          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 348.591 bits (893), Expect = 4.158e-113
Identity = 217/526 (41.25%), Postives = 302/526 (57.41%), Query Frame = 3
Query:  294 FWNFLSIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWG----ERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
             W+F  I   +C          S N+   +     T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL++NV   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+   NAV  +  I + QF+IV+Y + T     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G     + K  +K    N+E+ R++  K+      EN    +     E   ++A+       DP                 R     Y  +S+  R+    R      H FGR                 +   R + Q +K    R  S L+          +  + D+  ID++SRI FP+ F  FNI Y+  Y
Sbjct:   12 IWSFPLIIAAVCA--------QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLN--LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKMDP---HENILLSTLEIKNEMATSEAVM---GLGDP-----------------RSTMLAYDASSIQYRKAGLPR------HSFGR-----------------NALERHVAQ-KKSRLRRRASQLKI--------TIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYY 472          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 348.591 bits (893), Expect = 4.158e-113
Identity = 217/526 (41.25%), Postives = 302/526 (57.41%), Query Frame = 3
Query:  294 FWNFLSIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWG----ERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
             W+F  I   +C          S N+   +     T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL++NV   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+   NAV  +  I + QF+IV+Y + T     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G     + K  +K    N+E+ R++  K+      EN    +     E   ++A+       DP                 R     Y  +S+  R+    R      H FGR                 +   R + Q +K    R  S L+          +  + D+  ID++SRI FP+ F  FNI Y+  Y
Sbjct:   12 IWSFPLIIAAVCA--------QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLN--LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKMDP---HENILLSTLEIKNEMATSEAVM---GLGDP-----------------RSTMLAYDASSIQYRKAGLPR------HSFGR-----------------NALERHVAQ-KKSRLRRRASQLKI--------TIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYY 472          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Human
Match: GABRB3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:HGNC Symbol;Acc:HGNC:4083])

HSP 1 Score: 347.436 bits (890), Expect = 1.083e-112
Identity = 221/516 (42.83%), Postives = 309/516 (59.88%), Query Frame = 3
Query:  321 WICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSN---LSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            W      SE R  S N+   +     T+  L+K YD RLRP FG  P+ + M + +AS D +SEVNMDYT+T+Y  QYW+D+RLA+  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G  AV  +E I + QF+IV    H LVS     +TG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q++KK+ E + +++ + +K      +E+   D+        H   +          L S +      ++  N + G I  +T  +   F                 NSGI   + +  M      R +     P K    ++LR    + K K +  + D+  ID++SRI+FP +F LFN+ Y+  Y
Sbjct:   16 WTLGTRGSEPR--SVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAY--SGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVE---HRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG-RGPQRQKKLAEKTAKAKNDRSK------SESNRVDA--------HGNIL----------LTSLE-----VHNEMNEVSGGI-GDTRNSAISFD----------------NSGIQ--YRKQSMPREGHGRFLGDRSLPHKK---THLRRRSSQLKIK-IPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYY 471          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 348.591 bits (893), Expect = 1.104e-112
Identity = 218/533 (40.90%), Postives = 309/533 (57.97%), Query Frame = 3
Query:  294 FWNFLSIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWG----ERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQ--AIFPKPSCRDPNLYSCQKEFQ-FANSPHNRIKGSIY--ANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENR-EMFQNQKPSKT-REISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
             W+F  I   +C          S N+   +     T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL++NV   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+   NAV  +  I + QF+IV+Y + T     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G     + K  +K    N+E+ R++  K+             F+ D++    Q  +++       P   +   +F  +   PH  I  S     N    +       + R  +  +     S I      +P  +   N  E    QK S+  R  S L+          +  + D+  ID++SRI FP+ F  FNI Y+  Y
Sbjct:   12 IWSFPLIIAAVCA--------QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLN--LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKI-------------FYKDIKQNGTQYRSLWDPTGNLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYD---ASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKI--------TIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYY 510          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Celegans
Match: gab-1 (Gamma-aminobutyric acid receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:O18276])

HSP 1 Score: 382.489 bits (981), Expect = 9.436e-126
Identity = 234/507 (46.15%), Postives = 308/507 (60.75%), Query Frame = 3
Query:  432 RLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXX-------XXXENSERSRINNTK--------------------LSHPIFTEN--KNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYSL 1865
            RLRP FG   + + M++++ASFDSISEV+MDYT+T+YL+QYW DERL ++       + + G+FS  IWVPDTFLANDK+S+LH+VTE+NKMLRI  DG++ YGMR ++TL+C M+L  +PLD QNCTVEIESYGY   +V M W N   AVH +E   + QFTI  +     + + +TG YQRLSL FQL R+VG+F+FQTYLP +LIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVR SLPRISYVK+ID+YLV+CFVFVF+ALLEYAAVNY++WG    +             +    S +N  K                    L   + T N    N++F    + K   +    P CR  N  S  +E +  + P        Y+ TS+   R  AS N++   H  GR               S   + R        S  + IS +       K    ++VRD+ +IDK+SR++FP+ FI+FN+ Y+  Y +
Sbjct:   68 RLRPGFGGDALLLTMDIIIASFDSISEVDMDYTLTMYLHQYWTDERLRWSNEIPIDEMTLSGEFSQNIWVPDTFLANDKHSYLHEVTERNKMLRINVDGKVAYGMRLTSTLSCSMNLRNFPLDSQNCTVEIESYGYTTSEVLMKW-NYPLAVHGVEQADVPQFTITGFHTEDSIVSTATGSYQRLSLVFQLRRSVGYFIFQTYLPCVLIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRQSLPRISYVKSIDIYLVMCFVFVFAALLEYAAVNYSYWGRERGKGGGGNEWPVNGANKEDRESAVNVQKWVPSGLMDGVPQPQDRRVEALEEAMSTSNTAAQNNNFESTSKPKKRSSSPIPPLCRAGNTIS--EESESPDYPR-------YSTTSLKGARPHASLNHKTH-HLKGRS--------------SARAKRRMTLARMNVSMKQSISGIGRR--ARKVIPTIRVRDVNLIDKYSRVVFPVCFIVFNLFYWSYYMM 547          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Celegans
Match: lgc-38 (pep chromosome:WBcel235:III:7009136:7019574:1 gene:WBGene00017389.1 transcript:F11H8.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgc-38)

HSP 1 Score: 258.84 bits (660), Expect = 3.289e-79
Identity = 145/344 (42.15%), Postives = 205/344 (59.59%), Query Frame = 3
Query:  288 WIFWNFL---------------SIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            W+ W+ L                +  +  Q  +  T    SNE  L  N +  +  L+ ++D R+RP +G  P+ +++   V +  ++SEV+MDYT+ LYL Q W+D RLA+     D++  +  D    IW PDTF  N+K SF H+ T  N  LRI   G +   +R + T  C M LH +PLD Q C +E+ESYGY   D+   W +G NAV   EN+H+  FTI  +       +LSTG Y RL+  F   RN+GF++ Q Y PS LIV++SWVSFW++ EA  ARVA+G+TTVLTMTT+ T   +SLP++SYVK++DV+L VCF  VF++LLEYAA+ Y
Sbjct:    4 WLLWSLLIGYVTTEHPPLMKSDKLIEYAPQASTEPTLGGESNE-NLENNVTRLLDKLIASHDRRIRPNYGGPPIEVNITAHVTTISAVSEVSMDYTLDLYLRQIWKDPRLAWESDVEDSLT-IGIDMVKTIWTPDTFFPNEKKSFFHEATSHNSFLRIDNHGNVLRSIRLTVTANCPMSLHTFPLDRQECALEVESYGYSTKDIIYHW-HGTNAVTIDENVHLAHFTIGEHKHIERTISLSTGNYSRLTAYFLFKRNIGFYLIQIYFPSSLIVVISWVSFWLNREAVQARVAIGVTTVLTMTTLMTSTNASLPKVSYVKSLDVFLGVCFFIVFASLLEYAAIGY 344          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Celegans
Match: lgc-38 (pep chromosome:WBcel235:III:7009136:7019403:1 gene:WBGene00017389.1 transcript:F11H8.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgc-38)

HSP 1 Score: 258.455 bits (659), Expect = 7.147e-79
Identity = 145/344 (42.15%), Postives = 205/344 (59.59%), Query Frame = 3
Query:  288 WIFWNFL---------------SIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            W+ W+ L                +  +  Q  +  T    SNE  L  N +  +  L+ ++D R+RP +G  P+ +++   V +  ++SEV+MDYT+ LYL Q W+D RLA+     D++  +  D    IW PDTF  N+K SF H+ T  N  LRI   G +   +R + T  C M LH +PLD Q C +E+ESYGY   D+   W +G NAV   EN+H+  FTI  +       +LSTG Y RL+  F   RN+GF++ Q Y PS LIV++SWVSFW++ EA  ARVA+G+TTVLTMTT+ T   +SLP++SYVK++DV+L VCF  VF++LLEYAA+ Y
Sbjct:    4 WLLWSLLIGYVTTEHPPLMKSDKLIEYAPQASTEPTLGGESNE-NLENNVTRLLDKLIASHDRRIRPNYGGPPIEVNITAHVTTISAVSEVSMDYTLDLYLRQIWKDPRLAWESDVEDSLT-IGIDMVKTIWTPDTFFPNEKKSFFHEATSHNSFLRIDNHGNVLRSIRLTVTANCPMSLHTFPLDRQECALEVESYGYSTKDIIYHW-HGTNAVTIDENVHLAHFTIGEHKHIERTISLSTGNYSRLTAYFLFKRNIGFYLIQIYFPSSLIVVISWVSFWLNREAVQARVAIGVTTVLTMTTLMTSTNASLPKVSYVKSLDVFLGVCFFIVFASLLEYAAIGY 344          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Celegans
Match: unc-49 (Ionotropic GABA receptor subunit UNC-49B.3 [Source:UniProtKB/TrEMBL;Acc:G5ECD3])

HSP 1 Score: 249.98 bits (637), Expect = 1.411e-75
Identity = 135/290 (46.55%), Postives = 192/290 (66.21%), Query Frame = 3
Query:  420 NYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFN-----VSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
             YD RLRP++G  P+ + + + V+S  ++SEV+MD+T+  Y+ Q WQD RLAF      +S     + +  D+ +++W PDTF  N+K SF H  T  N  LRI GDG ++   R + T  C MDL  +P+D Q+C +EIESYGY + D+ M   + + +V + E+  + QF + +  V      LS+G Y RL   F   RN+GF++ Q YLPS+LIV++SWVSFW+S +AT ARVALG+TTVLTMTT+ T   SS+P++SYVK+ID++L VCF+ VF +LLEYAAV Y
Sbjct:   46 TYDKRLRPRYGEKPVDVGITIHVSSISAVSEVDMDFTLDFYMRQTWQDPRLAFGSLDLGLSKEIDSLTVGVDYLDRLWKPDTFFPNEKKSFFHLATTHNSFLRIEGDGTVYTSQRLTVTATCPMDLKLFPMDSQHCKLEIESYGYSILDI-MYVSHEKKSV-STESYELPQFVLQSIKVVNHTQKLSSGEYSRLCWFFLFKRNIGFYIIQIYLPSVLIVVISWVSFWLSRDATPARVALGVTTVLTMTTLMTMTNSSMPKVSYVKSIDIFLGVCFMMVFCSLLEYAAVGY 333          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Celegans
Match: unc-49 (Ionotropic GABA receptor subunit UNC-49B.3 [Source:UniProtKB/TrEMBL;Acc:G5ECD3])

HSP 1 Score: 249.98 bits (637), Expect = 1.411e-75
Identity = 135/290 (46.55%), Postives = 192/290 (66.21%), Query Frame = 3
Query:  420 NYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFN-----VSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
             YD RLRP++G  P+ + + + V+S  ++SEV+MD+T+  Y+ Q WQD RLAF      +S     + +  D+ +++W PDTF  N+K SF H  T  N  LRI GDG ++   R + T  C MDL  +P+D Q+C +EIESYGY + D+ M   + + +V + E+  + QF + +  V      LS+G Y RL   F   RN+GF++ Q YLPS+LIV++SWVSFW+S +AT ARVALG+TTVLTMTT+ T   SS+P++SYVK+ID++L VCF+ VF +LLEYAAV Y
Sbjct:   46 TYDKRLRPRYGEKPVDVGITIHVSSISAVSEVDMDFTLDFYMRQTWQDPRLAFGSLDLGLSKEIDSLTVGVDYLDRLWKPDTFFPNEKKSFFHLATTHNSFLRIEGDGTVYTSQRLTVTATCPMDLKLFPMDSQHCKLEIESYGYSILDI-MYVSHEKKSV-STESYELPQFVLQSIKVVNHTQKLSSGEYSRLCWFFLFKRNIGFYIIQIYLPSVLIVVISWVSFWLSRDATPARVALGVTTVLTMTTLMTMTNSSMPKVSYVKSIDIFLGVCFMMVFCSLLEYAAVGY 333          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Fly
Match: Lcch3 (gene:FBgn0010240 transcript:FBtr0074129)

HSP 1 Score: 447.588 bits (1150), Expect = 1.158e-151
Identity = 264/505 (52.28%), Postives = 335/505 (66.34%), Query Frame = 3
Query:  381 LKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNV----------SHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYSL 1865
            L+N + TISN+++ YD RLRP FG  P+ + M+L +ASFD+ISEVNMDYTIT+YLNQYW+DERLAFN+               ++ + GDF+ +IWVPDTF ANDK SFLHDVTE+NK++R+ GDG + YGMRF+TTLACMMDLHYYPLD QNCTVEIESYGY + DV M WK     V  +E+  + QFTI+ Y+ +     L+TG+YQRLSL F+L RN+G+FVFQTYLPSILIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAID+YLV+CFVFVF+ALLEYAAVNYT+WG+RAK+K KK+KE     +I  ++ S    T          D+    +  + P PS R                 +N    SI   T MN  +F  S        R  R + +G             ++ R   Q    ++ R +  L+     +    + K++D+ IIDK+SR++FPISF+ FN+GY+  Y L
Sbjct:   37 LENVTQTISNILQGYDIRLRPNFGGEPLHVGMDLTIASFDAISEVNMDYTITMYLNQYWRDERLAFNIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFANDKNSFLHDVTERNKLVRLGGDGAVTYGMRFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVSDVVMYWKP--TPVRGVEDAELPQFTIIGYETNDRKERLATGVYQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNYTYWGKRAKKKIKKVKECCP-GKIGKSERSETCSTTE--------DIIELQDVRMSPIPSLR--------------RGTYNATLDSIGTET-MNLGKFPPS-------FRITRNYGTG------------HSQLRRRAQRGISTRPRMLHALK-RGASAIKATIPKIKDVNIIDKYSRMIFPISFLAFNLGYWLFYIL 495          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Fly
Match: Rdl (gene:FBgn0004244 transcript:FBtr0333835)

HSP 1 Score: 252.292 bits (643), Expect = 5.181e-75
Identity = 127/296 (42.91%), Postives = 190/296 (64.19%), Query Frame = 3
Query:  387 NASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            N S  + +   +YD R+RP +G  P+ + + + V S  S+SEV MD+T+  Y  Q+W D RLA+        + +  +F   IWVPDTF  N+K S+ H  T  N+ +R++  G I   +R + T +C M+L Y+P+D Q C +EIES+GY + D++  W  G N+V     + + QF ++ +    +  +L+TG Y RL+   Q  R++G+++ Q Y+PS LIV++SWVSFW++  AT ARVALG+TTVLTMTT+ +   ++LP+ISYVK+IDVYL  CFV VF++LLEYA V Y
Sbjct:   58 NISAILDSFSVSYDKRVRPNYGGPPVEVGVTMYVLSISSLSEVKMDFTLDFYFRQFWTDPRLAYRKRPGVETLSVGSEFIKNIWVPDTFFVNEKQSYFHIATTSNEFIRVHHSGSITRSIRLTITASCPMNLQYFPMDRQLCHIEIESFGYTMRDIRYKWNEGPNSVGVSSEVSLPQFKVLGHRQRAMEISLTTGNYSRLACEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRNATPARVALGVTTVLTMTTLMSSTNAALPKISYVKSIDVYLGTCFVMVFASLLEYATVGY 353          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Fly
Match: Rdl (gene:FBgn0004244 transcript:FBtr0076534)

HSP 1 Score: 252.292 bits (643), Expect = 5.181e-75
Identity = 127/296 (42.91%), Postives = 190/296 (64.19%), Query Frame = 3
Query:  387 NASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            N S  + +   +YD R+RP +G  P+ + + + V S  S+SEV MD+T+  Y  Q+W D RLA+        + +  +F   IWVPDTF  N+K S+ H  T  N+ +R++  G I   +R + T +C M+L Y+P+D Q C +EIES+GY + D++  W  G N+V     + + QF ++ +    +  +L+TG Y RL+   Q  R++G+++ Q Y+PS LIV++SWVSFW++  AT ARVALG+TTVLTMTT+ +   ++LP+ISYVK+IDVYL  CFV VF++LLEYA V Y
Sbjct:   58 NISAILDSFSVSYDKRVRPNYGGPPVEVGVTMYVLSISSLSEVKMDFTLDFYFRQFWTDPRLAYRKRPGVETLSVGSEFIKNIWVPDTFFVNEKQSYFHIATTSNEFIRVHHSGSITRSIRLTITASCPMNLQYFPMDRQLCHIEIESFGYTMRDIRYKWNEGPNSVGVSSEVSLPQFKVLGHRQRAMEISLTTGNYSRLACEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRNATPARVALGVTTVLTMTTLMSSTNAALPKISYVKSIDVYLGTCFVMVFASLLEYATVGY 353          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Fly
Match: Rdl (gene:FBgn0004244 transcript:FBtr0309054)

HSP 1 Score: 251.136 bits (640), Expect = 6.343e-75
Identity = 127/296 (42.91%), Postives = 191/296 (64.53%), Query Frame = 3
Query:  387 NASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            N S  + +   +YD R+RP +G  P+ + + + V S  S+SEV MD+T+  Y  Q+W D RLA+        + +  +F   IWVPDTF  N+K S+ H  T  N+ +R++  G I   +R + T +C M+L Y+P+D Q C +EIES+GY + D++  W++G ++V     + + QF ++ +       NL+TG Y RL+   Q  R++G+++ Q Y+PS LIV++SWVSFW++  AT ARVALG+TTVLTMTT+ +   ++LP+ISYVK+IDVYL  CFV VF++LLEYA V Y
Sbjct:   58 NISAILDSFSVSYDKRVRPNYGGPPVEVGVTMYVLSISSLSEVKMDFTLDFYFRQFWTDPRLAYRKRPGVETLSVGSEFIKNIWVPDTFFVNEKQSYFHIATTSNEFIRVHHSGSITRSIRLTITASCPMNLQYFPMDRQLCHIEIESFGYTMRDIRYFWRDGLSSVGMSSEVELPQFRVLGHRQRATEINLTTGNYSRLACEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRNATPARVALGVTTVLTMTTLMSSTNAALPKISYVKSIDVYLGTCFVMVFASLLEYATVGY 353          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Fly
Match: Rdl (gene:FBgn0004244 transcript:FBtr0333834)

HSP 1 Score: 251.521 bits (641), Expect = 1.029e-74
Identity = 127/296 (42.91%), Postives = 190/296 (64.19%), Query Frame = 3
Query:  387 NASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            N S  + +   +YD R+RP +G  P+ + + + V S  S+SEV MD+T+  Y  Q+W D RLA+        + +  +F   IWVPDTF  N+K S+ H  T  N+ +R++  G I   +R + T +C M+L Y+P+D Q C +EIES+GY + D++  W  G N+V     + + QF ++ +    +  +L+TG Y RL+   Q  R++G+++ Q Y+PS LIV++SWVSFW++  AT ARVALG+TTVLTMTT+ +   ++LP+ISYVK+IDVYL  CFV VF++LLEYA V Y
Sbjct:   58 NISAILDSFSVSYDKRVRPNYGGPPVEVGVTMYVLSISSVSEVLMDFTLDFYFRQFWTDPRLAYRKRPGVETLSVGSEFIKNIWVPDTFFVNEKQSYFHIATTSNEFIRVHHSGSITRSIRLTITASCPMNLQYFPMDRQLCHIEIESFGYTMRDIRYKWNEGPNSVGVSSEVSLPQFKVLGHRQRAMEISLTTGNYSRLACEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRNATPARVALGVTTVLTMTTLMSSTNAALPKISYVKSIDVYLGTCFVMVFASLLEYATVGY 353          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Zebrafish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 363.999 bits (933), Expect = 6.716e-119
Identity = 222/506 (43.87%), Postives = 308/506 (60.87%), Query Frame = 3
Query:  357 HSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKP-SCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQAS----RNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
             S+NE   +     T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G  AV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E +E++                NND   +D      +    KP S +  N     +  +  +S  N +  ++  +  +       S    RN    +       NSGI  Y ++     ST    M +N +  K R    LR    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y
Sbjct:   26 QSANEPGNMSFVKETVDKLLKGYDIRLRPDFGGAPVAVGMSIDVASIDMVSEVNMDYTLTMYFQQYWRDKRLAY--TGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWKGGETAVTGVSRIELPQFSIVDYKLVSRNVVFSTGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG-RGPQMQKKLAEKAEKA----------------NNDRNKYDGNKSVQEGGNCKPSSVKQSNQVQGHRHSRGVDSQGNILLTTLEIHNEVAGNEITTSVSEARNSTSMVFD-----NSGIQ-YRKQ-----STARHSMDRNAQSKKPR----LRRRSSQLKIK-IPDLTDVNAIDRWSRIIFPAVFSLFNLIYWLYY 496          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Zebrafish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 363.999 bits (933), Expect = 6.716e-119
Identity = 222/506 (43.87%), Postives = 308/506 (60.87%), Query Frame = 3
Query:  357 HSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKP-SCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQAS----RNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
             S+NE   +     T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G  AV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E +E++                NND   +D      +    KP S +  N     +  +  +S  N +  ++  +  +       S    RN    +       NSGI  Y ++     ST    M +N +  K R    LR    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y
Sbjct:   26 QSANEPGNMSFVKETVDKLLKGYDIRLRPDFGGAPVAVGMSIDVASIDMVSEVNMDYTLTMYFQQYWRDKRLAY--TGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWKGGETAVTGVSRIELPQFSIVDYKLVSRNVVFSTGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG-RGPQMQKKLAEKAEKA----------------NNDRNKYDGNKSVQEGGNCKPSSVKQSNQVQGHRHSRGVDSQGNILLTTLEIHNEVAGNEITTSVSEARNSTSMVFD-----NSGIQ-YRKQ-----STARHSMDRNAQSKKPR----LRRRSSQLKIK-IPDLTDVNAIDRWSRIIFPAVFSLFNLIYWLYY 496          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Zebrafish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 363.229 bits (931), Expect = 2.946e-118
Identity = 222/505 (43.96%), Postives = 308/505 (60.99%), Query Frame = 3
Query:  360 SSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKP-SCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQAS----RNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            S+NE   +     T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G  AV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E +E++                NND   +D      +    KP S +  N     +  +  +S  N +  ++  +  +       S    RN    +       NSGI  Y ++     ST    M +N +  K R    LR    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y
Sbjct:   61 SANEPGNMSFVKETVDKLLKGYDIRLRPDFGGAPVAVGMSIDVASIDMVSEVNMDYTLTMYFQQYWRDKRLAY--TGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWKGGETAVTGVSRIELPQFSIVDYKLVSRNVVFSTGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG-RGPQMQKKLAEKAEKA----------------NNDRNKYDGNKSVQEGGNCKPSSVKQSNQVQGHRHSRGVDSQGNILLTTLEIHNEVAGNEITTSVSEARNSTSMVFD-----NSGIQ-YRKQ-----STARHSMDRNAQSKKPR----LRRRSSQLKIK-IPDLTDVNAIDRWSRIIFPAVFSLFNLIYWLYY 530          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Zebrafish
Match: gabrb4 (gamma-aminobutyric acid type A receptor beta4 subunit [Source:ZFIN;Acc:ZDB-GENE-070424-211])

HSP 1 Score: 350.903 bits (899), Expect = 1.134e-113
Identity = 211/494 (42.71%), Postives = 301/494 (60.93%), Query Frame = 3
Query:  390 ASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTS-MNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQK--PSKTREISNLRFHFCRSKTK-NLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            A  T+  L+K YD RLRP FG  P+ + M + +AS DSISEVNMDYTIT+Y  Q W+D+RLA+  +     + +    ++Q+W+PDT+  NDK SFLH VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G NAV  ++ + + QF+IV   + +     +TG Y RLSL F++ RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALG+TTVLTMTTI+T +R +LP+I YVKAIDVYL+ CFVFVF ALLEYA VNY F+G          ++     R+N      P + E +  +        + N     +   +  NLY  ++     ++  N +  ++  N   M +    +  + R  +  F    +SG+   F + PM +    R+ F +     S  R  +N R     SK K  +  + D+  IDK+SRI+FPI+F  FN+ Y+  Y
Sbjct:   38 AKTTVDKLLKGYDIRLRPDFGGPPVIVGMSINIASIDSISEVNMDYTITMYFQQSWRDKRLAY--AEMALNLTLDNRVADQLWLPDTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGDNAVTGVDKLELPQFSIVELRLVSREVRFTTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVFFGRGP------QQQKKINERLNKANNERPRYEEKRLREQDSISAPFQSNTL---RSYTQRRNLYLEEQRKVGVDAYGNILLTTLEMNNEVMPSDVGSSVSDSRNSVMSFD---SSGVQ--FRK-PMGS----RDGFSHHSLDRSAMRSRANCRLRRRSSKLKLKIPNLTDVSTIDKWSRIIFPITFGFFNLIYWLYY 510          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Zebrafish
Match: gabrb1 (gamma-aminobutyric acid type A receptor beta1 subunit [Source:ZFIN;Acc:ZDB-GENE-090313-230])

HSP 1 Score: 345.51 bits (885), Expect = 5.045e-112
Identity = 209/505 (41.39%), Postives = 301/505 (59.60%), Query Frame = 3
Query:  357 HSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGE----RAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            HS NE   +    +T+  L+K YD RLRP FG  P+ + M + ++S D +SEVNMDYTIT+Y  Q W+D+RL++  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G ++V  ++NI + QF+I++Y   +     +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G     + K  +K  K N+E+SR+ + K+   +                 H          R     S  +       P N +    Y + S+  R+    R+       +GR                T++  R +     P K+R    LR    + K K +  + D+  IDK+SR++FPI++  FN+ Y+  Y
Sbjct:   34 HSVNEPSNMSYVKVTVDKLLKGYDIRLRPDFGGPPVDVGMSIDISSIDMVSEVNMDYTITMYFQQSWRDKRLSY--TGIPLNLTLDNRVADQLWVPDTYFINDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWQGG-SSVTGVDNIELPQFSIIDYKTLSKKVVFATGSYPRLSLSFKLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGRGPHLQKKVAEKAAKSNNEKSRLESNKVQVDV-----------------HGSIPLTNLDLR----LSGAEMLGALGDPRNTMFS--YDSASIQYRKPLTGRDL------YGR---------------PTASIERPL----APKKSR----LRRRAAQLKVK-IPDLTDVNAIDKWSRVIFPITYTFFNLVYWLYY 482          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Xenopus
Match: dusp5 (dual specificity phosphatase 5 [Source:Xenbase;Acc:XB-GENE-957572])

HSP 1 Score: 360.918 bits (925), Expect = 6.959e-118
Identity = 221/491 (45.01%), Postives = 304/491 (61.91%), Query Frame = 3
Query:  399 TISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSN---LSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKF-NSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  QYW+D+RLA+  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W  G NAV  +E I + QF+I++   H LVS     +TG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E S +S              NK++  F  +  + H   +                        HN + G+    TS+++ R  A+             F NSGI  Y ++     S   R   +N  P KT    +LR    + K K +  + D+  ID++SRI+FPI+F LFN+ Y+  Y
Sbjct:   40 TVDKLLKGYDIRLRPDFGGSPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAY--TGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWLGGDNAVTGVERIELPQFSIMD---HKLVSKNVVFATGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG-RGPQMQKKLAEKSAKS--------------NKDHSKFESNRVDAHGNILLTTLEI------------------HNEVTGN-EITTSVSDARNSAT------------SFDNSGIQ-YRKQSTARDSLGRRTADRNHPPKKT----HLRRRSSQLKIK-IPDLTDVNAIDRWSRIVFPITFSLFNLIYWLYY 473          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Xenopus
Match: gabrb2 (gamma-aminobutyric acid (GABA) A receptor, beta 2 [Source:NCBI gene;Acc:100125027])

HSP 1 Score: 353.984 bits (907), Expect = 3.094e-115
Identity = 207/522 (39.66%), Postives = 300/522 (57.47%), Query Frame = 3
Query:  294 FWNFLSIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
             W+F  +   +C          S N+   +     T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL+++V   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G NAV  +E + + QF+I++Y++ +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G              +R +    + +H       NN+    +L            +    N  +  +       P + +    Y  +S+  R+    R      H +GR                 +   R + Q +K    R  S L+         N+  + D+  ID++SR++FP+ F  FNI Y+  Y
Sbjct:   12 IWSFPVLITMVCT--------QSVNDPSNMTLVKETVDRLLKGYDIRLRPDFGGDPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSVIPLN--LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIGFYWRGGNNAVTGVERLELPQFSIIDYNLLSRNVVFSTGSYPRLSLSFKLRRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFG-----------RGPQRQKRAAERAAH------ANNEQMRMELNKMDPHENILLSTLEIKNEMAASEAVMGLGDPRSTMLA--YDTSSIQYRKAGLPR------HSYGR-----------------NALERHVVQ-KKSRLRRRASQLKI--------NIPDLTDVNAIDRWSRMIFPVVFSFFNIVYWLYY 472          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Xenopus
Match: gabrb2 (gamma-aminobutyric acid (GABA) A receptor, beta 2 [Source:NCBI gene;Acc:100125027])

HSP 1 Score: 352.443 bits (903), Expect = 4.809e-115
Identity = 202/487 (41.48%), Postives = 290/487 (59.55%), Query Frame = 3
Query:  399 TISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL+++V   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G NAV  +E + + QF+I++Y++ +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G              +R +    + +H       NN+    +L            +    N  +  +       P + +    Y  +S+  R+    R      H +GR                 +   R + Q +K    R  S L+         N+  + D+  ID++SR++FP+ F  FNI Y+  Y
Sbjct:   16 TVDRLLKGYDIRLRPDFGGDPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSVIPLN--LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIGFYWRGGNNAVTGVERLELPQFSIIDYNLLSRNVVFSTGSYPRLSLSFKLRRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFG-----------RGPQRQKRAAERAAH------ANNEQMRMELNKMDPHENILLSTLEIKNEMAASEAVMGLGDPRSTMLA--YDTSSIQYRKAGLPR------HSYGR-----------------NALERHVVQ-KKSRLRRRASQLKI--------NIPDLTDVNAIDRWSRMIFPVVFSFFNIVYWLYY 449          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Xenopus
Match: gabrb2 (gamma-aminobutyric acid (GABA) A receptor, beta 2 [Source:NCBI gene;Acc:100125027])

HSP 1 Score: 352.829 bits (904), Expect = 5.564e-115
Identity = 202/487 (41.48%), Postives = 290/487 (59.55%), Query Frame = 3
Query:  399 TISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL+++V   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G NAV  +E + + QF+I++Y++ +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G              +R +    + +H       NN+    +L            +    N  +  +       P + +    Y  +S+  R+    R      H +GR                 +   R + Q +K    R  S L+         N+  + D+  ID++SR++FP+ F  FNI Y+  Y
Sbjct:   22 TVDRLLKGYDIRLRPDFGGDPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSVIPLN--LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIGFYWRGGNNAVTGVERLELPQFSIIDYNLLSRNVVFSTGSYPRLSLSFKLRRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFG-----------RGPQRQKRAAERAAH------ANNEQMRMELNKMDPHENILLSTLEIKNEMAASEAVMGLGDPRSTMLA--YDTSSIQYRKAGLPR------HSYGR-----------------NALERHVVQ-KKSRLRRRASQLKI--------NIPDLTDVNAIDRWSRMIFPVVFSFFNIVYWLYY 455          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Xenopus
Match: gabrb2 (gamma-aminobutyric acid (GABA) A receptor, beta 2 [Source:NCBI gene;Acc:100125027])

HSP 1 Score: 352.443 bits (903), Expect = 1.537e-114
Identity = 202/487 (41.48%), Postives = 290/487 (59.55%), Query Frame = 3
Query:  399 TISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL+++V   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G NAV  +E + + QF+I++Y++ +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G              +R +    + +H       NN+    +L            +    N  +  +       P + +    Y  +S+  R+    R      H +GR                 +   R + Q +K    R  S L+         N+  + D+  ID++SR++FP+ F  FNI Y+  Y
Sbjct:   46 TVDRLLKGYDIRLRPDFGGDPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYSVIPLN--LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIGFYWRGGNNAVTGVERLELPQFSIIDYNLLSRNVVFSTGSYPRLSLSFKLRRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFG-----------RGPQRQKRAAERAAH------ANNEQMRMELNKMDPHENILLSTLEIKNEMAASEAVMGLGDPRSTMLA--YDTSSIQYRKAGLPR------HSYGR-----------------NALERHVVQ-KKSRLRRRASQLKI--------NIPDLTDVNAIDRWSRMIFPVVFSFFNIVYWLYY 479          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Mouse
Match: Gabrb1 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 1 [Source:MGI Symbol;Acc:MGI:95619])

HSP 1 Score: 353.984 bits (907), Expect = 2.582e-115
Identity = 215/504 (42.66%), Postives = 300/504 (59.52%), Query Frame = 3
Query:  357 HSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENS--ERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTE-NREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            HSSNE   +     T+  L+K YD RLRP FG  P+ + M + VAS D +SEVNMDYT+T+Y  Q W+D+RL++  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W  G  AV  +  I + QF+IV+Y + +     +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTIST +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G+  ++K    ++ S  E++R+   K+                   + H   +      R  N  S  +     + P    K ++Y+  S       AS  YRK                    P+S+     R + ++  P K R    +R    + K K +  + D+  IDK+SR+ FPI+F LFN+ Y+  Y
Sbjct:   26 HSSNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSY--SGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNRLEMNKVQ-----------------VDAHGNILLSTLEIR--NETSGSEVLTGVSDP----KATMYSYDS-------ASIQYRK--------------------PLSSREGFGRGLDRHGVPGKGR----IRRRASQLKVK-IPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYY 472          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 347.821 bits (891), Expect = 5.683e-113
Identity = 214/490 (43.67%), Postives = 297/490 (60.61%), Query Frame = 3
Query:  399 TISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSN---LSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            T+  L+K YD RLRP FG  P+ + M + +AS D +SEVNMDYT+T+Y  QYW+D+RLA+  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G  AV  +E I + QF+IV    H LVS     +TG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q++KK+ E + +++ + +K        + N      D+ N+ N+                             + GS+  +T  +   F                 NSGI   + +  M      R M     P K    ++LR    + K K +  + D+  ID++SRI+FP +F LFN+ Y+  Y
Sbjct:   40 TVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAY--SGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVE---HRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG-RGPQRQKKLAEKTAKAKNDRSKSEINRVDAHGNILLAPMDVHNEMNE-----------------------------VAGSV-GDTRNSAISFD----------------NSGIQ--YRKQSMPKEGHGRYMGDRSIPHKK---THLRRRSSQLKIK-IPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYY 471          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 347.821 bits (891), Expect = 5.806e-113
Identity = 214/490 (43.67%), Postives = 297/490 (60.61%), Query Frame = 3
Query:  399 TISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSN---LSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            T+  L+K YD RLRP FG  P+ + M + +AS D +SEVNMDYT+T+Y  QYW+D+RLA+  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G  AV  +E I + QF+IV    H LVS     +TG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q++KK+ E + +++ + +K        + N      D+ N+ N+                             + GS+  +T  +   F                 NSGI   + +  M      R M     P K    ++LR    + K K +  + D+  ID++SRI+FP +F LFN+ Y+  Y
Sbjct:   40 TVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAY--SGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVE---HRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG-RGPQRQKKLAEKTAKAKNDRSKSEINRVDAHGNILLAPMDVHNEMNE-----------------------------VAGSV-GDTRNSAISFD----------------NSGIQ--YRKQSMPKEGHGRYMGDRSIPHKK---THLRRRSSQLKIK-IPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYY 471          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 347.436 bits (890), Expect = 1.659e-112
Identity = 214/490 (43.67%), Postives = 297/490 (60.61%), Query Frame = 3
Query:  399 TISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSN---LSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            T+  L+K YD RLRP FG  P+ + M + +AS D +SEVNMDYT+T+Y  QYW+D+RLA+  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G  AV  +E I + QF+IV    H LVS     +TG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q++KK+ E + +++ + +K        + N      D+ N+ N+                             + GS+  +T  +   F                 NSGI   + +  M      R M     P K    ++LR    + K K +  + D+  ID++SRI+FP +F LFN+ Y+  Y
Sbjct:   62 TVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAY--SGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVE---HRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG-RGPQRQKKLAEKTAKAKNDRSKSEINRVDAHGNILLAPMDVHNEMNE-----------------------------VAGSV-GDTRNSAISFD----------------NSGIQ--YRKQSMPKEGHGRYMGDRSIPHKK---THLRRRSSQLKIK-IPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYY 493          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Mouse
Match: Gabrb2 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 2 [Source:MGI Symbol;Acc:MGI:95620])

HSP 1 Score: 341.273 bits (874), Expect = 1.624e-110
Identity = 176/332 (53.01%), Postives = 236/332 (71.08%), Query Frame = 3
Query:  294 FWNFLSIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGE 1289
             W+F  I   +C          S N+   +     T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL++NV   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+   NAV  +  I + QF+IV+Y + T     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G 
Sbjct:   12 IWSFPLIIAAVCA--------QSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLN--LTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFMALLEYALVNYIFFGR 333          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. UniProt/SwissProt
Match: sp|Q08832|GBRB3_DROME (Gamma-aminobutyric acid receptor subunit beta-like OS=Drosophila melanogaster OX=7227 GN=Lcch3 PE=1 SV=2)

HSP 1 Score: 447.588 bits (1150), Expect = 1.160e-150
Identity = 264/505 (52.28%), Postives = 335/505 (66.34%), Query Frame = 3
Query:  381 LKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNV----------SHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYSL 1865
            L+N + TISN+++ YD RLRP FG  P+ + M+L +ASFD+ISEVNMDYTIT+YLNQYW+DERLAFN+               ++ + GDF+ +IWVPDTF ANDK SFLHDVTE+NK++R+ GDG + YGMRF+TTLACMMDLHYYPLD QNCTVEIESYGY + DV M WK     V  +E+  + QFTI+ Y+ +     L+TG+YQRLSL F+L RN+G+FVFQTYLPSILIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAID+YLV+CFVFVF+ALLEYAAVNYT+WG+RAK+K KK+KE     +I  ++ S    T          D+    +  + P PS R                 +N    SI   T MN  +F  S        R  R + +G             ++ R   Q    ++ R +  L+     +    + K++D+ IIDK+SR++FPISF+ FN+GY+  Y L
Sbjct:   37 LENVTQTISNILQGYDIRLRPNFGGEPLHVGMDLTIASFDAISEVNMDYTITMYLNQYWRDERLAFNIFGQYFDDENDDGISDVLTLSGDFAEKIWVPDTFFANDKNSFLHDVTERNKLVRLGGDGAVTYGMRFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVSDVVMYWKP--TPVRGVEDAELPQFTIIGYETNDRKERLATGVYQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNYTYWGKRAKKKIKKVKECCP-GKIGKSERSETCSTTE--------DIIELQDVRMSPIPSLR--------------RGTYNATLDSIGTET-MNLGKFPPS-------FRITRNYGTG------------HSQLRRRAQRGISTRPRMLHALK-RGASAIKATIPKIKDVNIIDKYSRMIFPISFLAFNLGYWLFYIL 495          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. UniProt/SwissProt
Match: sp|P26714|GBRB_LYMST (Gamma-aminobutyric acid receptor subunit beta OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 5.135e-147
Identity = 250/501 (49.90%), Postives = 327/501 (65.27%), Query Frame = 3
Query:  387 NASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAF--------NVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYSL 1865
            N + TI +L+K YD RLRP FG  P+ I +E+++ASFDSISEV+MDYTIT+YLNQYW+DERL F          + +   + + G F+ +IWVPDTFLANDK SFLHD+TEKNKM+R+YG+G + YGMRF+TTLACMMDLH YPLD Q CTVEIESYGY +DD+ + W N R AV  +E++ + QF+I NY     +  LSTG YQRLSL FQL RN+G+F+FQTYLPSILIVMLSWVSFWI+HEATSARVALGITTVLTMTTIS GVRSSLPRISYVKAID+YLV+CFVFVF+ALLEYAAVNYT+WG RA       K  ++R R   T +   +   ++ N++    +E K    +       +   ++   +    +    R+   I                 R F H      ++  + Y   IP  T+   R    +  P + R +S+ R    +S    + +V+D+  IDK++R++FP+ FI+FN  Y+ +Y L
Sbjct:   32 NVTNTIDSLLKGYDIRLRPSFGGAPLEIGIEVILASFDSISEVDMDYTITMYLNQYWRDERLQFIFNESLDLGENRSVTTMTLTGAFAEKIWVPDTFLANDKNSFLHDITEKNKMVRLYGNGSLVYGMRFTTTLACMMDLHNYPLDHQECTVEIESYGYTMDDIVLYWLNDRGAVTGVEDVSLPQFSITNYATINKIEELSTGDYQRLSLIFQLQRNIGYFIFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISNGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNYTYWGARA-------KRKAKRLRERATSVRKRVDDGDQMNNTNMDTVELKEVHMVPTSVGVTNSQSFNLDLDDGSGDDTGFRVVPPI----------------PRSFTHS-----HATTHGY---IP--TNVVRRRSSSHVPPRRRRLLSHFR-QKAKSIKVKIPRVQDVNTIDKYARLMFPLLFIIFNTSYWSVYLL 498          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. UniProt/SwissProt
Match: sp|O18276|GBRB_CAEEL (Gamma-aminobutyric acid receptor subunit beta OS=Caenorhabditis elegans OX=6239 GN=gab-1 PE=2 SV=3)

HSP 1 Score: 382.489 bits (981), Expect = 1.200e-124
Identity = 234/507 (46.15%), Postives = 308/507 (60.75%), Query Frame = 3
Query:  432 RLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXX-------XXXENSERSRINNTK--------------------LSHPIFTEN--KNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYSL 1865
            RLRP FG   + + M++++ASFDSISEV+MDYT+T+YL+QYW DERL ++       + + G+FS  IWVPDTFLANDK+S+LH+VTE+NKMLRI  DG++ YGMR ++TL+C M+L  +PLD QNCTVEIESYGY   +V M W N   AVH +E   + QFTI  +     + + +TG YQRLSL FQL R+VG+F+FQTYLP +LIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVR SLPRISYVK+ID+YLV+CFVFVF+ALLEYAAVNY++WG    +             +    S +N  K                    L   + T N    N++F    + K   +    P CR  N  S  +E +  + P        Y+ TS+   R  AS N++   H  GR               S   + R        S  + IS +       K    ++VRD+ +IDK+SR++FP+ FI+FN+ Y+  Y +
Sbjct:   68 RLRPGFGGDALLLTMDIIIASFDSISEVDMDYTLTMYLHQYWTDERLRWSNEIPIDEMTLSGEFSQNIWVPDTFLANDKHSYLHEVTERNKMLRINVDGKVAYGMRLTSTLSCSMNLRNFPLDSQNCTVEIESYGYTTSEVLMKW-NYPLAVHGVEQADVPQFTITGFHTEDSIVSTATGSYQRLSLVFQLRRSVGYFIFQTYLPCVLIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRQSLPRISYVKSIDIYLVMCFVFVFAALLEYAAVNYSYWGRERGKGGGGNEWPVNGANKEDRESAVNVQKWVPSGLMDGVPQPQDRRVEALEEAMSTSNTAAQNNNFESTSKPKKRSSSPIPPLCRAGNTIS--EESESPDYPR-------YSTTSLKGARPHASLNHKTH-HLKGRS--------------SARAKRRMTLARMNVSMKQSISGIGRR--ARKVIPTIRVRDVNLIDKYSRVVFPVCFIVFNLFYWSYYMM 547          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. UniProt/SwissProt
Match: sp|P50571|GBRB1_MOUSE (Gamma-aminobutyric acid receptor subunit beta-1 OS=Mus musculus OX=10090 GN=Gabrb1 PE=1 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 1.806e-114
Identity = 215/504 (42.66%), Postives = 300/504 (59.52%), Query Frame = 3
Query:  357 HSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENS--ERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTE-NREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            HSSNE   +     T+  L+K YD RLRP FG  P+ + M + VAS D +SEVNMDYT+T+Y  Q W+D+RL++  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W  G  AV  +  I + QF+IV+Y + +     +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTIST +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G+  ++K    ++ S  E++R+   K+                   + H   +      R  N  S  +     + P    K ++Y+  S       AS  YRK                    P+S+     R + ++  P K R    +R    + K K +  + D+  IDK+SR+ FPI+F LFN+ Y+  Y
Sbjct:   26 HSSNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSY--SGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNRLEMNKVQ-----------------VDAHGNILLSTLEIR--NETSGSEVLTGVSDP----KATMYSYDS-------ASIQYRK--------------------PLSSREGFGRGLDRHGVPGKGR----IRRRASQLKVK-IPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYY 472          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. UniProt/SwissProt
Match: sp|P18505|GBRB1_HUMAN (Gamma-aminobutyric acid receptor subunit beta-1 OS=Homo sapiens OX=9606 GN=GABRB1 PE=1 SV=2)

HSP 1 Score: 353.214 bits (905), Expect = 3.058e-114
Identity = 214/504 (42.46%), Postives = 301/504 (59.72%), Query Frame = 3
Query:  357 HSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENS--ERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMST-STENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            HS+NE   +     T+  L+K YD RLRP FG  P+ + M + VAS D +SEVNMDYT+T+Y  Q W+D+RL++  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W  G  AV  +  I + QF+IV+Y + +     +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTIST +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G+  ++K    ++ S  E++++   K+                   + H   +      R  N  S  +     + P    K ++Y+  S       AS  YRK                    P+S+     R + ++  PSK R    +R    + K K +  + D+  IDK+SR+ FPI+F LFN+ Y+  Y
Sbjct:   26 HSTNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSY--SGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQ-----------------VDAHGNILLSTLEIR--NETSGSEVLTSVSDP----KATMYSYDS-------ASIQYRK--------------------PLSSREAYGRALDRHGVPSKGR----IRRRASQLKVK-IPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYY 472          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. TrEMBL
Match: A0A2Z5X785 (Gamma-aminobutyric acid receptor subunit beta A OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 427/528 (80.87%), Postives = 471/528 (89.20%), Query Frame = 3
Query:  288 WIFWNFLSIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTK--NLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYSL 1865
            WI+WN +SI  +   ++SS   F SSNEY+ LKNAS+TISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFN SHA AMI MPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDG+IFYGMRF+TTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTI +YDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAKQKKKK+KEN +RSR N TKLS P+F ++ NND F F+ ENK+N+ +FPK S  D NLYSC +E+Q +  PHNRIK   Y + S+N+++F++S+NYRKF+H+F +K++SGINDYFEEIPMS S E+ E+F NQK +     SN +  FC+SK+K  +L KVR+IKIIDKFSRILFPI F+LFNI YFCIYSL
Sbjct:    6 WIYWNSISILGFFIGLNSSIQNFQSSNEYDHLKNASVTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNASHAGAMITMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGKIFYGMRFTTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTINSYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAKQKKKKLKENYDRSRTNLTKLSQPLFPDDMNNDLFLFNSENKNNEVVFPKTSSPDHNLYSCHREYQASGFPHNRIKSCSYTSNSVNSKKFRSSKNYRKFMHKFSKKYSSGINDYFEEIPMSASIEHTEIFNNQKTNTNPRQSNWKSQFCQSKSKHLHLPKVRNIKIIDKFSRILFPICFLLFNICYFCIYSL 533          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. TrEMBL
Match: R7UBK0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_144043 PE=3 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 6.201e-157
Identity = 271/496 (54.64%), Postives = 348/496 (70.16%), Query Frame = 3
Query:  381 LKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWK-NGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYSL 1865
            L+N S TI+NL++ YD RLRP+FG   + I+M+L++ASFDSISEVNMDYTIT+YLNQYW+DERLAF+ ++ D  + + GDF+ +IWVPDTF ANDK+SFLHDVTEKNKM+R++GDG + YGMRF+TTLACMMDLHYYPLD QNCTVEIESYGYP+ DV M WK  G +AV  +  + + QFTIV+Y   + V  L+TG YQRLSL F++ RN+G+F+FQTYLPSILIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAID+YLV+CFVFVF+ALLEYAAVNYT+WG RAK+K K++KE ++ ++       H     N +  SF  +     +  + P  S R+      ++ F F +     +  S+  N  M     +A+   R    +  RK N           +STS   ++MF N K  K +EI            + +  V+D+  IDK+SR++FP  FI+FN+ Y+C Y L
Sbjct:   38 LQNVSRTIANLLEKYDIRLRPQFGGEALIIEMKLLLASFDSISEVNMDYTITIYLNQYWKDERLAFSDNY-DETMTLTGDFAEKIWVPDTFFANDKHSFLHDVTEKNKMVRLHGDGSLVYGMRFTTTLACMMDLHYYPLDVQNCTVEIESYGYPMQDVVMKWKGGGEDAVDGVAKVEIPQFTIVDYRCISTVEKLATGSYQRLSLSFKMERNIGYFIFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNYTYWGARAKRKAKRLKEQAKANQ------EHQYQRVNCSIVSFQNEAIELQDVRMSPILSLRN------RQNFNFDSED---VAQSMAPNFRMQTAVPRATYPIRGGHTQLLRKRN-----------VSTSKNRKKMFTNLK-KKAKEIR-----------QKIPSVKDVNKIDKYSRLVFPSLFIVFNVCYWCFYLL 494          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. TrEMBL
Match: A0A1I8MLG2 (Uncharacterized protein OS=Musca domestica OX=7370 GN=101891413 PE=3 SV=1)

HSP 1 Score: 457.218 bits (1175), Expect = 5.773e-152
Identity = 258/506 (50.99%), Postives = 335/506 (66.21%), Query Frame = 3
Query:  381 LKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNV-----------SHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYSL 1865
            L+N + TI+ ++K YD RLRP FG  P+ + M+L +ASFD+ISEVNMDYTIT+YLNQYW+DERLAFN               + ++ + GDF+ +IWVPDTF ANDK SFLHDVTE+NK++R+ GDG + YGMRF+TTLACMMDLHYYPLD QNCTVEIESYGY + DV M WK     V  +E+  + QFTI+ Y+ +     L+TG+YQRLSL F+L RN+G+F+FQTYLPSILIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAID+YLV+CFVFVF+ALLEYAAVNYT+WG+RA       K+  +R +  ++K S     +     S   D+    +  + P PS R  N           NS  N + G+   + +     F+ +RNY                         T++ +   ++ Q+ +K R I  L+      K   + K++D+ IIDK+SR++FP+SF+ FN+GY+  Y L
Sbjct:   36 LENVTQTITKILKGYDIRLRPNFGGEPLHVGMDLTIASFDAISEVNMDYTITMYLNQYWRDERLAFNAYGPYYDDDADDDGVNDVLTLSGDFAEKIWVPDTFFANDKNSFLHDVTERNKLVRLGGDGSVTYGMRFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVSDVVMYWKP--TPVRGVEDAQLPQFTIIGYETNDRKERLATGVYQRLSLSFKLQRNIGYFIFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNYTYWGKRA-------KKKVKRGKDGDSKKSGK--QDKSETCSTAEDIIELQDVRMSPIPSLRKGNY----------NSTLNSL-GAETLDLAKFPPSFRIARNY------------------------GTTSRSNLRYRGQRGNKPRVIHALKKGASAIKA-TIPKIKDVNIIDKYSRMVFPVSFMAFNLGYWLFYIL 494          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. TrEMBL
Match: A0A5N4ANR0 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_06803 PE=4 SV=1)

HSP 1 Score: 456.062 bits (1172), Expect = 1.265e-151
Identity = 260/513 (50.68%), Postives = 329/513 (64.13%), Query Frame = 3
Query:  321 WICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            W C I +       +   + L N + TIS L++ YD RLRP FG  P+ + M+L +ASFD+ISEVNMDYTIT+YLNQYW+DERLAF  S  + ++ + GDF+ +IWVPDTF ANDK SFLHDVTE+NK++R+ GDG I YGMRF+TTLACMMDLHYYPLD QNCTVEIESYGY + DV M WK     V  +E   + QFTI+ Y+ +     L+TG+YQRLSL F+L RN+G+FVFQTYLPSILIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAID+YLV+CFVFVF+ALLEYAAVNYT+WG RA           +  +    +   P     K+ D+ +      HN+ I      R   + S +     + S      G +      +  +F  S        R  R    G N      P ST        +     K +    +R   C  K  ++ K++D+ +IDK+SRI+FP++F+LFN+GY+  Y
Sbjct:   12 WYCCIIAGSVGIKKTMVSDRLDNVTQTISKLLEGYDIRLRPNFGGDPLRVGMDLTIASFDAISEVNMDYTITMYLNQYWKDERLAF--STDEEILTLSGDFAEKIWVPDTFFANDKNSFLHDVTERNKLVRLNGDGAITYGMRFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVMDVVMYWKE--TPVRGVEEAELPQFTIIGYETNDRKERLATGIYQRLSLSFKLQRNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNYTYWGARA---------KKKSKKSKEVEEKRP---GTKSTDTTY----QPHNEDIIELQDVRMSPIASIRNRHNSSKSTSGGATGEV------DPSKFPPS-------FRISRSVGYGFN------PRSTPGLRYRGSKGNPLHKPKVFHVIRKGACALKA-SMPKIKDVNVIDKYSRIIFPVTFLLFNVGYWAFY 484          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. TrEMBL
Match: A0A1I8PT20 (Uncharacterized protein OS=Stomoxys calcitrans OX=35570 GN=106095898 PE=3 SV=1)

HSP 1 Score: 456.062 bits (1172), Expect = 1.345e-151
Identity = 258/506 (50.99%), Postives = 334/506 (66.01%), Query Frame = 3
Query:  381 LKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNV-----------SHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYSL 1865
            L+N + TI+ ++K YD RLRP FG  P+ + M+L +ASFD+ISEVNMDYTIT+YLNQYW+DERLAFN               + ++ + GDF+ +IWVPDTF ANDK SFLHDVTE+NK++R+ GDG + YGMRF+TTLACMMDLHYYPLD QNCTVEIESYGY + DV M WK     V  +E+  + QFTI+ Y+ +     L+TG+YQRLSL F+L RN+G+F+FQTYLPSILIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAID+YLV+CFVFVF+ALLEYAAVNYT+WG+RA       K+  +R +  + K S     +     S   D+    +  + P PS R  N           NS  N + G+   + +     F+ +RNY                         T++ +   ++ Q+ +K R I  L+      K   + K++D+ IIDK+SR++FP+SF+ FN+GY+  Y L
Sbjct:   36 LENVTQTITKILKGYDIRLRPNFGGEPLHVGMDLTIASFDAISEVNMDYTITMYLNQYWRDERLAFNAYGPYYDDDADDDGVNDVLTLSGDFAEKIWVPDTFFANDKNSFLHDVTERNKLVRLGGDGSVTYGMRFTTTLACMMDLHYYPLDSQNCTVEIESYGYTVSDVVMYWKP--TPVRGVEDAQLPQFTIIGYETNDRKERLATGVYQRLSLSFKLQRNIGYFIFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDIYLVMCFVFVFAALLEYAAVNYTYWGKRA-------KKKVKRGKDGDIKKSGK--PDKSETCSTAEDIIELQDVRMSPIPSLRKGNY----------NSTLNSL-GAETLDLAKFPPSFRIARNY------------------------GTTSRSNLRYRGQRGNKPRVIHALKKGASAIKA-TIPKIKDVNIIDKYSRMIFPVSFMAFNLGYWLFYIL 494          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Cavefish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:NCBI gene;Acc:103041149])

HSP 1 Score: 372.089 bits (954), Expect = 4.572e-122
Identity = 230/516 (44.57%), Postives = 313/516 (60.66%), Query Frame = 3
Query:  357 HSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSN----QIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKP-SCRDPNLYSCQKEFQFANSP----------HNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
             S+NE   +     T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+      A IP+     N    Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G NAV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E +E++                NND   +D      +A   KP S +  N     +  +  +S           HN + G+    TS++  R   S  +           NSGI    +  P   +T +  + +N +P K R    LR    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y
Sbjct:   26 QSANEPGNMSFVKETVDKLLKGYDIRLRPDFGGAPVAVGMSIDVASIDMVSEVNMDYTLTMYFQQYWRDKRLAY------AGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWKGGDNAVTGVSRIELPQFSIVDYKLVSRNVVFSTGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG-RGPQMQKKLAEKAEKA----------------NNDRTKYDGNKSVQEAGNCKPSSVKQSNQVQGHRHSRGVDSQGNILLTTLEIHNEVAGN-EVTTSVSEARNSTSMVFD----------NSGIQYRKQSAPRHDTTRH-SVDRNAQPKKAR----LRRRSSQLKIK-IPDLTDVNAIDRWSRIIFPAVFSLFNLIYWLYY 501          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Cavefish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:NCBI gene;Acc:103041149])

HSP 1 Score: 370.933 bits (951), Expect = 2.588e-121
Identity = 230/515 (44.66%), Postives = 313/515 (60.78%), Query Frame = 3
Query:  360 SSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSN----QIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKP-SCRDPNLYSCQKEFQFANSP----------HNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            S+NE   +     T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+      A IP+     N    Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G NAV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E +E++                NND   +D      +A   KP S +  N     +  +  +S           HN + G+    TS++  R   S  +           NSGI    +  P   +T +  + +N +P K R    LR    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y
Sbjct:   48 SANEPGNMSFVKETVDKLLKGYDIRLRPDFGGAPVAVGMSIDVASIDMVSEVNMDYTLTMYFQQYWRDKRLAY------AGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWKGGDNAVTGVSRIELPQFSIVDYKLVSRNVVFSTGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG-RGPQMQKKLAEKAEKA----------------NNDRTKYDGNKSVQEAGNCKPSSVKQSNQVQGHRHSRGVDSQGNILLTTLEIHNEVAGN-EVTTSVSEARNSTSMVFD----------NSGIQYRKQSAPRHDTTRH-SVDRNAQPKKAR----LRRRSSQLKIK-IPDLTDVNAIDRWSRIIFPAVFSLFNLIYWLYY 522          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Cavefish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:NCBI gene;Acc:103041149])

HSP 1 Score: 367.466 bits (942), Expect = 1.885e-120
Identity = 227/504 (45.04%), Postives = 307/504 (60.91%), Query Frame = 3
Query:  360 SSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSN----QIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            S+NE   +     T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+      A IP+     N    Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G NAV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E +E++                NND   +D     +Q           N+     E       HN + G+    TS++  R   S  +           NSGI    +  P   +T +  + +N +P K R    LR    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y
Sbjct:   48 SANEPGNMSFVKETVDKLLKGYDIRLRPDFGGAPVAVGMSIDVASIDMVSEVNMDYTLTMYFQQYWRDKRLAY------AGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWKGGDNAVTGVSRIELPQFSIVDYKLVSRNVVFSTGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG-RGPQMQKKLAEKAEKA----------------NNDRTKYDGNKVDSQG----------NILLTTLEI------HNEVAGN-EVTTSVSEARNSTSMVFD----------NSGIQYRKQSAPRHDTTRH-SVDRNAQPKKAR----LRRRSSQLKIK-IPDLTDVNAIDRWSRIIFPAVFSLFNLIYWLYY 495          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Cavefish
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4-like [Source:NCBI gene;Acc:103032374])

HSP 1 Score: 352.058 bits (902), Expect = 3.224e-114
Identity = 219/526 (41.63%), Postives = 318/526 (60.46%), Query Frame = 3
Query:  306 LSIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWG----ERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTS-MNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQK--PSKTREISNLRFHFCRSKTK-NLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            L++   IC +  + T    S        A  T+  L+K YD RLRP FG  P+ + M + +AS DSISEVNMDYTIT+Y  Q W+D+RLA+        + +    ++Q+W+PDT+  NDK SFLH VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G+NAV  ++ + + QF+IV   + +     +TG Y RLSL F++ RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALG+TTVLTMTTI+T +R +LP+I YVKAIDVYL+ CFVFVF ALLEYA VNY F+G    ++ K  ++  K N+ER R  + +L      ++  +  F  +    + Q           NLY  ++     ++  N +  ++  N   M +    +  + R  +  F    +SG+   F + PM++    R+ F +     S  R  +N R     SK K  +  + D+  IDK+SR++FPI+F  FN+ Y+  Y
Sbjct:   16 LTVLSSICFVQCTSTGTGISV-------AKTTVDKLLKGYDIRLRPDFGGPPVIVGMSINIASIDSISEVNMDYTITMYFQQSWRDKRLAY--VEMPLNLTLDNRVADQLWLPDTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGKNAVTGVDKLELPQFSIVELHLVSREVRFTTGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVFFGRGPQQQKKINERLNKANNERPRYEDKRLRE----QDSISAPFQTNTLRSYTQR---------RNLYLEEQRKVGVDAYGNILLTTLEMNNEVMPSDVGSSVSDSRNSVMSFD---SSGVQ--FRK-PMAS----RDGFSHHSLDRSAMRSRANCRLRRRSSKLKLKIPNLTDVSTIDKWSRVIFPITFGFFNLIYWLYY 509          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Cavefish
Match: gabrb1 (gamma-aminobutyric acid type A receptor beta1 subunit [Source:ZFIN;Acc:ZDB-GENE-090313-230])

HSP 1 Score: 348.591 bits (893), Expect = 1.416e-113
Identity = 210/508 (41.34%), Postives = 303/508 (59.65%), Query Frame = 3
Query:  357 HSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGE----RAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKV---RDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            HS NE   +    +T+  L+K YD RLRP FG  P+ + M + ++S D +SEVNMDYTIT+Y  Q W+D+RL++  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G ++V  ++NI + QF+I++Y   +     +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G     + K  +K  K N+E+SR+   K+   +   + N    + DL     + +    S  DP        F F +                      AS  YRK                    P++     R+++     S  R I++ + H  R   +  +K+    D+  IDK+SR++FPI++  FN+ Y+  Y
Sbjct:   12 HSGNEPSNMSYVKVTVDKLLKGYDIRLRPDFGGPPVDVGMSIDISSIDMVSEVNMDYTITMYFQQSWRDKRLSY--TGIPLNLTLDNRVADQLWVPDTYFINDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWQEG-SSVTGVDNIELPQFSIIDYKTLSKKVVFATGSYPRLSLSFKLKRNIGYFILQTYMPSNLITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGRGPHLQKKVAEKAAKSNNEKSRLECNKVQ--VVDAHGNIPLTNLDLRLTGAEML---GSLGDPR----NTMFSFDS----------------------ASIQYRK--------------------PLT----GRDLYGRPTASLERPITHKKSHLRRRAAQLKVKIPDLTDVNAIDKWSRVIFPITYTFFNLVYWLYY 461          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000073.1 (pep scaffold:Pmarinus_7.0:GL476340:503477:541718:1 gene:ENSPMAG00000000064.1 transcript:ENSPMAT00000000073.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 272.322 bits (695), Expect = 3.763e-85
Identity = 136/317 (42.90%), Postives = 205/317 (64.67%), Query Frame = 3
Query:  339 SSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXX----XXXXXXXXXXRSSLPRI-SYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            S+   +  S EY+        I NLM+ Y+  LRP F +GP++I M L +AS D+ISE+NMDYT T++L Q WQDERL F     +  + + G     +WVPDTF+ + K SFLHD+T +N+++RI+ +G + Y +R +TT+AC MDL  YP+D+Q CT+++ES+GY  +D+   W  G ++V  ++ + + Q+T+  Y      +   TG Y +L   F+L RN+ +F+ +TY+PS+L+V+LSWVSFWIS  +  AR+ +G        LTMTT+  G R+SLP    ++KAIDVYL +CF F+F AL+EYA  ++
Sbjct:   16 STRAAYQGSQEYKEGDALPQKIQNLMRGYNKYLRPSFDNGPVAIGMSLDIASIDTISEINMDYTATIFLRQRWQDERLCF---EGNKSLSLDGRLVELLWVPDTFIVDSKRSFLHDITVENRLIRIFPNGTVLYALRITTTVACNMDLTKYPMDKQTCTLQLESWGYNTNDLVFYWTRGNDSVRGLDTLKLAQYTVEGYYTSVSEAVYETGQYPKLVFHFKLRRNILYFILETYIPSVLLVVLSWVSFWISQSSVPARICIGTNAGVTTVLTMTTLMMGARTSLPNANCFIKAIDVYLGICFSFIFGALVEYAVAHF 329          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008467.1 (pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 gene:ENSPMAG00000007648.1 transcript:ENSPMAT00000008467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 238.424 bits (607), Expect = 5.452e-72
Identity = 139/292 (47.60%), Postives = 188/292 (64.38%), Query Frame = 3
Query:  420 NYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPG---DFSN--QIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVN-YDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYT 1277
             Y+ R+RP FG   +++   + + SF SI E   DY +T+YL Q W D RLA+  SH     P+P    D SN   IW PD F  N+K +  H++T  NKMLRI  +G + Y MR + TL+C MDLH +P+D Q C++ +ES+GY   D+   W NG   V   E + + QF + N     +     STG +  +   F LHR +GF++ Q Y+PSILIV+LSWVSFWI+ EA  ARVALGITTVLT+TT STG R+SLP++SY+KA+D+++  C +FVF+ALLEYAAVN T
Sbjct:   55 GYNHRVRPNFGGPAVNVSCGVFIRSFGSIQEATSDYRMTVYLRQRWTDPRLAY--SH----YPVPLLHLDQSNIKHIWKPDLFFDNEKSAHFHEITTDNKMLRIANNGVVDYAMRLTLTLSCPMDLHNFPMDTQMCSMYLESFGYTTADIVFHW-NGPTPVSLFEGLTLPQFVLSNKISTGSCTKTYSTGSFTCIFAKFTLHREMGFYLIQLYVPSILIVILSWVSFWINMEAAPARVALGITTVLTLTTQSTGARASLPKVSYIKAMDIWMATCLLFVFAALLEYAAVNVT 339          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Sea Lamprey
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 233.032 bits (593), Expect = 1.032e-70
Identity = 124/274 (45.26%), Postives = 186/274 (67.88%), Query Frame = 3
Query:  459 PMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVN-YDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYT 1277
            P+++   + + SF SI+E  MDY + ++L Q W D RLA++  + D  + +     + IW PD F AN+K +  H+VT  NK+LRI+ DG + Y +R + TL+C MDL  +P+D Q C +++ES+GY ++D+   WK    AV   E + + QF + +  D+     + +TG +  + + F L R +G+++ Q Y+PS+LIV+LSWVSFWI+ +A  ARVALGITTVLTMTT S+G R+SLP++SYVKAID+++ VC +FVF+ALLEYAAVN+ 
Sbjct:    5 PVNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYS-EYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKDGNVLYSIRLTLTLSCPMDLKNFPMDVQTCAMQLESFGYTMNDLIFEWKQ-EGAVQVAEGLTLPQFVLKDEKDLVYCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFV 276          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Sea Lamprey
Match: gabra6a (gamma-aminobutyric acid (GABA) A receptor, alpha 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1692])

HSP 1 Score: 215.698 bits (548), Expect = 1.111e-62
Identity = 118/299 (39.46%), Postives = 176/299 (58.86%), Query Frame = 3
Query:  384 KNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNI--ENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            +N +  +  L+  YD+RLRP FG     +  ++ V SF  +S+V MDYT+ ++  Q W DERL F+      ++ +     N+IW PDT+  N K S  H++T  NK+ RI  +G + Y MR +    C M L  +P+D   C ++  SY YP  ++  SW  G N    +  E+  ++Q+ +  ++V +       G Y  +++ F L R +G+F+ QTY+P I+ V+LS VSFWI+ E+  AR   GITTVLTMTT S   R SLP++SY  A+D ++ V F FVFSAL+E+AAVNY
Sbjct:   43 ENITKILDRLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMDYTMDVFFRQTWVDERLKFD--GPIEILRLNNLMVNRIWTPDTYFRNGKKSIAHNMTAPNKLFRIMQNGTVLYTMRLTINAECPMRLMDFPMDGHTCPLKFGSYAYPKSEIIYSWTKGANNSVEVPQESSSLLQYDLTGHNVSSEELKSKIGDYVVMTVSFYLKRKMGYFIVQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMTTQSISARGSLPKVSYATAMDWFIAVSFAFVFSALIEFAAVNY 339          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Sea Lamprey
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 204.527 bits (519), Expect = 8.701e-61
Identity = 142/371 (38.27%), Postives = 202/371 (54.45%), Query Frame = 3
Query:  771 MMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSER-SRINNTKLSHPIFTENKNNDSFH------FDLENKHNQAIFPKPSC-RDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            MMDL  YPLDE  CT+EIESYGY  +D+K  W+ G  A+  +  I + QFTIV ++  +     +TG Y RLSL F+L RN+G+F+ QTY+P+ILI +LSWVSFWI+++A++ARVALG+TTVLTMTTIST +R +LP+I YVKAID+YL+ CF FVF ALLEYAAVNY F+G       ++ K+ +ER +R NN K   P   +    D+         ++ N+     +  P    DP       +    + P  +++  +        R   A+R  R      GR                  T  R     +K    R  S L+          +  + ++  IDK+SR++FP++F  FN  Y+  Y
Sbjct:    1 MMDLRRYPLDEPFCTLEIESYGYTTEDIKFYWRGGDTAITGVGEIKLPQFTIVKHNQVSRNVQFATGSYPRLSLSFRLKRNIGYFILQTYMPTILITILSWVSFWINYDASAARVALGVTTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFCFVFLALLEYAAVNYLFFGR----GPQRAKKAAERIARANNEK---PRAADTSKVDAHGNILLTSLEIRNEMGGPGYGHPGLPGDPRATGLGLD-HHHHHPGVQLRQPVQGGGETLER---AARGER------GR-----------------GTLQRGQGGAKKTRLQRRTSQLKI--------KIPDLSNVNAIDKWSRVIFPVTFGFFNAVYWLYY 329          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Nematostella
Match: EDO35410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK4])

HSP 1 Score: 241.891 bits (616), Expect = 7.802e-75
Identity = 122/299 (40.80%), Postives = 195/299 (65.22%), Query Frame = 3
Query:  387 NASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWK---NGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            N++L + NL++ YD R+RP     P+ + +++ V++  ++ E+NMD+TI +YL QYW+DERL F      AM+ +  D + QIWVP T+    K ++ HDVT  N +L++  DG +FY +R + T +C +DL  +P D Q+C++ +ESYGY   DV   W    +  +A++  +++ + QF ++       ++  + G +  L   F++ R +G+F+  TY+PS +IV++SW+SFWI  E   ARVALGITTVLTMTT+ +  R++LP++SYVKAID YL++C +FVF ++LEY  V Y
Sbjct:   21 NSTLVLKNLLEGYDRRIRPGSKGEPVVVYVDMYVSNIWAMQEMNMDFTIDIYLRQYWRDERLQFETQTPGAMLTLSSDINKQIWVPSTYFLATKKAYFHDVTTDNYLLQVKPDGSLFYSIRLTITTSCRLDLRDFPHDTQSCSLSLESYGYQSTDVLYVWNERLDNTSAIYIHDDLELPQFEVLGVSRSAKMNKYNIGNHSSLVANFRMKRRIGYFLIDTYIPSTIIVIISWISFWIDPETAPARVALGITTVLTMTTLISSARANLPKVSYVKAIDWYLLLCLIFVFGSILEYTCVTY 319          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Nematostella
Match: EDO40478 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S763])

HSP 1 Score: 228.024 bits (580), Expect = 4.462e-70
Identity = 111/274 (40.51%), Postives = 184/274 (67.15%), Query Frame = 3
Query:  459 PMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSW-KN-GRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            P+ +  ++ V     ISE +M++ +  +  QYWQD RLA++ +  +  + +     + +W+PD +  N+K    HD+T++N+++R++ DGR+F+ +R S T +C M LH YP+D+Q C +  ES+ YP  ++   W KN G   V   + + + QF +  Y   +  +N +TG Y RL++ F+  R++GFF+ QTY+P+ LIVMLSW++FWI+H +T AR+ LGITTVLTMTT++   R+SLP++SYVK+I+ +L++CF++VF +L+EY  V+Y
Sbjct:    5 PVIVYTDMFVLDIGDISEADMEFRVMFFYRQYWQDTRLAYDYTGYNKRLALNARMVDYMWIPDIYFVNEKSGIKHDLTKQNEVVRVWPDGRVFHSIRLSMTASCPMKLHSYPMDKQTCKLSFESFSYPSTELIFKWNKNRGNKEVQVSDELQIPQFILTEYKTTSEFANFTTGSYSRLTVLFRFERSIGFFLIQTYIPAYLIVMLSWIAFWINHTSTPARIGLGITTVLTMTTLTNSARASLPKVSYVKSIEWFLIMCFLYVFMSLVEYGCVSY 278          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Nematostella
Match: EDO36340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ14])

HSP 1 Score: 220.32 bits (560), Expect = 5.003e-67
Identity = 126/293 (43.00%), Postives = 177/293 (60.41%), Query Frame = 3
Query:  399 TISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGR-NAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            T+  L  + D RLRP FG  P+ + +++ + +   IS  NMDY + LY  Q W D RLAF++  A   I + G   N IW+PDT   N+K S  H VT+ N +L I+ +G  +  MR S T  C MDL  YP+D Q C + I SY    D++ + WK G   +V   ENI++ Q  ++      +V   ++G Y RLSL F+  R +  F+ +TY+P +LIV LSWVSFWI+++   ARVAL ITTVLT+ T+S  VR+SLP+++Y K  D  L+   V+VF AL+EYA VNY
Sbjct:    1 TLDRLKSSMDKRLRPFFGGKPVVVYVDIYIVNIGEISVTNMDYKLMLYYRQTWHDPRLAFDLPEA---ITVQGGMLNDIWIPDTLFTNEKSSTFHKVTQDNYLLSIWPNGTTYLSMRISLTGICPMDLRKYPMDTQTCYLNIMSYSGSTDNLILKWKFGETGSVTWAENINLPQMDVLGVKGREVVDVFASGNYSRLSLAFKFKRRISLFLTETYVPLVLIVALSWVSFWINYKVAPARVALCITTVLTIITLSASVRTSLPKVTYTKYSDWILITGLVYVFGALVEYAVVNY 290          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Nematostella
Match: EDO37555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG6])

HSP 1 Score: 216.468 bits (550), Expect = 5.952e-64
Identity = 122/293 (41.64%), Postives = 179/293 (61.09%), Query Frame = 3
Query:  402 ISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKN-GRNAVHNIENIH-MIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            + NL++ YD RLRP FG  P+++ +   V S D+I+ ++MDY +  +L Q W+D RL       D  + +     ++IWVPDT+  N K S  H VT  NKML I  DG + Y  R +   +C M+L  +P D QNC ++IESYGY  D+V+  W+N   N +   + I  M Q+ + + +V    +    G +  L+  F+  R  G+F+   Y P  LIV+LSW+SF I  E+T+AR+ALGIT+VLT+TTI   + +S+P++SYVKA+D YL+ CF+FVF+ LLEY  V Y
Sbjct:   10 LDNLIQGYDPRLRPDFGGDPVTVTVGFWVLSIDAINVIDMDYRMDFFLRQLWRDPRLKHRF---DDTLALSNTMLDKIWVPDTYFVNSKMSKFHSVTTINKMLSISPDGLVHYNSRVTVKASCAMNLRMFPKDVQNCNIDIESYGYSADNVQYQWENRSDNGIAVNKKIRDMPQYNLSDINVSRHFTMYVAGNWSGLTATFRFRRRSGYFIIHIYAPCALIVILSWISFCIPPESTAARIALGITSVLTITTILNMLNNSMPKVSYVKAVDWYLIGCFLFVFAVLLEYTFVLY 299          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Nematostella
Match: EDO39173 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS4])

HSP 1 Score: 201.06 bits (510), Expect = 9.299e-60
Identity = 117/292 (40.07%), Postives = 171/292 (58.56%), Query Frame = 3
Query:  399 TISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAM-IPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVN-YDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAV 1268
             I  L   YD+RLRP FG  P++I + + V SF ++ E +M++++ ++  Q W+D RL     H+  M   +PG    + W+PDTF  N K +  H V   N  + +  DG I    R + + +C MDL  YPLD+Q C +EI SY + ++D+   WK   + +  I +  M +F + +        S   TG Y  L   F   R + +   Q Y P+ LIV+LSW+SFWIS +A  ARVALGITTVLT+ T+   +R+S+P++SY+KAID+YL+V F+FVF  LLEY AV
Sbjct:    8 AIDGLFVGYDNRLRPYFGGPPLNISVYMSVVSFSTVYEKDMEFSLDVFFKQAWRDPRL----RHSAKMPFILPGSQKEKFWIPDTFFLNVKTARFHQVPAANTRIVVTPDGDIELSERLTVSASCRMDLRMYPLDQQTCVLEILSYSFDINDIDYRWKAKEDLI--ILDGEMNEFELKDSRGERKQKSRSCTGTYTHLVAKFVFRRRLAYSFIQIYSPTFLIVVLSWLSFWISKDAVPARVALGITTVLTIVTLMGSLRNSVPKVSYIKAIDLYLIVSFIFVFGTLLEYIAV 293          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Medaka
Match: gabrb1 (gamma-aminobutyric acid type A receptor beta1 subunit [Source:NCBI gene;Acc:101154825])

HSP 1 Score: 350.132 bits (897), Expect = 5.245e-114
Identity = 212/506 (41.90%), Postives = 303/506 (59.88%), Query Frame = 3
Query:  363 SNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNA--VHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXE---NSERSRINNTKLS--HPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            +NE   +     T+  L+K YD RLRP FG  P+ + M + +AS D +SEVNMDYTIT+Y  Q W+D+RL++  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G NA  V  +ENI + QF+I++Y   +  +  +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G     +KK  ++   N  RSR+ ++++     I   N   +    D+ +          +  DP      +   F+           Y + S+  R+  ASR+       +GR                       + +   P K+R    LR    + K K +  + D+  IDK+SR++FPI+FI FN+ Y+  Y
Sbjct:   25 ANEPSNMSYVKATVDKLLKGYDIRLRPDFGGAPVDVGMSIDIASIDMVSEVNMDYTITMYFQQSWRDKRLSY--TGIPLNLTLDNRVADQLWVPDTYFINDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWQGGSNAGSVTGVENIELPQFSIIDYQTLSTKAVFATGSYPRLSLSFKLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGRGPHLQKKAAEKAKSNENRSRLESSRVDAHGSILLSNMPTEMGGPDMMS----------TLHDP------RATMFS-----------YDSASIQYRKPMASRDL------YGRP---------------------ALDRPLGPKKSR----LRRRASQLKVK-IPDLTDVNAIDKWSRVVFPITFIFFNLVYWLYY 469          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Medaka
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4 [Source:NCBI gene;Acc:101160433])

HSP 1 Score: 350.517 bits (898), Expect = 1.171e-113
Identity = 215/523 (41.11%), Postives = 314/523 (60.04%), Query Frame = 3
Query:  306 LSIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWG----ERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTS-MNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            L+   ++C + SS T          +  A  T+  L+K YD RLRP FG  P+ + M + +AS DSISEVNMDYTIT+Y  Q W D+RLA+     D  + +    ++Q+W+PDT+  NDK SFLH VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G +AV  ++ + + QF+IV   + +     +TG Y RLSL F++ RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALG+TTVLTMTTI+T +R +LP+I YVKAIDVYL+ CFVFVF ALLEYA VNY F+G    ++ K  ++  K N+ER+R    +L        +  DS     +    ++       +  NLY  ++     ++  N +  ++  N   M +    +  + R  +  F    +SG+   F + PM+          ++   ++R    LR    + K K +  + D+  IDK+SR++FPI F  FN+ Y+  Y
Sbjct:   16 LAALSFVCFVQSSSTGNTG------MSVAKTTVDKLLKGYDIRLRPDFGGPPVIVGMSINIASIDSISEVNMDYTITMYFQQSWTDKRLAYG--ELDLNLTLDNRVADQLWLPDTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGNSAVTGVDKLELPQFSIVELRLVSREVRFATGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVFFGRGPAQQKKLSERLGKVNNERTRYEEKRL--------REQDSISVPFQTNTFRSF-----TQRRNLYLEEQRKVGVDAYGNILLTTLDMNNEVMPSDVGSSVSDSRNSVMSFD---SSGVQ--FRK-PMAPRDGYSHHSLDRSAMRSRANCRLRRRSSKLKLK-IPNLSDVSTIDKWSRVIFPIIFGFFNLIYWLYY 510          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Medaka
Match: GABRB2 (gamma-aminobutyric acid receptor subunit beta-2 [Source:NCBI gene;Acc:101167169])

HSP 1 Score: 348.206 bits (892), Expect = 3.346e-113
Identity = 218/522 (41.76%), Postives = 306/522 (58.62%), Query Frame = 3
Query:  324 ICQIHSSETRFHSS--NEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSN---LSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWG----ERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFA-NSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIY 1859
            +C    S   FHS   N+   +     T+  L+K YD RLRP FG  P+ + M + +AS D +SEVNMDYT+T+Y  Q W+D+RL++  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G  AV  +E I + QF+IV+   H L+S     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAIDVYL+ CFVFVF ALLEYA VNY F+G     + +  +K    N+E+ R++  K+       + + +     L+ K++  +                E     N P N +    Y ++++  R+   +R      H FGR                 +  +R M Q +K    R  S L+          +  + D+  IDK+SRI+FP  F  FNI Y+  Y
Sbjct:   13 MCTPFLSFLPFHSVGVNDPSNMPLVKQTVDRLLKGYDIRLRPDFGGPPVRVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSY--SEIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGVGAVTGVERIELPQFSIVD---HKLISKNVVFSTGAYPRLSLSFKLKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKRAAEKTALANNEKMRMDPNKM-------DPHENILLGTLDIKNDMGV---------------TELALGLNDPRNTML--TYDSSNLQYRKAGLAR------HNFGR-----------------NALDRHMTQ-KKSRLRRRASQLKI--------TIPDLTDVNSIDKWSRIIFPTVFSFFNIVYWLYY 473          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Medaka
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:NCBI gene;Acc:101165384])

HSP 1 Score: 345.895 bits (886), Expect = 4.791e-112
Identity = 221/496 (44.56%), Postives = 301/496 (60.69%), Query Frame = 3
Query:  399 TISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSN----QIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHP-IFTENKNNDSFHFDLENKHNQAIFPKPSCR---DPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYS 1862
            T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+        IP+     N    Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G  AV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E + ++    +K   P    E  N     F    + NQ    + S R     N+     E       HN + GS    T+++     +S  +           NSGI   + +           + +N    KTR    L+    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y+
Sbjct:   39 TVDKLLKGYDIRLRPDFGGPPVAVGMSIDVASIDMVSEVNMDYTLTMYFQQYWRDKRLAY------LGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWKGGDTAVTGVTRIELPQFSIVDYKLVSRNVVFSTGAYPRLSLSFKLRRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFG-RGPQMQKKLAEKALKANNERSKYEKPKSLLEGVN---CKFSSLKQSNQVQGRRHSQRVDSQGNILLTTLEI------HNEV-GSNEITTTLSETHNSSSMVFD----------NSGIQ--YRKQSAVHDPGRLSLDRNAHLKKTR----LQRRSSQLKIK-IPDLTDVNGIDRWSRIIFPSVFSLFNLIYWLYYA 500          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Medaka
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4 [Source:NCBI gene;Acc:101160433])

HSP 1 Score: 343.199 bits (879), Expect = 1.691e-111
Identity = 180/345 (52.17%), Postives = 244/345 (70.72%), Query Frame = 3
Query:  348 TRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWG----ERAXXXXXXXXENSERSRINNTKLSHPI 1370
            +R HSS     +  A  T+  L+K YD RLRP FG  P+ + M + +AS DSISEVNMDYTIT+Y  Q W D+RLA+     D  + +    ++Q+W+PDT+  NDK SFLH VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G +AV  ++ + + QF+IV   + +     +TG Y RLSL F++ RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALG+TTVLTMTTI+T +R +LP+I YVKAIDVYL+ CFVFVF ALLEYA VNY F+G    ++ K  ++  K N+ER+R    +L   +
Sbjct:    6 SRSHSSTGNTGMSVAKTTVDKLLKGYDIRLRPDFGGPPVIVGMSINIASIDSISEVNMDYTITMYFQQSWTDKRLAYG--ELDLNLTLDNRVADQLWLPDTYFLNDKKSFLHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIVFFWQGGNSAVTGVDKLELPQFSIVELRLVSREVRFATGSYPRLSLSFRIKRNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGVTTVLTMTTINTHLRETLPKIPYVKAIDVYLMGCFVFVFLALLEYAFVNYVFFGRGPAQQKKLSERLGKVNNERTRYEEKRLREQV 348          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Planmine SMEST
Match: SMESG000026005.1 (SMESG000026005.1)

HSP 1 Score: 1040.02 bits (2688), Expect = 0.000e+0
Identity = 526/526 (100.00%), Postives = 526/526 (100.00%), Query Frame = 3
Query:  288 WIFWNFLSIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAXXXXXXXXENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYSL 1865
            WIFWNFLSIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAKQKKKKMKENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYSL
Sbjct:    6 WIFWNFLSIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAKQKKKKMKENSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLYSCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNSGINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKVRDIKIIDKFSRILFPISFILFNIGYFCIYSL 531          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Planmine SMEST
Match: SMESG000018336.1 (SMESG000018336.1)

HSP 1 Score: 203.371 bits (516), Expect = 8.867e-59
Identity = 112/300 (37.33%), Postives = 174/300 (58.00%), Query Frame = 3
Query:  381 LKNASLTISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRN-AVHNIENIHMIQFTIVNYDVHTLVSNL-STGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            L N S+ ++ L+  YD  LRP     P+ I +++ + S   ISE+NM Y+   Y  Q WQD+RL F+      ++ +     + +W PDT+  N + S+LH++T  N  +RI+ DG I Y MR +    C M+LH +PLD Q C + I SYGY   D+   W    N +V +   + + QF ++N         +   G +  L++ F L RN+G+F+ Q YLP  L+V++SWV FWI+ EATS R+ LG+TTVLTM   S   R  LP++SY  A+D+Y+  C+ F+ + ++++A V+Y
Sbjct:   23 LNNISIHLNKLLDRYDRNLRPSNQGEPLIISIDINIRSMGPISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSMRLTIKATCPMELHRFPLDTQKCPLLIASYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHY 322          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Planmine SMEST
Match: SMESG000071005.1 (SMESG000071005.1)

HSP 1 Score: 189.889 bits (481), Expect = 1.245e-52
Identity = 116/314 (36.94%), Postives = 178/314 (56.69%), Query Frame = 3
Query:  375 ELLKNASL---TISNLMKNYDSRLRP-KFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFNVSHA----DAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQFTIVNYDVHTLVSNL----STGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYA-AVNYT 1277
            E +KN S+    I  + +NY     P +    P  + + + + + +SI  +NM +    YL Q W D RLA+    A       I +P  F N++W+PD F  N K  F++ +T  N ++R+  DG I Y  + +   +C M L  +P+D Q C + I SYGY +DD++  WK   +   + ++I + +F     +V T+  NL    STG Y  L L F L R +  ++  TY+P+ILIVM+SW+SFWIS EA  ARV LG+ T+L + T + GV  +LPR+SY+KAID+Y++ C +F+  A  E+A A NY+
Sbjct:   30 ESIKNPSIRDKIIVQIFENYKKHELPTEELLKPTIVIVNIHILAINSIDVINMAFNADFYLRQEWLDRRLAWTDQEAFRNFTRPISIPSMF-NKLWLPDLFFRNGKEGFMYKMTMPNFLIRLKSDGEILYSQKITMRFSCQMHLSNFPMDSQQCEINIGSYGYTMDDLRFQWKTNESVTQS-KDIQISEF-YTPVEVLTMDCNLNSKTSTGTYSCLKLLFTLKRQLSSYLVSTYIPAILIVMVSWLSFWISVEAVPARVTLGLLTLLGILTQNKGVSGNLPRVSYIKAIDIYIIACILFIIGAFTEFAIASNYS 340          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Planmine SMEST
Match: SMESG000032691.1 (SMESG000032691.1)

HSP 1 Score: 184.496 bits (467), Expect = 1.845e-51
Identity = 105/297 (35.35%), Postives = 174/297 (58.59%), Query Frame = 3
Query:  402 ISNLMKNYDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERLAFN----VSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRNAVHNIENIHMIQF---TIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVN 1271
            +  +++NY    RP   S    + + + V + +S++  NM+Y+  LYL Q W D RL ++      H ++ +  P    +++W+PD F  N K  ++H +T+ N ++R++ +G + Y  + +   +C MDL  YP+D Q+C + I SYGY LD +K  W    N +    N+ + +F   T V  +  T  S   TG Y  L   F L R +G ++  T++P+ LIV++SW++FW+S EA  AR+ LG+ T+L + T ++G+  +LPR+SY+KAIDV+L+ C VFV  ALLE+A  +
Sbjct:   35 MDKILQNYSLNERP-IESNQTRVMVFMKVLAINSVNVSNMEYSTDLYLRQLWVDARLRWDNLNEFKHFNSSLVSPS-LKDRLWLPDLFFRNGKEGYVHIMTKPNYLMRLFPNGEVLYSQKITMRFSCQMDLQTYPMDTQSCEMNIGSYGYTLDQLKFYWSQT-NPMELGNNVQIPEFNAPTKVETNDCTNSSTTETGFYSCLKALFILRRQLGSYLVSTFIPNTLIVIVSWLNFWVSVEAVPARITLGLLTLLGILTQASGISGNLPRVSYIKAIDVWLIACIVFVIGALLEFAVAS 328          
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Planmine SMEST
Match: SMESG000018336.1 (SMESG000018336.1)

HSP 1 Score: 181.415 bits (459), Expect = 3.509e-51
Identity = 100/259 (38.61%), Postives = 153/259 (59.07%), Query Frame = 3
Query:  504 ISEVNMDYTITLYLNQYWQDERLAFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYGDGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKNGRN-AVHNIENIHMIQFTIVNYDVHTLVSNL-STGLYQRLSLCFQLHRNVGFFVFQTYLPSILIVMLSWVSFWISHEATSARVAXXXXXXXXXXXXXXXXRSSLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNY 1274
            ISE+NM Y+   Y  Q WQD+RL F+      ++ +     + +W PDT+  N + S+LH++T  N  +RI+ DG I Y MR +    C M+LH +PLD Q C + I SYGY   D+   W    N +V +   + + QF ++N         +   G +  L++ F L RN+G+F+ Q YLP  L+V++SWV FWI+ EATS R+ LG+TTVLTM   S   R  LP++SY  A+D+Y+  C+ F+ + ++++A V+Y
Sbjct:    4 ISEMNMVYSFDCYFRQRWQDQRLKFDGVDHPKILQLNQKLLDTVWKPDTYFMNGEGSYLHNITLPNIFVRIHNDGNIVYSMRLTIKATCPMELHRFPLDTQKCPLLIASYGYNNHDLLYKWTQSPNRSVEHDNELTLSQFHLMNISESRSTKIIPGRGNFSILAVEFILKRNIGYFMIQQYLPCCLLVIISWVGFWINREATSDRITLGVTTVLTMAFSSVDNRKDLPKVSYATALDIYVNGCYTFIAATIIQFATVHY 262          
The following BLAST results are available for this feature:
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRB16.367e-11542.46gamma-aminobutyric acid type A receptor beta1 subu... [more]
GABRB24.158e-11341.25gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB24.158e-11341.25gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB31.083e-11242.83gamma-aminobutyric acid type A receptor beta3 subu... [more]
GABRB21.104e-11240.90gamma-aminobutyric acid type A receptor beta2 subu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gab-19.436e-12646.15Gamma-aminobutyric acid receptor subunit beta [So... [more]
lgc-383.289e-7942.15pep chromosome:WBcel235:III:7009136:7019574:1 gene... [more]
lgc-387.147e-7942.15pep chromosome:WBcel235:III:7009136:7019403:1 gene... [more]
unc-491.411e-7546.55Ionotropic GABA receptor subunit UNC-49B.3 [Sourc... [more]
unc-491.411e-7546.55Ionotropic GABA receptor subunit UNC-49B.3 [Sourc... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lcch31.158e-15152.28gene:FBgn0010240 transcript:FBtr0074129[more]
Rdl5.181e-7542.91gene:FBgn0004244 transcript:FBtr0333835[more]
Rdl5.181e-7542.91gene:FBgn0004244 transcript:FBtr0076534[more]
Rdl6.343e-7542.91gene:FBgn0004244 transcript:FBtr0309054[more]
Rdl1.029e-7442.91gene:FBgn0004244 transcript:FBtr0333834[more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrb36.716e-11943.87gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb36.716e-11943.87gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb32.946e-11843.96gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb41.134e-11342.71gamma-aminobutyric acid type A receptor beta4 subu... [more]
gabrb15.045e-11241.39gamma-aminobutyric acid type A receptor beta1 subu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp56.959e-11845.01dual specificity phosphatase 5 [Source:Xenbase;Acc... [more]
gabrb23.094e-11539.66gamma-aminobutyric acid (GABA) A receptor, beta 2 ... [more]
gabrb24.809e-11541.48gamma-aminobutyric acid (GABA) A receptor, beta 2 ... [more]
gabrb25.564e-11541.48gamma-aminobutyric acid (GABA) A receptor, beta 2 ... [more]
gabrb21.537e-11441.48gamma-aminobutyric acid (GABA) A receptor, beta 2 ... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gabrb12.582e-11542.66gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb35.683e-11343.67gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb35.806e-11343.67gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb31.659e-11243.67gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb21.624e-11053.01gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08832|GBRB3_DROME1.160e-15052.28Gamma-aminobutyric acid receptor subunit beta-like... [more]
sp|P26714|GBRB_LYMST5.135e-14749.90Gamma-aminobutyric acid receptor subunit beta OS=L... [more]
sp|O18276|GBRB_CAEEL1.200e-12446.15Gamma-aminobutyric acid receptor subunit beta OS=C... [more]
sp|P50571|GBRB1_MOUSE1.806e-11442.66Gamma-aminobutyric acid receptor subunit beta-1 OS... [more]
sp|P18505|GBRB1_HUMAN3.058e-11442.46Gamma-aminobutyric acid receptor subunit beta-1 OS... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Z5X7850.000e+080.87Gamma-aminobutyric acid receptor subunit beta A OS... [more]
R7UBK06.201e-15754.64Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1I8MLG25.773e-15250.99Uncharacterized protein OS=Musca domestica OX=7370... [more]
A0A5N4ANR01.265e-15150.68Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A1I8PT201.345e-15150.99Uncharacterized protein OS=Stomoxys calcitrans OX=... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrb34.572e-12244.57gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb32.588e-12144.66gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb31.885e-12045.04gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb43.224e-11441.63gamma-aminobutyric acid receptor subunit beta-4-li... [more]
gabrb11.416e-11341.34gamma-aminobutyric acid type A receptor beta1 subu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000073.13.763e-8542.90pep scaffold:Pmarinus_7.0:GL476340:503477:541718:1... [more]
ENSPMAT00000008467.15.452e-7247.60pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 ge... [more]
glra21.032e-7045.26glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
gabra6a1.111e-6239.46gamma-aminobutyric acid (GABA) A receptor, alpha 6... [more]
gabrb38.701e-6138.27gamma-aminobutyric acid type A receptor beta3 subu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354107.802e-7540.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404784.462e-7040.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363405.003e-6743.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375555.952e-6441.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391739.299e-6040.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrb15.245e-11441.90gamma-aminobutyric acid type A receptor beta1 subu... [more]
gabrb41.171e-11341.11gamma-aminobutyric acid receptor subunit beta-4 [S... [more]
GABRB23.346e-11341.76gamma-aminobutyric acid receptor subunit beta-2 [S... [more]
gabrb34.791e-11244.56gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb41.691e-11152.17gamma-aminobutyric acid receptor subunit beta-4 [S... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026005.10.000e+0100.00SMESG000026005.1[more]
SMESG000018336.18.867e-5937.33SMESG000018336.1[more]
SMESG000071005.11.245e-5236.94SMESG000071005.1[more]
SMESG000032691.11.845e-5135.35SMESG000032691.1[more]
SMESG000018336.13.509e-5138.61SMESG000018336.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013129 ID=SMED30013129|Name=Gamma-aminobutyric acid receptor subunit beta A|organism=Schmidtea mediterranea sexual|type=transcript|length=1889bp
AATTGATCCGGCGATCTGGAATCTGATTGGCTGAAATCGGCAGATGAATC
AAGGAAACCATCAGCTGTATTAAATGGGAAAATTTTTAGTTTTCCTGAGT
TGTCGTTTTCTTTTTTGTCAAAACATACAAACACAGTTTCAAAACTGACG
TGGAACAATTTCCCAAGGATAATTTCCATTTCTGAATGTATTATTGGTTC
ATTTTATCCACGGTAATCGATAAATGTTTTCATAGACAATTTCGGATGTT
ATTCTCCTTGTCACTCTGATTAATGGAATTTCAGTTGTGGATTTTTTGGA
ATTTTCTCTCAATATTTCGATGGATTTGTCAAATTCATTCTTCTGAAACT
CGATTCCATTCTTCAAATGAATATGAACTTTTGAAAAATGCCTCTTTGAC
AATCTCTAACCTCATGAAAAACTACGACAGTCGACTGAGACCAAAATTCG
GATCCGGTCCAATGAGCATTGATATGGAACTGGTTGTGGCAAGCTTTGAT
TCGATTTCAGAAGTAAACATGGATTACACAATTACTCTCTATCTTAACCA
ATACTGGCAAGATGAGAGATTAGCTTTCAATGTTTCCCATGCTGACGCTA
TGATCCCGATGCCGGGGGATTTCTCTAATCAGATTTGGGTGCCGGACACT
TTTCTGGCAAATGATAAATACTCATTTTTACACGATGTCACAGAGAAAAA
TAAAATGCTCAGGATTTATGGCGATGGTAGAATATTCTATGGAATGAGGT
TTTCTACTACTCTCGCCTGCATGATGGATTTACATTATTATCCGCTGGAT
GAGCAAAATTGCACTGTCGAAATTGAGAGCTATGGGTATCCGTTGGATGA
TGTGAAAATGAGCTGGAAGAACGGCCGGAATGCTGTGCATAATATTGAGA
ATATTCATATGATACAATTCACGATAGTCAACTATGACGTTCACACCCTT
GTTTCAAATCTGTCAACAGGGCTTTATCAGAGATTGTCTCTATGCTTTCA
ACTTCACAGAAATGTTGGATTTTTCGTCTTCCAAACATATTTGCCGTCCA
TTCTGATCGTTATGCTCAGTTGGGTATCATTTTGGATCAGCCATGAAGCA
ACTTCCGCTAGAGTAGCACTGGGAATTACTACAGTTTTAACCATGACTAC
TATCAGTACAGGTGTAAGATCTTCACTGCCTCGAATCTCATATGTAAAAG
CCATAGATGTATATCTAGTAGTTTGTTTTGTCTTCGTGTTCTCAGCTTTA
CTAGAATATGCTGCTGTCAATTATACATTTTGGGGTGAGAGAGCAAAACA
GAAAAAGAAGAAGATGAAAGAAAATTCTGAAAGAAGCCGTATCAATAACA
CGAAACTTTCACATCCAATTTTTACAGAGAATAAGAATAATGATTCATTT
CATTTTGATTTAGAAAATAAACATAATCAAGCTATTTTTCCTAAACCGTC
ATGTCGTGATCCTAATTTATATTCATGTCAAAAAGAATTTCAATTCGCAA
ATTCTCCTCACAACCGAATCAAGGGCTCCATTTATGCAAACACTTCCATG
AACAATAGGAGATTCCAGGCATCACGAAACTATCGAAAATTTATTCACAG
ATTCGGCAGGAAATTCAATTCAGGCATTAATGACTATTTTGAAGAAATTC
CGATGTCGACATCAACAGAAAATAGAGAAATGTTCCAGAATCAGAAACCC
TCGAAGACCCGTGAGATATCAAACCTAAGATTTCATTTTTGTCGTTCGAA
AACGAAAAATTTACTGAAAGTTAGAGATATTAAAATTATTGACAAGTTCA
GCAGAATACTTTTCCCAATATCTTTCATATTGTTTAATATTGGGTATTTT
TGTATTTATTCGTTATGAATGACAAGAATATTTTTCTAC
back to top

protein sequence of SMED30013129-orf-1

>SMED30013129-orf-1 ID=SMED30013129-orf-1|Name=SMED30013129-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=532bp
MEFQLWIFWNFLSIFRWICQIHSSETRFHSSNEYELLKNASLTISNLMKN
YDSRLRPKFGSGPMSIDMELVVASFDSISEVNMDYTITLYLNQYWQDERL
AFNVSHADAMIPMPGDFSNQIWVPDTFLANDKYSFLHDVTEKNKMLRIYG
DGRIFYGMRFSTTLACMMDLHYYPLDEQNCTVEIESYGYPLDDVKMSWKN
GRNAVHNIENIHMIQFTIVNYDVHTLVSNLSTGLYQRLSLCFQLHRNVGF
FVFQTYLPSILIVMLSWVSFWISHEATSARVALGITTVLTMTTISTGVRS
SLPRISYVKAIDVYLVVCFVFVFSALLEYAAVNYTFWGERAKQKKKKMKE
NSERSRINNTKLSHPIFTENKNNDSFHFDLENKHNQAIFPKPSCRDPNLY
SCQKEFQFANSPHNRIKGSIYANTSMNNRRFQASRNYRKFIHRFGRKFNS
GINDYFEEIPMSTSTENREMFQNQKPSKTREISNLRFHFCRSKTKNLLKV
RDIKIIDKFSRILFPISFILFNIGYFCIYSL*
back to top
Aliases
The feature 'Gamma-aminobutyric acid receptor subunit beta A' has the following synonyms
Synonym
Smed_11992
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0004890GABA-A receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0005254chloride channel activity
GO:0022851GABA-gated chloride ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR002289GABAAb_rcpt
IPR006201Neur_channel
IPR006028GABAA/Glycine_rcpt
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0006821chloride transport
GO:0007165signal transduction
GO:0034220ion transmembrane transport
GO:1902476chloride transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0034707chloride channel complex
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:1902711GABA-A receptor complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 86..102
score: 39.77
coord: 242..254
score: 31.53
coord: 166..180
score: 50.5
coord: 120..131
score: 50.9
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 18..529
e-value: 1.5E-140
score: 467.0
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 26..372
IPR002289Gamma-aminobutyric-acid A receptor, beta subunitPRINTSPR01160GABAARBETAcoord: 305..317
score: 73.68
coord: 497..511
score: 38.6
coord: 205..218
score: 33.08
IPR006028Gamma-aminobutyric acid A receptor/Glycine receptor alphaPRINTSPR00253GABAARECEPTRcoord: 251..271
score: 62.41
coord: 311..332
score: 60.1
coord: 509..529
score: 47.49
coord: 277..298
score: 61.3
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 44..246
e-value: 2.3E-47
score: 161.2
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 255..526
e-value: 5.4E-42
score: 144.5
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 28..245
e-value: 1.2E-75
score: 255.3
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 44..247
NoneNo IPR availablePANTHERPTHR18945:SF571GAMMA-AMINOBUTYRIC ACID RECEPTOR SUBUNIT BETA-3coord: 26..372
NoneNo IPR availableCDDcd19006LGIC_ECD_GABAAR_LCCH3-likecoord: 63..247
e-value: 2.14517E-102
score: 303.609
NoneNo IPR availableCDDcd19049LGIC_TM_anioncoord: 250..334
e-value: 8.06876E-54
score: 175.333
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.549
NoneNo IPR availableTMHMMTMhelixcoord: 250..272
NoneNo IPR availableTMHMMTMhelixcoord: 509..528
NoneNo IPR availableTMHMMTMhelixcoord: 313..335
NoneNo IPR availableTMHMMTMhelixcoord: 279..298
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 166..180
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 249..530