Gamma-aminobutyric acid receptor subunit beta A

NameGamma-aminobutyric acid receptor subunit beta A
Smed IDSMED30013129
Length (bp)1889
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of Gamma-aminobutyric acid receptor subunit beta A (SMED30013129) t-SNE clustered cells

Violin plots show distribution of expression levels for Gamma-aminobutyric acid receptor subunit beta A (SMED30013129) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gamma-aminobutyric acid receptor subunit beta A (SMED30013129) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gamma-aminobutyric acid receptor subunit beta A (SMED30013129) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 7

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30013129h1SMcG0018726 SmedASXL_008288SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30013129h1SMcG0000248 Contig5618newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013129h1SMcG0000248 Contig5618uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013129h1SMcG0018726 Contig5618newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013129h1SMcG0018726 Contig5618uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30013129h1SMcG0018726 dd_Smed_v4_25116_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013129h1SMcG0018726 dd_Smed_v6_25116_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Human
Match: GABRB1 (gamma-aminobutyric acid type A receptor beta1 subunit [Source:HGNC Symbol;Acc:HGNC:4081])

HSP 1 Score: 353.214 bits (905), Expect = 6.367e-115
Identity = 214/504 (42.46%), Postives = 301/504 (59.72%), Query Frame = 3
            HS+NE   +     T+  L+K YD RLRP FG  P+ + M + VAS D +SEVNMDYT+T+Y  Q W+D+RL++  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W  G  AV  +  I + QF+IV+Y + +     +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTIST +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G+  ++K    ++ S  E++++   K+                   + H   +      R  N  S  +     + P    K ++Y+  S       AS  YRK                    P+S+     R + ++  PSK R    +R    + K K +  + D+  IDK+SR+ FPI+F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 348.591 bits (893), Expect = 4.158e-113
Identity = 217/526 (41.25%), Postives = 302/526 (57.41%), Query Frame = 3
             W+F  I   +C          S N+   +     T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL++NV   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+   NAV  +  I + QF+IV+Y + T     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G     + K  +K    N+E+ R++  K+      EN    +     E   ++A+       DP                 R     Y  +S+  R+    R      H FGR                 +   R + Q +K    R  S L+          +  + D+  ID++SRI FP+ F  FNI Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 348.591 bits (893), Expect = 4.158e-113
Identity = 217/526 (41.25%), Postives = 302/526 (57.41%), Query Frame = 3
             W+F  I   +C          S N+   +     T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL++NV   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+   NAV  +  I + QF+IV+Y + T     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G     + K  +K    N+E+ R++  K+      EN    +     E   ++A+       DP                 R     Y  +S+  R+    R      H FGR                 +   R + Q +K    R  S L+          +  + D+  ID++SRI FP+ F  FNI Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Human
Match: GABRB3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:HGNC Symbol;Acc:HGNC:4083])

HSP 1 Score: 347.436 bits (890), Expect = 1.083e-112
Identity = 221/516 (42.83%), Postives = 309/516 (59.88%), Query Frame = 3
            W      SE R  S N+   +     T+  L+K YD RLRP FG  P+ + M + +AS D +SEVNMDYT+T+Y  QYW+D+RLA+  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G  AV  +E I + QF+IV    H LVS     +TG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q++KK+ E + +++ + +K      +E+   D+        H   +          L S +      ++  N + G I  +T  +   F                 NSGI   + +  M      R +     P K    ++LR    + K K +  + D+  ID++SRI+FP +F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Human
Match: GABRB2 (gamma-aminobutyric acid type A receptor beta2 subunit [Source:HGNC Symbol;Acc:HGNC:4082])

HSP 1 Score: 348.591 bits (893), Expect = 1.104e-112
Identity = 218/533 (40.90%), Postives = 309/533 (57.97%), Query Frame = 3
             W+F  I   +C          S N+   +     T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL++NV   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+   NAV  +  I + QF+IV+Y + T     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G     + K  +K    N+E+ R++  K+             F+ D++    Q  +++       P   +   +F  +   PH  I  S     N    +       + R  +  +     S I      +P  +   N  E    QK S+  R  S L+          +  + D+  ID++SRI FP+ F  FNI Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Celegans
Match: gab-1 (Gamma-aminobutyric acid receptor subunit beta [Source:UniProtKB/Swiss-Prot;Acc:O18276])

HSP 1 Score: 382.489 bits (981), Expect = 9.436e-126
Identity = 234/507 (46.15%), Postives = 308/507 (60.75%), Query Frame = 3
            RLRP FG   + + M++++ASFDSISEV+MDYT+T+YL+QYW DERL ++       + + G+FS  IWVPDTFLANDK+S+LH+VTE+NKMLRI  DG++ YGMR ++TL+C M+L  +PLD QNCTVEIESYGY   +V M W N   AVH +E   + QFTI  +     + + +TG YQRLSL FQL R+VG+F+FQTYLP +LIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVR SLPRISYVK+ID+YLV+CFVFVF+ALLEYAAVNY++WG    +             +    S +N  K                    L   + T N    N++F    + K   +    P CR  N  S  +E +  + P        Y+ TS+   R  AS N++   H  GR               S   + R        S  + IS +       K    ++VRD+ +IDK+SR++FP+ FI+FN+ Y+  Y +
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Celegans
Match: lgc-38 (pep chromosome:WBcel235:III:7009136:7019574:1 gene:WBGene00017389.1 transcript:F11H8.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgc-38)

HSP 1 Score: 258.84 bits (660), Expect = 3.289e-79
Identity = 145/344 (42.15%), Postives = 205/344 (59.59%), Query Frame = 3
            W+ W+ L                +  +  Q  +  T    SNE  L  N +  +  L+ ++D R+RP +G  P+ +++   V +  ++SEV+MDYT+ LYL Q W+D RLA+     D++  +  D    IW PDTF  N+K SF H+ T  N  LRI   G +   +R + T  C M LH +PLD Q C +E+ESYGY   D+   W +G NAV   EN+H+  FTI  +       +LSTG Y RL+  F   RN+GF++ Q Y PS LIV++SWVSFW++ EA  ARVA+G+TTVLTMTT+ T   +SLP++SYVK++DV+L VCF  VF++LLEYAA+ Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Celegans
Match: lgc-38 (pep chromosome:WBcel235:III:7009136:7019403:1 gene:WBGene00017389.1 transcript:F11H8.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lgc-38)

HSP 1 Score: 258.455 bits (659), Expect = 7.147e-79
Identity = 145/344 (42.15%), Postives = 205/344 (59.59%), Query Frame = 3
            W+ W+ L                +  +  Q  +  T    SNE  L  N +  +  L+ ++D R+RP +G  P+ +++   V +  ++SEV+MDYT+ LYL Q W+D RLA+     D++  +  D    IW PDTF  N+K SF H+ T  N  LRI   G +   +R + T  C M LH +PLD Q C +E+ESYGY   D+   W +G NAV   EN+H+  FTI  +       +LSTG Y RL+  F   RN+GF++ Q Y PS LIV++SWVSFW++ EA  ARVA+G+TTVLTMTT+ T   +SLP++SYVK++DV+L VCF  VF++LLEYAA+ Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Celegans
Match: unc-49 (Ionotropic GABA receptor subunit UNC-49B.3 [Source:UniProtKB/TrEMBL;Acc:G5ECD3])

HSP 1 Score: 249.98 bits (637), Expect = 1.411e-75
Identity = 135/290 (46.55%), Postives = 192/290 (66.21%), Query Frame = 3
             YD RLRP++G  P+ + + + V+S  ++SEV+MD+T+  Y+ Q WQD RLAF      +S     + +  D+ +++W PDTF  N+K SF H  T  N  LRI GDG ++   R + T  C MDL  +P+D Q+C +EIESYGY + D+ M   + + +V + E+  + QF + +  V      LS+G Y RL   F   RN+GF++ Q YLPS+LIV++SWVSFW+S +AT ARVALG+TTVLTMTT+ T   SS+P++SYVK+ID++L VCF+ VF +LLEYAAV Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Celegans
Match: unc-49 (Ionotropic GABA receptor subunit UNC-49B.3 [Source:UniProtKB/TrEMBL;Acc:G5ECD3])

HSP 1 Score: 249.98 bits (637), Expect = 1.411e-75
Identity = 135/290 (46.55%), Postives = 192/290 (66.21%), Query Frame = 3
             YD RLRP++G  P+ + + + V+S  ++SEV+MD+T+  Y+ Q WQD RLAF      +S     + +  D+ +++W PDTF  N+K SF H  T  N  LRI GDG ++   R + T  C MDL  +P+D Q+C +EIESYGY + D+ M   + + +V + E+  + QF + +  V      LS+G Y RL   F   RN+GF++ Q YLPS+LIV++SWVSFW+S +AT ARVALG+TTVLTMTT+ T   SS+P++SYVK+ID++L VCF+ VF +LLEYAAV Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Fly
Match: Lcch3 (gene:FBgn0010240 transcript:FBtr0074129)

HSP 1 Score: 447.588 bits (1150), Expect = 1.158e-151
Identity = 264/505 (52.28%), Postives = 335/505 (66.34%), Query Frame = 3
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Fly
Match: Rdl (gene:FBgn0004244 transcript:FBtr0333835)

HSP 1 Score: 252.292 bits (643), Expect = 5.181e-75
Identity = 127/296 (42.91%), Postives = 190/296 (64.19%), Query Frame = 3
            N S  + +   +YD R+RP +G  P+ + + + V S  S+SEV MD+T+  Y  Q+W D RLA+        + +  +F   IWVPDTF  N+K S+ H  T  N+ +R++  G I   +R + T +C M+L Y+P+D Q C +EIES+GY + D++  W  G N+V     + + QF ++ +    +  +L+TG Y RL+   Q  R++G+++ Q Y+PS LIV++SWVSFW++  AT ARVALG+TTVLTMTT+ +   ++LP+ISYVK+IDVYL  CFV VF++LLEYA V Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Fly
Match: Rdl (gene:FBgn0004244 transcript:FBtr0076534)

HSP 1 Score: 252.292 bits (643), Expect = 5.181e-75
Identity = 127/296 (42.91%), Postives = 190/296 (64.19%), Query Frame = 3
            N S  + +   +YD R+RP +G  P+ + + + V S  S+SEV MD+T+  Y  Q+W D RLA+        + +  +F   IWVPDTF  N+K S+ H  T  N+ +R++  G I   +R + T +C M+L Y+P+D Q C +EIES+GY + D++  W  G N+V     + + QF ++ +    +  +L+TG Y RL+   Q  R++G+++ Q Y+PS LIV++SWVSFW++  AT ARVALG+TTVLTMTT+ +   ++LP+ISYVK+IDVYL  CFV VF++LLEYA V Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Fly
Match: Rdl (gene:FBgn0004244 transcript:FBtr0309054)

HSP 1 Score: 251.136 bits (640), Expect = 6.343e-75
Identity = 127/296 (42.91%), Postives = 191/296 (64.53%), Query Frame = 3
            N S  + +   +YD R+RP +G  P+ + + + V S  S+SEV MD+T+  Y  Q+W D RLA+        + +  +F   IWVPDTF  N+K S+ H  T  N+ +R++  G I   +R + T +C M+L Y+P+D Q C +EIES+GY + D++  W++G ++V     + + QF ++ +       NL+TG Y RL+   Q  R++G+++ Q Y+PS LIV++SWVSFW++  AT ARVALG+TTVLTMTT+ +   ++LP+ISYVK+IDVYL  CFV VF++LLEYA V Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Fly
Match: Rdl (gene:FBgn0004244 transcript:FBtr0333834)

HSP 1 Score: 251.521 bits (641), Expect = 1.029e-74
Identity = 127/296 (42.91%), Postives = 190/296 (64.19%), Query Frame = 3
            N S  + +   +YD R+RP +G  P+ + + + V S  S+SEV MD+T+  Y  Q+W D RLA+        + +  +F   IWVPDTF  N+K S+ H  T  N+ +R++  G I   +R + T +C M+L Y+P+D Q C +EIES+GY + D++  W  G N+V     + + QF ++ +    +  +L+TG Y RL+   Q  R++G+++ Q Y+PS LIV++SWVSFW++  AT ARVALG+TTVLTMTT+ +   ++LP+ISYVK+IDVYL  CFV VF++LLEYA V Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Zebrafish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 363.999 bits (933), Expect = 6.716e-119
Identity = 222/506 (43.87%), Postives = 308/506 (60.87%), Query Frame = 3
             S+NE   +     T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G  AV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E +E++                NND   +D      +    KP S +  N     +  +  +S  N +  ++  +  +       S    RN    +       NSGI  Y ++     ST    M +N +  K R    LR    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Zebrafish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 363.999 bits (933), Expect = 6.716e-119
Identity = 222/506 (43.87%), Postives = 308/506 (60.87%), Query Frame = 3
             S+NE   +     T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G  AV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E +E++                NND   +D      +    KP S +  N     +  +  +S  N +  ++  +  +       S    RN    +       NSGI  Y ++     ST    M +N +  K R    LR    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Zebrafish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 363.229 bits (931), Expect = 2.946e-118
Identity = 222/505 (43.96%), Postives = 308/505 (60.99%), Query Frame = 3
            S+NE   +     T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G  AV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E +E++                NND   +D      +    KP S +  N     +  +  +S  N +  ++  +  +       S    RN    +       NSGI  Y ++     ST    M +N +  K R    LR    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Zebrafish
Match: gabrb4 (gamma-aminobutyric acid type A receptor beta4 subunit [Source:ZFIN;Acc:ZDB-GENE-070424-211])

HSP 1 Score: 350.903 bits (899), Expect = 1.134e-113
Identity = 211/494 (42.71%), Postives = 301/494 (60.93%), Query Frame = 3
            A  T+  L+K YD RLRP FG  P+ + M + +AS DSISEVNMDYTIT+Y  Q W+D+RLA+  +     + +    ++Q+W+PDT+  NDK SFLH VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G NAV  ++ + + QF+IV   + +     +TG Y RLSL F++ RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALG+TTVLTMTTI+T +R +LP+I YVKAIDVYL+ CFVFVF ALLEYA VNY F+G          ++     R+N      P + E +  +        + N     +   +  NLY  ++     ++  N +  ++  N   M +    +  + R  +  F    +SG+   F + PM +    R+ F +     S  R  +N R     SK K  +  + D+  IDK+SRI+FPI+F  FN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Zebrafish
Match: gabrb1 (gamma-aminobutyric acid type A receptor beta1 subunit [Source:ZFIN;Acc:ZDB-GENE-090313-230])

HSP 1 Score: 345.51 bits (885), Expect = 5.045e-112
Identity = 209/505 (41.39%), Postives = 301/505 (59.60%), Query Frame = 3
            HS NE   +    +T+  L+K YD RLRP FG  P+ + M + ++S D +SEVNMDYTIT+Y  Q W+D+RL++  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G ++V  ++NI + QF+I++Y   +     +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G     + K  +K  K N+E+SR+ + K+   +                 H          R     S  +       P N +    Y + S+  R+    R+       +GR                T++  R +     P K+R    LR    + K K +  + D+  IDK+SR++FPI++  FN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Xenopus
Match: dusp5 (dual specificity phosphatase 5 [Source:Xenbase;Acc:XB-GENE-957572])

HSP 1 Score: 360.918 bits (925), Expect = 6.959e-118
Identity = 221/491 (45.01%), Postives = 304/491 (61.91%), Query Frame = 3
            T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  QYW+D+RLA+  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W  G NAV  +E I + QF+I++   H LVS     +TG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E S +S              NK++  F  +  + H   +                        HN + G+    TS+++ R  A+             F NSGI  Y ++     S   R   +N  P KT    +LR    + K K +  + D+  ID++SRI+FPI+F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Xenopus
Match: gabrb2 (gamma-aminobutyric acid (GABA) A receptor, beta 2 [Source:NCBI gene;Acc:100125027])

HSP 1 Score: 353.984 bits (907), Expect = 3.094e-115
Identity = 207/522 (39.66%), Postives = 300/522 (57.47%), Query Frame = 3
             W+F  +   +C          S N+   +     T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL+++V   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G NAV  +E + + QF+I++Y++ +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G              +R +    + +H       NN+    +L            +    N  +  +       P + +    Y  +S+  R+    R      H +GR                 +   R + Q +K    R  S L+         N+  + D+  ID++SR++FP+ F  FNI Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Xenopus
Match: gabrb2 (gamma-aminobutyric acid (GABA) A receptor, beta 2 [Source:NCBI gene;Acc:100125027])

HSP 1 Score: 352.443 bits (903), Expect = 4.809e-115
Identity = 202/487 (41.48%), Postives = 290/487 (59.55%), Query Frame = 3
            T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL+++V   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G NAV  +E + + QF+I++Y++ +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G              +R +    + +H       NN+    +L            +    N  +  +       P + +    Y  +S+  R+    R      H +GR                 +   R + Q +K    R  S L+         N+  + D+  ID++SR++FP+ F  FNI Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Xenopus
Match: gabrb2 (gamma-aminobutyric acid (GABA) A receptor, beta 2 [Source:NCBI gene;Acc:100125027])

HSP 1 Score: 352.829 bits (904), Expect = 5.564e-115
Identity = 202/487 (41.48%), Postives = 290/487 (59.55%), Query Frame = 3
            T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL+++V   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G NAV  +E + + QF+I++Y++ +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G              +R +    + +H       NN+    +L            +    N  +  +       P + +    Y  +S+  R+    R      H +GR                 +   R + Q +K    R  S L+         N+  + D+  ID++SR++FP+ F  FNI Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Xenopus
Match: gabrb2 (gamma-aminobutyric acid (GABA) A receptor, beta 2 [Source:NCBI gene;Acc:100125027])

HSP 1 Score: 352.443 bits (903), Expect = 1.537e-114
Identity = 202/487 (41.48%), Postives = 290/487 (59.55%), Query Frame = 3
            T+  L+K YD RLRP FG  P+++ M + +AS D +SEVNMDYT+T+Y  Q W+D+RL+++V   +  + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G NAV  +E + + QF+I++Y++ +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G              +R +    + +H       NN+    +L            +    N  +  +       P + +    Y  +S+  R+    R      H +GR                 +   R + Q +K    R  S L+         N+  + D+  ID++SR++FP+ F  FNI Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Mouse
Match: Gabrb1 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 1 [Source:MGI Symbol;Acc:MGI:95619])

HSP 1 Score: 353.984 bits (907), Expect = 2.582e-115
Identity = 215/504 (42.66%), Postives = 300/504 (59.52%), Query Frame = 3
            HSSNE   +     T+  L+K YD RLRP FG  P+ + M + VAS D +SEVNMDYT+T+Y  Q W+D+RL++  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W  G  AV  +  I + QF+IV+Y + +     +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTIST +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G+  ++K    ++ S  E++R+   K+                   + H   +      R  N  S  +     + P    K ++Y+  S       AS  YRK                    P+S+     R + ++  P K R    +R    + K K +  + D+  IDK+SR+ FPI+F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 347.821 bits (891), Expect = 5.683e-113
Identity = 214/490 (43.67%), Postives = 297/490 (60.61%), Query Frame = 3
            T+  L+K YD RLRP FG  P+ + M + +AS D +SEVNMDYT+T+Y  QYW+D+RLA+  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G  AV  +E I + QF+IV    H LVS     +TG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q++KK+ E + +++ + +K        + N      D+ N+ N+                             + GS+  +T  +   F                 NSGI   + +  M      R M     P K    ++LR    + K K +  + D+  ID++SRI+FP +F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 347.821 bits (891), Expect = 5.806e-113
Identity = 214/490 (43.67%), Postives = 297/490 (60.61%), Query Frame = 3
            T+  L+K YD RLRP FG  P+ + M + +AS D +SEVNMDYT+T+Y  QYW+D+RLA+  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G  AV  +E I + QF+IV    H LVS     +TG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q++KK+ E + +++ + +K        + N      D+ N+ N+                             + GS+  +T  +   F                 NSGI   + +  M      R M     P K    ++LR    + K K +  + D+  ID++SRI+FP +F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Mouse
Match: Gabrb3 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 3 [Source:MGI Symbol;Acc:MGI:95621])

HSP 1 Score: 347.436 bits (890), Expect = 1.659e-112
Identity = 214/490 (43.67%), Postives = 297/490 (60.61%), Query Frame = 3
            T+  L+K YD RLRP FG  P+ + M + +AS D +SEVNMDYT+T+Y  QYW+D+RLA+  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G  AV  +E I + QF+IV    H LVS     +TG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q++KK+ E + +++ + +K        + N      D+ N+ N+                             + GS+  +T  +   F                 NSGI   + +  M      R M     P K    ++LR    + K K +  + D+  ID++SRI+FP +F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Mouse
Match: Gabrb2 (gamma-aminobutyric acid (GABA) A receptor, subunit beta 2 [Source:MGI Symbol;Acc:MGI:95620])

HSP 1 Score: 341.273 bits (874), Expect = 1.624e-110
Identity = 176/332 (53.01%), Postives = 236/332 (71.08%), Query Frame = 3
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. UniProt/SwissProt
Match: sp|Q08832|GBRB3_DROME (Gamma-aminobutyric acid receptor subunit beta-like OS=Drosophila melanogaster OX=7227 GN=Lcch3 PE=1 SV=2)

HSP 1 Score: 447.588 bits (1150), Expect = 1.160e-150
Identity = 264/505 (52.28%), Postives = 335/505 (66.34%), Query Frame = 3
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. UniProt/SwissProt
Match: sp|P26714|GBRB_LYMST (Gamma-aminobutyric acid receptor subunit beta OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 438.343 bits (1126), Expect = 5.135e-147
Identity = 250/501 (49.90%), Postives = 327/501 (65.27%), Query Frame = 3
            N + TI +L+K YD RLRP FG  P+ I +E+++ASFDSISEV+MDYTIT+YLNQYW+DERL F          + +   + + G F+ +IWVPDTFLANDK SFLHD+TEKNKM+R+YG+G + YGMRF+TTLACMMDLH YPLD Q CTVEIESYGY +DD+ + W N R AV  +E++ + QF+I NY     +  LSTG YQRLSL FQL RN+G+F+FQTYLPSILIVMLSWVSFWI+HEATSARVALGITTVLTMTTIS GVRSSLPRISYVKAID+YLV+CFVFVF+ALLEYAAVNYT+WG RA       K  ++R R   T +   +   ++ N++    +E K    +       +   ++   +    +    R+   I                 R F H      ++  + Y   IP  T+   R    +  P + R +S+ R    +S    + +V+D+  IDK++R++FP+ FI+FN  Y+ +Y L
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. UniProt/SwissProt
Match: sp|O18276|GBRB_CAEEL (Gamma-aminobutyric acid receptor subunit beta OS=Caenorhabditis elegans OX=6239 GN=gab-1 PE=2 SV=3)

HSP 1 Score: 382.489 bits (981), Expect = 1.200e-124
Identity = 234/507 (46.15%), Postives = 308/507 (60.75%), Query Frame = 3
            RLRP FG   + + M++++ASFDSISEV+MDYT+T+YL+QYW DERL ++       + + G+FS  IWVPDTFLANDK+S+LH+VTE+NKMLRI  DG++ YGMR ++TL+C M+L  +PLD QNCTVEIESYGY   +V M W N   AVH +E   + QFTI  +     + + +TG YQRLSL FQL R+VG+F+FQTYLP +LIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVR SLPRISYVK+ID+YLV+CFVFVF+ALLEYAAVNY++WG    +             +    S +N  K                    L   + T N    N++F    + K   +    P CR  N  S  +E +  + P        Y+ TS+   R  AS N++   H  GR               S   + R        S  + IS +       K    ++VRD+ +IDK+SR++FP+ FI+FN+ Y+  Y +
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. UniProt/SwissProt
Match: sp|P50571|GBRB1_MOUSE (Gamma-aminobutyric acid receptor subunit beta-1 OS=Mus musculus OX=10090 GN=Gabrb1 PE=1 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 1.806e-114
Identity = 215/504 (42.66%), Postives = 300/504 (59.52%), Query Frame = 3
            HSSNE   +     T+  L+K YD RLRP FG  P+ + M + VAS D +SEVNMDYT+T+Y  Q W+D+RL++  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W  G  AV  +  I + QF+IV+Y + +     +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTIST +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G+  ++K    ++ S  E++R+   K+                   + H   +      R  N  S  +     + P    K ++Y+  S       AS  YRK                    P+S+     R + ++  P K R    +R    + K K +  + D+  IDK+SR+ FPI+F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. UniProt/SwissProt
Match: sp|P18505|GBRB1_HUMAN (Gamma-aminobutyric acid receptor subunit beta-1 OS=Homo sapiens OX=9606 GN=GABRB1 PE=1 SV=2)

HSP 1 Score: 353.214 bits (905), Expect = 3.058e-114
Identity = 214/504 (42.46%), Postives = 301/504 (59.72%), Query Frame = 3
            HS+NE   +     T+  L+K YD RLRP FG  P+ + M + VAS D +SEVNMDYT+T+Y  Q W+D+RL++  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W  G  AV  +  I + QF+IV+Y + +     +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTIST +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G+  ++K    ++ S  E++++   K+                   + H   +      R  N  S  +     + P    K ++Y+  S       AS  YRK                    P+S+     R + ++  PSK R    +R    + K K +  + D+  IDK+SR+ FPI+F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. TrEMBL
Match: A0A2Z5X785 (Gamma-aminobutyric acid receptor subunit beta A OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 827.395 bits (2136), Expect = 0.000e+0
Identity = 427/528 (80.87%), Postives = 471/528 (89.20%), Query Frame = 3
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. TrEMBL
Match: R7UBK0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_144043 PE=3 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 6.201e-157
Identity = 271/496 (54.64%), Postives = 348/496 (70.16%), Query Frame = 3
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. TrEMBL
Match: A0A1I8MLG2 (Uncharacterized protein OS=Musca domestica OX=7370 GN=101891413 PE=3 SV=1)

HSP 1 Score: 457.218 bits (1175), Expect = 5.773e-152
Identity = 258/506 (50.99%), Postives = 335/506 (66.21%), Query Frame = 3
            L+N + TI+ ++K YD RLRP FG  P+ + M+L +ASFD+ISEVNMDYTIT+YLNQYW+DERLAFN               + ++ + GDF+ +IWVPDTF ANDK SFLHDVTE+NK++R+ GDG + YGMRF+TTLACMMDLHYYPLD QNCTVEIESYGY + DV M WK     V  +E+  + QFTI+ Y+ +     L+TG+YQRLSL F+L RN+G+F+FQTYLPSILIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAID+YLV+CFVFVF+ALLEYAAVNYT+WG+RA       K+  +R +  ++K S     +     S   D+    +  + P PS R  N           NS  N + G+   + +     F+ +RNY                         T++ +   ++ Q+ +K R I  L+      K   + K++D+ IIDK+SR++FP+SF+ FN+GY+  Y L
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. TrEMBL
Match: A0A5N4ANR0 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_06803 PE=4 SV=1)

HSP 1 Score: 456.062 bits (1172), Expect = 1.265e-151
Identity = 260/513 (50.68%), Postives = 329/513 (64.13%), Query Frame = 3
            W C I +       +   + L N + TIS L++ YD RLRP FG  P+ + M+L +ASFD+ISEVNMDYTIT+YLNQYW+DERLAF  S  + ++ + GDF+ +IWVPDTF ANDK SFLHDVTE+NK++R+ GDG I YGMRF+TTLACMMDLHYYPLD QNCTVEIESYGY + DV M WK     V  +E   + QFTI+ Y+ +     L+TG+YQRLSL F+L RN+G+FVFQTYLPSILIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAID+YLV+CFVFVF+ALLEYAAVNYT+WG RA           +  +    +   P     K+ D+ +      HN+ I      R   + S +     + S      G +      +  +F  S        R  R    G N      P ST        +     K +    +R   C  K  ++ K++D+ +IDK+SRI+FP++F+LFN+GY+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. TrEMBL
Match: A0A1I8PT20 (Uncharacterized protein OS=Stomoxys calcitrans OX=35570 GN=106095898 PE=3 SV=1)

HSP 1 Score: 456.062 bits (1172), Expect = 1.345e-151
Identity = 258/506 (50.99%), Postives = 334/506 (66.01%), Query Frame = 3
            L+N + TI+ ++K YD RLRP FG  P+ + M+L +ASFD+ISEVNMDYTIT+YLNQYW+DERLAFN               + ++ + GDF+ +IWVPDTF ANDK SFLHDVTE+NK++R+ GDG + YGMRF+TTLACMMDLHYYPLD QNCTVEIESYGY + DV M WK     V  +E+  + QFTI+ Y+ +     L+TG+YQRLSL F+L RN+G+F+FQTYLPSILIVMLSWVSFWI+HEATSARVALGITTVLTMTTISTGVRSSLPRISYVKAID+YLV+CFVFVF+ALLEYAAVNYT+WG+RA       K+  +R +  + K S     +     S   D+    +  + P PS R  N           NS  N + G+   + +     F+ +RNY                         T++ +   ++ Q+ +K R I  L+      K   + K++D+ IIDK+SR++FP+SF+ FN+GY+  Y L
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Cavefish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:NCBI gene;Acc:103041149])

HSP 1 Score: 372.089 bits (954), Expect = 4.572e-122
Identity = 230/516 (44.57%), Postives = 313/516 (60.66%), Query Frame = 3
             S+NE   +     T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+      A IP+     N    Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G NAV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E +E++                NND   +D      +A   KP S +  N     +  +  +S           HN + G+    TS++  R   S  +           NSGI    +  P   +T +  + +N +P K R    LR    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Cavefish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:NCBI gene;Acc:103041149])

HSP 1 Score: 370.933 bits (951), Expect = 2.588e-121
Identity = 230/515 (44.66%), Postives = 313/515 (60.78%), Query Frame = 3
            S+NE   +     T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+      A IP+     N    Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G NAV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E +E++                NND   +D      +A   KP S +  N     +  +  +S           HN + G+    TS++  R   S  +           NSGI    +  P   +T +  + +N +P K R    LR    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Cavefish
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:NCBI gene;Acc:103041149])

HSP 1 Score: 367.466 bits (942), Expect = 1.885e-120
Identity = 227/504 (45.04%), Postives = 307/504 (60.91%), Query Frame = 3
            S+NE   +     T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+      A IP+     N    Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G NAV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E +E++                NND   +D     +Q           N+     E       HN + G+    TS++  R   S  +           NSGI    +  P   +T +  + +N +P K R    LR    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Cavefish
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4-like [Source:NCBI gene;Acc:103032374])

HSP 1 Score: 352.058 bits (902), Expect = 3.224e-114
Identity = 219/526 (41.63%), Postives = 318/526 (60.46%), Query Frame = 3
            L++   IC +  + T    S        A  T+  L+K YD RLRP FG  P+ + M + +AS DSISEVNMDYTIT+Y  Q W+D+RLA+        + +    ++Q+W+PDT+  NDK SFLH VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G+NAV  ++ + + QF+IV   + +     +TG Y RLSL F++ RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALG+TTVLTMTTI+T +R +LP+I YVKAIDVYL+ CFVFVF ALLEYA VNY F+G    ++ K  ++  K N+ER R  + +L      ++  +  F  +    + Q           NLY  ++     ++  N +  ++  N   M +    +  + R  +  F    +SG+   F + PM++    R+ F +     S  R  +N R     SK K  +  + D+  IDK+SR++FPI+F  FN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Cavefish
Match: gabrb1 (gamma-aminobutyric acid type A receptor beta1 subunit [Source:ZFIN;Acc:ZDB-GENE-090313-230])

HSP 1 Score: 348.591 bits (893), Expect = 1.416e-113
Identity = 210/508 (41.34%), Postives = 303/508 (59.65%), Query Frame = 3
            HS NE   +    +T+  L+K YD RLRP FG  P+ + M + ++S D +SEVNMDYTIT+Y  Q W+D+RL++  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G ++V  ++NI + QF+I++Y   +     +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G     + K  +K  K N+E+SR+   K+   +   + N    + DL     + +    S  DP        F F +                      AS  YRK                    P++     R+++     S  R I++ + H  R   +  +K+    D+  IDK+SR++FPI++  FN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000073.1 (pep scaffold:Pmarinus_7.0:GL476340:503477:541718:1 gene:ENSPMAG00000000064.1 transcript:ENSPMAT00000000073.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 272.322 bits (695), Expect = 3.763e-85
Identity = 136/317 (42.90%), Postives = 205/317 (64.67%), Query Frame = 3
            S+   +  S EY+        I NLM+ Y+  LRP F +GP++I M L +AS D+ISE+NMDYT T++L Q WQDERL F     +  + + G     +WVPDTF+ + K SFLHD+T +N+++RI+ +G + Y +R +TT+AC MDL  YP+D+Q CT+++ES+GY  +D+   W  G ++V  ++ + + Q+T+  Y      +   TG Y +L   F+L RN+ +F+ +TY+PS+L+V+LSWVSFWIS  +  AR+ +G        LTMTT+  G R+SLP    ++KAIDVYL +CF F+F AL+EYA  ++
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008467.1 (pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 gene:ENSPMAG00000007648.1 transcript:ENSPMAT00000008467.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 238.424 bits (607), Expect = 5.452e-72
Identity = 139/292 (47.60%), Postives = 188/292 (64.38%), Query Frame = 3
             Y+ R+RP FG   +++   + + SF SI E   DY +T+YL Q W D RLA+  SH     P+P    D SN   IW PD F  N+K +  H++T  NKMLRI  +G + Y MR + TL+C MDLH +P+D Q C++ +ES+GY   D+   W NG   V   E + + QF + N     +     STG +  +   F LHR +GF++ Q Y+PSILIV+LSWVSFWI+ EA  ARVALGITTVLT+TT STG R+SLP++SY+KA+D+++  C +FVF+ALLEYAAVN T
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Sea Lamprey
Match: glra2 (glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-090407-1])

HSP 1 Score: 233.032 bits (593), Expect = 1.032e-70
Identity = 124/274 (45.26%), Postives = 186/274 (67.88%), Query Frame = 3
            P+++   + + SF SI+E  MDY + ++L Q W D RLA++  + D  + +     + IW PD F AN+K +  H+VT  NK+LRI+ DG + Y +R + TL+C MDL  +P+D Q C +++ES+GY ++D+   WK    AV   E + + QF + +  D+     + +TG +  + + F L R +G+++ Q Y+PS+LIV+LSWVSFWI+ +A  ARVALGITTVLTMTT S+G R+SLP++SYVKAID+++ VC +FVF+ALLEYAAVN+ 
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Sea Lamprey
Match: gabra6a (gamma-aminobutyric acid (GABA) A receptor, alpha 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1692])

HSP 1 Score: 215.698 bits (548), Expect = 1.111e-62
Identity = 118/299 (39.46%), Postives = 176/299 (58.86%), Query Frame = 3
            +N +  +  L+  YD+RLRP FG     +  ++ V SF  +S+V MDYT+ ++  Q W DERL F+      ++ +     N+IW PDT+  N K S  H++T  NK+ RI  +G + Y MR +    C M L  +P+D   C ++  SY YP  ++  SW  G N    +  E+  ++Q+ +  ++V +       G Y  +++ F L R +G+F+ QTY+P I+ V+LS VSFWI+ E+  AR   GITTVLTMTT S   R SLP++SY  A+D ++ V F FVFSAL+E+AAVNY
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Sea Lamprey
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:ZFIN;Acc:ZDB-GENE-101102-2])

HSP 1 Score: 204.527 bits (519), Expect = 8.701e-61
Identity = 142/371 (38.27%), Postives = 202/371 (54.45%), Query Frame = 3
            MMDL  YPLDE  CT+EIESYGY  +D+K  W+ G  A+  +  I + QFTIV ++  +     +TG Y RLSL F+L RN+G+F+ QTY+P+ILI +LSWVSFWI+++A++ARVALG+TTVLTMTTIST +R +LP+I YVKAID+YL+ CF FVF ALLEYAAVNY F+G       ++ K+ +ER +R NN K   P   +    D+         ++ N+     +  P    DP       +    + P  +++  +        R   A+R  R      GR                  T  R     +K    R  S L+          +  + ++  IDK+SR++FP++F  FN  Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Nematostella
Match: EDO35410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK4])

HSP 1 Score: 241.891 bits (616), Expect = 7.802e-75
Identity = 122/299 (40.80%), Postives = 195/299 (65.22%), Query Frame = 3
            N++L + NL++ YD R+RP     P+ + +++ V++  ++ E+NMD+TI +YL QYW+DERL F      AM+ +  D + QIWVP T+    K ++ HDVT  N +L++  DG +FY +R + T +C +DL  +P D Q+C++ +ESYGY   DV   W    +  +A++  +++ + QF ++       ++  + G +  L   F++ R +G+F+  TY+PS +IV++SW+SFWI  E   ARVALGITTVLTMTT+ +  R++LP++SYVKAID YL++C +FVF ++LEY  V Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Nematostella
Match: EDO40478 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S763])

HSP 1 Score: 228.024 bits (580), Expect = 4.462e-70
Identity = 111/274 (40.51%), Postives = 184/274 (67.15%), Query Frame = 3
            P+ +  ++ V     ISE +M++ +  +  QYWQD RLA++ +  +  + +     + +W+PD +  N+K    HD+T++N+++R++ DGR+F+ +R S T +C M LH YP+D+Q C +  ES+ YP  ++   W KN G   V   + + + QF +  Y   +  +N +TG Y RL++ F+  R++GFF+ QTY+P+ LIVMLSW++FWI+H +T AR+ LGITTVLTMTT++   R+SLP++SYVK+I+ +L++CF++VF +L+EY  V+Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Nematostella
Match: EDO36340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ14])

HSP 1 Score: 220.32 bits (560), Expect = 5.003e-67
Identity = 126/293 (43.00%), Postives = 177/293 (60.41%), Query Frame = 3
            T+  L  + D RLRP FG  P+ + +++ + +   IS  NMDY + LY  Q W D RLAF++  A   I + G   N IW+PDT   N+K S  H VT+ N +L I+ +G  +  MR S T  C MDL  YP+D Q C + I SY    D++ + WK G   +V   ENI++ Q  ++      +V   ++G Y RLSL F+  R +  F+ +TY+P +LIV LSWVSFWI+++   ARVAL ITTVLT+ T+S  VR+SLP+++Y K  D  L+   V+VF AL+EYA VNY
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Nematostella
Match: EDO37555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG6])

HSP 1 Score: 216.468 bits (550), Expect = 5.952e-64
Identity = 122/293 (41.64%), Postives = 179/293 (61.09%), Query Frame = 3
            + NL++ YD RLRP FG  P+++ +   V S D+I+ ++MDY +  +L Q W+D RL       D  + +     ++IWVPDT+  N K S  H VT  NKML I  DG + Y  R +   +C M+L  +P D QNC ++IESYGY  D+V+  W+N   N +   + I  M Q+ + + +V    +    G +  L+  F+  R  G+F+   Y P  LIV+LSW+SF I  E+T+AR+ALGIT+VLT+TTI   + +S+P++SYVKA+D YL+ CF+FVF+ LLEY  V Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Nematostella
Match: EDO39173 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS4])

HSP 1 Score: 201.06 bits (510), Expect = 9.299e-60
Identity = 117/292 (40.07%), Postives = 171/292 (58.56%), Query Frame = 3
             I  L   YD+RLRP FG  P++I + + V SF ++ E +M++++ ++  Q W+D RL     H+  M   +PG    + W+PDTF  N K +  H V   N  + +  DG I    R + + +C MDL  YPLD+Q C +EI SY + ++D+   WK   + +  I +  M +F + +        S   TG Y  L   F   R + +   Q Y P+ LIV+LSW+SFWIS +A  ARVALGITTVLT+ T+   +R+S+P++SY+KAID+YL+V F+FVF  LLEY AV
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Medaka
Match: gabrb1 (gamma-aminobutyric acid type A receptor beta1 subunit [Source:NCBI gene;Acc:101154825])

HSP 1 Score: 350.132 bits (897), Expect = 5.245e-114
Identity = 212/506 (41.90%), Postives = 303/506 (59.88%), Query Frame = 3
            +NE   +     T+  L+K YD RLRP FG  P+ + M + +AS D +SEVNMDYTIT+Y  Q W+D+RL++  +     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G NA  V  +ENI + QF+I++Y   +  +  +TG Y RLSL F+L RN+G+F+ QTY+PS LI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G     +KK  ++   N  RSR+ ++++     I   N   +    D+ +          +  DP      +   F+           Y + S+  R+  ASR+       +GR                       + +   P K+R    LR    + K K +  + D+  IDK+SR++FPI+FI FN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Medaka
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4 [Source:NCBI gene;Acc:101160433])

HSP 1 Score: 350.517 bits (898), Expect = 1.171e-113
Identity = 215/523 (41.11%), Postives = 314/523 (60.04%), Query Frame = 3
            L+   ++C + SS T          +  A  T+  L+K YD RLRP FG  P+ + M + +AS DSISEVNMDYTIT+Y  Q W D+RLA+     D  + +    ++Q+W+PDT+  NDK SFLH VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD+   W+ G +AV  ++ + + QF+IV   + +     +TG Y RLSL F++ RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALG+TTVLTMTTI+T +R +LP+I YVKAIDVYL+ CFVFVF ALLEYA VNY F+G    ++ K  ++  K N+ER+R    +L        +  DS     +    ++       +  NLY  ++     ++  N +  ++  N   M +    +  + R  +  F    +SG+   F + PM+          ++   ++R    LR    + K K +  + D+  IDK+SR++FPI F  FN+ Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Medaka
Match: GABRB2 (gamma-aminobutyric acid receptor subunit beta-2 [Source:NCBI gene;Acc:101167169])

HSP 1 Score: 348.206 bits (892), Expect = 3.346e-113
Identity = 218/522 (41.76%), Postives = 306/522 (58.62%), Query Frame = 3
            +C    S   FHS   N+   +     T+  L+K YD RLRP FG  P+ + M + +AS D +SEVNMDYT+T+Y  Q W+D+RL++  S     + +    ++Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  W+ G  AV  +E I + QF+IV+   H L+S     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAIDVYL+ CFVFVF ALLEYA VNY F+G     + +  +K    N+E+ R++  K+       + + +     L+ K++  +                E     N P N +    Y ++++  R+   +R      H FGR                 +  +R M Q +K    R  S L+          +  + D+  IDK+SRI+FP  F  FNI Y+  Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Medaka
Match: gabrb3 (gamma-aminobutyric acid type A receptor beta3 subunit [Source:NCBI gene;Acc:101165384])

HSP 1 Score: 345.895 bits (886), Expect = 4.791e-112
Identity = 221/496 (44.56%), Postives = 301/496 (60.69%), Query Frame = 3
            T+  L+K YD RLRP FG  P+++ M + VAS D +SEVNMDYT+T+Y  QYW+D+RLA+        IP+     N    Q+WVPDT+  NDK SF+H VT KN+M+R++ DG + YG+R +TT ACMMDL  YPLDEQNCT+EIESYGY  DD++  WK G  AV  +  I + QF+IV+Y + +     STG Y RLSL F+L RN+G+F+ QTY+PSILI +LSWVSFWI+++A++ARVALGITTVLTMTTI+T +R +LP+I YVKAID+YL+ CFVFVF ALLEYA VNY F+G R  Q +KK+ E + ++    +K   P    E  N     F    + NQ    + S R     N+     E       HN + GS    T+++     +S  +           NSGI   + +           + +N    KTR    L+    + K K +  + D+  ID++SRI+FP  F LFN+ Y+  Y+
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Medaka
Match: gabrb4 (gamma-aminobutyric acid receptor subunit beta-4 [Source:NCBI gene;Acc:101160433])

HSP 1 Score: 343.199 bits (879), Expect = 1.691e-111
Identity = 180/345 (52.17%), Postives = 244/345 (70.72%), Query Frame = 3
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Planmine SMEST
Match: SMESG000026005.1 (SMESG000026005.1)

HSP 1 Score: 1040.02 bits (2688), Expect = 0.000e+0
Identity = 526/526 (100.00%), Postives = 526/526 (100.00%), Query Frame = 3
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Planmine SMEST
Match: SMESG000018336.1 (SMESG000018336.1)

HSP 1 Score: 203.371 bits (516), Expect = 8.867e-59
Identity = 112/300 (37.33%), Postives = 174/300 (58.00%), Query Frame = 3
            L N S+ ++ L+  YD  LRP     P+ I +++ + S   ISE+NM Y+   Y  Q WQD+RL F+      ++ +     + +W PDT+  N + S+LH++T  N  +RI+ DG I Y MR +    C M+LH +PLD Q C + I SYGY   D+   W    N +V +   + + QF ++N         +   G +  L++ F L RN+G+F+ Q YLP  L+V++SWV FWI+ EATS R+ LG+TTVLTM   S   R  LP++SY  A+D+Y+  C+ F+ + ++++A V+Y
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Planmine SMEST
Match: SMESG000071005.1 (SMESG000071005.1)

HSP 1 Score: 189.889 bits (481), Expect = 1.245e-52
Identity = 116/314 (36.94%), Postives = 178/314 (56.69%), Query Frame = 3
            E +KN S+    I  + +NY     P +    P  + + + + + +SI  +NM +    YL Q W D RLA+    A       I +P  F N++W+PD F  N K  F++ +T  N ++R+  DG I Y  + +   +C M L  +P+D Q C + I SYGY +DD++  WK   +   + ++I + +F     +V T+  NL    STG Y  L L F L R +  ++  TY+P+ILIVM+SW+SFWIS EA  ARV LG+ T+L + T + GV  +LPR+SY+KAID+Y++ C +F+  A  E+A A NY+
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Planmine SMEST
Match: SMESG000032691.1 (SMESG000032691.1)

HSP 1 Score: 184.496 bits (467), Expect = 1.845e-51
Identity = 105/297 (35.35%), Postives = 174/297 (58.59%), Query Frame = 3
            +  +++NY    RP   S    + + + V + +S++  NM+Y+  LYL Q W D RL ++      H ++ +  P    +++W+PD F  N K  ++H +T+ N ++R++ +G + Y  + +   +C MDL  YP+D Q+C + I SYGY LD +K  W    N +    N+ + +F   T V  +  T  S   TG Y  L   F L R +G ++  T++P+ LIV++SW++FW+S EA  AR+ LG+ T+L + T ++G+  +LPR+SY+KAIDV+L+ C VFV  ALLE+A  +
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Planmine SMEST
Match: SMESG000018336.1 (SMESG000018336.1)

HSP 1 Score: 181.415 bits (459), Expect = 3.509e-51
Identity = 100/259 (38.61%), Postives = 153/259 (59.07%), Query Frame = 3
            ISE+NM Y+   Y  Q WQD+RL F+      ++ +     + +W PDT+  N + S+LH++T  N  +RI+ DG I Y MR +    C M+LH +PLD Q C + I SYGY   D+   W    N +V +   + + QF ++N         +   G +  L++ F L RN+G+F+ Q YLP  L+V++SWV FWI+ EATS R+ LG+TTVLTM   S   R  LP++SY  A+D+Y+  C+ F+ + ++++A V+Y
The following BLAST results are available for this feature:
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABRB16.367e-11542.46gamma-aminobutyric acid type A receptor beta1 subu... [more]
GABRB24.158e-11341.25gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB24.158e-11341.25gamma-aminobutyric acid type A receptor beta2 subu... [more]
GABRB31.083e-11242.83gamma-aminobutyric acid type A receptor beta3 subu... [more]
GABRB21.104e-11240.90gamma-aminobutyric acid type A receptor beta2 subu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gab-19.436e-12646.15Gamma-aminobutyric acid receptor subunit beta [So... [more]
lgc-383.289e-7942.15pep chromosome:WBcel235:III:7009136:7019574:1 gene... [more]
lgc-387.147e-7942.15pep chromosome:WBcel235:III:7009136:7019403:1 gene... [more]
unc-491.411e-7546.55Ionotropic GABA receptor subunit UNC-49B.3 [Sourc... [more]
unc-491.411e-7546.55Ionotropic GABA receptor subunit UNC-49B.3 [Sourc... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lcch31.158e-15152.28gene:FBgn0010240 transcript:FBtr0074129[more]
Rdl5.181e-7542.91gene:FBgn0004244 transcript:FBtr0333835[more]
Rdl5.181e-7542.91gene:FBgn0004244 transcript:FBtr0076534[more]
Rdl6.343e-7542.91gene:FBgn0004244 transcript:FBtr0309054[more]
Rdl1.029e-7442.91gene:FBgn0004244 transcript:FBtr0333834[more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrb36.716e-11943.87gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb36.716e-11943.87gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb32.946e-11843.96gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb41.134e-11342.71gamma-aminobutyric acid type A receptor beta4 subu... [more]
gabrb15.045e-11241.39gamma-aminobutyric acid type A receptor beta1 subu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp56.959e-11845.01dual specificity phosphatase 5 [Source:Xenbase;Acc... [more]
gabrb23.094e-11539.66gamma-aminobutyric acid (GABA) A receptor, beta 2 ... [more]
gabrb24.809e-11541.48gamma-aminobutyric acid (GABA) A receptor, beta 2 ... [more]
gabrb25.564e-11541.48gamma-aminobutyric acid (GABA) A receptor, beta 2 ... [more]
gabrb21.537e-11441.48gamma-aminobutyric acid (GABA) A receptor, beta 2 ... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gabrb12.582e-11542.66gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb35.683e-11343.67gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb35.806e-11343.67gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb31.659e-11243.67gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
Gabrb21.624e-11053.01gamma-aminobutyric acid (GABA) A receptor, subunit... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08832|GBRB3_DROME1.160e-15052.28Gamma-aminobutyric acid receptor subunit beta-like... [more]
sp|P26714|GBRB_LYMST5.135e-14749.90Gamma-aminobutyric acid receptor subunit beta OS=L... [more]
sp|O18276|GBRB_CAEEL1.200e-12446.15Gamma-aminobutyric acid receptor subunit beta OS=C... [more]
sp|P50571|GBRB1_MOUSE1.806e-11442.66Gamma-aminobutyric acid receptor subunit beta-1 OS... [more]
sp|P18505|GBRB1_HUMAN3.058e-11442.46Gamma-aminobutyric acid receptor subunit beta-1 OS... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Z5X7850.000e+080.87Gamma-aminobutyric acid receptor subunit beta A OS... [more]
R7UBK06.201e-15754.64Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1I8MLG25.773e-15250.99Uncharacterized protein OS=Musca domestica OX=7370... [more]
A0A5N4ANR01.265e-15150.68Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A1I8PT201.345e-15150.99Uncharacterized protein OS=Stomoxys calcitrans OX=... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrb34.572e-12244.57gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb32.588e-12144.66gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb31.885e-12045.04gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb43.224e-11441.63gamma-aminobutyric acid receptor subunit beta-4-li... [more]
gabrb11.416e-11341.34gamma-aminobutyric acid type A receptor beta1 subu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000073.13.763e-8542.90pep scaffold:Pmarinus_7.0:GL476340:503477:541718:1... [more]
ENSPMAT00000008467.15.452e-7247.60pep scaffold:Pmarinus_7.0:GL477211:8305:20106:1 ge... [more]
glra21.032e-7045.26glycine receptor, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
gabra6a1.111e-6239.46gamma-aminobutyric acid (GABA) A receptor, alpha 6... [more]
gabrb38.701e-6138.27gamma-aminobutyric acid type A receptor beta3 subu... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354107.802e-7540.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404784.462e-7040.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363405.003e-6743.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375555.952e-6441.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391739.299e-6040.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabrb15.245e-11441.90gamma-aminobutyric acid type A receptor beta1 subu... [more]
gabrb41.171e-11341.11gamma-aminobutyric acid receptor subunit beta-4 [S... [more]
GABRB23.346e-11341.76gamma-aminobutyric acid receptor subunit beta-2 [S... [more]
gabrb34.791e-11244.56gamma-aminobutyric acid type A receptor beta3 subu... [more]
gabrb41.691e-11152.17gamma-aminobutyric acid receptor subunit beta-4 [S... [more]
back to top
BLAST of Gamma-aminobutyric acid receptor subunit beta A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
back to top
The following sequences are available for this feature:

transcript sequence

>SMED30013129 ID=SMED30013129|Name=Gamma-aminobutyric acid receptor subunit beta A|organism=Schmidtea mediterranea sexual|type=transcript|length=1889bp
back to top

protein sequence of SMED30013129-orf-1

>SMED30013129-orf-1 ID=SMED30013129-orf-1|Name=SMED30013129-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=532bp
back to top
The feature 'Gamma-aminobutyric acid receptor subunit beta A' has the following synonyms
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
GO:0004888transmembrane signaling receptor activity
GO:0004890GABA-A receptor activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0005254chloride channel activity
GO:0022851GABA-gated chloride ion channel activity
Vocabulary: Planarian Anatomy
PLANA:0000017photoreceptor neuron
Vocabulary: INTERPRO
Vocabulary: biological process
GO:0006811ion transport
GO:0006821chloride transport
GO:0007165signal transduction
GO:0034220ion transmembrane transport
GO:1902476chloride transmembrane transport
Vocabulary: cellular component
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0034707chloride channel complex
GO:0045211postsynaptic membrane
GO:1902711GABA-A receptor complex
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 86..102
score: 39.77
coord: 242..254
score: 31.53
coord: 166..180
score: 50.5
coord: 120..131
score: 50.9
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 18..529
e-value: 1.5E-140
score: 467.0
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 26..372
IPR002289Gamma-aminobutyric-acid A receptor, beta subunitPRINTSPR01160GABAARBETAcoord: 305..317
score: 73.68
coord: 497..511
score: 38.6
coord: 205..218
score: 33.08
IPR006028Gamma-aminobutyric acid A receptor/Glycine receptor alphaPRINTSPR00253GABAARECEPTRcoord: 251..271
score: 62.41
coord: 311..332
score: 60.1
coord: 509..529
score: 47.49
coord: 277..298
score: 61.3
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 44..246
e-value: 2.3E-47
score: 161.2
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 255..526
e-value: 5.4E-42
score: 144.5
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA: 28..245
e-value: 1.2E-75
score: 255.3
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 44..247
NoneNo IPR availableCDDcd19006LGIC_ECD_GABAAR_LCCH3-likecoord: 63..247
e-value: 2.14517E-102
score: 303.609
NoneNo IPR availableCDDcd19049LGIC_TM_anioncoord: 250..334
e-value: 8.06876E-54
score: 175.333
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.549
NoneNo IPR availableTMHMMTMhelixcoord: 250..272
NoneNo IPR availableTMHMMTMhelixcoord: 509..528
NoneNo IPR availableTMHMMTMhelixcoord: 313..335
NoneNo IPR availableTMHMMTMhelixcoord: 279..298
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 166..180
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 249..530