Glyceraldehyde-3-phosphate dehydrogenase

Overview
NameGlyceraldehyde-3-phosphate dehydrogenase
Smed IDSMED30013107
Length (bp)1188
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glyceraldehyde-3-phosphate dehydrogenase (SMED30013107) t-SNE clustered cells

Violin plots show distribution of expression levels for Glyceraldehyde-3-phosphate dehydrogenase (SMED30013107) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glyceraldehyde-3-phosphate dehydrogenase (SMED30013107) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glyceraldehyde-3-phosphate dehydrogenase (SMED30013107) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013107

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior pole progenitor cellSMED30013107SMESG000052353.1 SMED30013107smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30013107SMESG000052353.1 dd_Smed_v4_78_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013107SMESG000052353.1 dd_Smed_v4_78_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013107SMESG000052353.1 dd_Smed_v4_78_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013107SMESG000052353.1 dd_Smed_v4_78_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013107SMESG000052353.1 dd_Smed_v4_78_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013107SMESG000052353.1 dd_Smed_v4_78_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013107SMESG000052353.1 dd_Smed_v4_78_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013107SMESG000052353.1 dd_Smed_v4_78_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30013107SMESG000052353.1 dd_Smed_v4_78_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013107SMESG000052353.1 dd_Smed_v4_78_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013107SMESG000052353.1 dd_Smed_v4_78_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013107SMESG000052353.1 dd_Smed_v4_78_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013107SMESG000052353.1 OX_Smed_1.0.23342ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 3 cellSMED30013107SMESG000052353.1 dd_Smed_v6_78_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30013107SMESG000052353.1 dd_Smed_v6_78_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30013107SMESG000052353.1 dd_Smed_v6_78_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30013107SMESG000052353.1 dd_Smed_v6_78_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDH (glyceraldehyde-3-phosphate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4141])

HSP 1 Score: 513.457 bits (1321), Expect = 0.000e+0
Identity = 241/336 (71.73%), Postives = 283/336 (84.23%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            M K +VG+NGFGRIGRLV RAA   G VD+VA+NDPFI+L+YMVYMF+YDSTHGKFHG V+ ++GKLV++G+ I+++ +++P +I W      YVVESTGVFTT+EKA  H +   AK+VIISAPSADAPM+VMGVNHEKYD  + I+SNASCTTNCLAPLAKVI DNFGIVEGLMTT+HA TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP  +VSVVDLTC+L KPAKYD+IK  +K ASE  +KGIL YTE +VVS DF  D HSS FDA AGI L D FVKL++WYDNE+GYS RV+DL+ HM++K+
Sbjct:    1 MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDH (glyceraldehyde-3-phosphate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4141])

HSP 1 Score: 513.457 bits (1321), Expect = 0.000e+0
Identity = 241/336 (71.73%), Postives = 283/336 (84.23%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            M K +VG+NGFGRIGRLV RAA   G VD+VA+NDPFI+L+YMVYMF+YDSTHGKFHG V+ ++GKLV++G+ I+++ +++P +I W      YVVESTGVFTT+EKA  H +   AK+VIISAPSADAPM+VMGVNHEKYD  + I+SNASCTTNCLAPLAKVI DNFGIVEGLMTT+HA TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP  +VSVVDLTC+L KPAKYD+IK  +K ASE  +KGIL YTE +VVS DF  D HSS FDA AGI L D FVKL++WYDNE+GYS RV+DL+ HM++K+
Sbjct:    1 MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDH (glyceraldehyde-3-phosphate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4141])

HSP 1 Score: 513.457 bits (1321), Expect = 0.000e+0
Identity = 241/336 (71.73%), Postives = 283/336 (84.23%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            M K +VG+NGFGRIGRLV RAA   G VD+VA+NDPFI+L+YMVYMF+YDSTHGKFHG V+ ++GKLV++G+ I+++ +++P +I W      YVVESTGVFTT+EKA  H +   AK+VIISAPSADAPM+VMGVNHEKYD  + I+SNASCTTNCLAPLAKVI DNFGIVEGLMTT+HA TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP  +VSVVDLTC+L KPAKYD+IK  +K ASE  +KGIL YTE +VVS DF  D HSS FDA AGI L D FVKL++WYDNE+GYS RV+DL+ HM++K+
Sbjct:    1 MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDHS (glyceraldehyde-3-phosphate dehydrogenase, spermatogenic [Source:HGNC Symbol;Acc:HGNC:24864])

HSP 1 Score: 484.952 bits (1247), Expect = 7.230e-171
Identity = 236/332 (71.08%), Postives = 276/332 (83.13%), Query Frame = 3
Query:   87 VGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDP-KISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            VGINGFGRIGRLVLRA +EKG V VVA+NDPFI+ +YMVYMFKYDSTHG++ G VE ++G+LVVD H ISVY  K P++IPW      YVVESTGV+ +I+ AS H     A++V+ISAPS DAPM+VMGVN   Y+P  ++IVSNASCTTNCLAPLAKVI + FGIVEGLMTT+H+YTATQKTVDGPS K WRDGRGA QNIIPASTGAAKAV KVIPEL GK+TGMAFRVP PDVSVVDLTC+L++PA Y  IK A+K A++  M GILAYTE+EVVS DF GD HSSIFDAKAGI L D FVKL++WYDNEYGYS RV+DL+++M ++D
Sbjct:   78 VGINGFGRIGRLVLRACMEKG-VKVVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAG-AQRVVISAPSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKLTGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTEDEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRD 407          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDH (glyceraldehyde-3-phosphate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4141])

HSP 1 Score: 448.743 bits (1153), Expect = 1.808e-158
Identity = 212/294 (72.11%), Postives = 248/294 (84.35%), Query Frame = 3
Query:  198 MVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            MVYMF+YDSTHGKFHG V+ ++GKLV++G+ I+++ +++P +I W      YVVESTGVFTT+EKA  H +   AK+VIISAPSADAPM+VMGVNHEKYD  + I+SNASCTTNCLAPLAKVI DNFGIVEGLMTT+HA TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP  +VSVVDLTC+L KPAKYD+IK  +K ASE  +KGIL YTE +VVS DF  D HSS FDA AGI L D FVKL++WYDNE+GYS RV+DL+ HM++K+
Sbjct:    1 MVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE 293          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-3 (Glyceraldehyde-3-phosphate dehydrogenase 3 [Source:UniProtKB/Swiss-Prot;Acc:P17330])

HSP 1 Score: 489.189 bits (1258), Expect = 4.715e-174
Identity = 245/341 (71.85%), Postives = 277/341 (81.23%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVV-----DGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYD-PKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTK 1076
            MTKP VGINGFGRIGRLVLRAA+EK +V+VVA+NDPFI +DYMVY+F+YDSTHG+F G V  +   L+V       H I VYN ++P EI W      YVVESTGVFTTIEKA+ H K   AKKVIISAPSADAPM+V+GVNHEKYD     I+SNASCTTNCLAPLAKVI DNFGI+EGLMTT+HA TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP PDVSVVDLT +L KPA  D+IK  IK A++  MKGILAYTE++VVS DF  D +SSIFDA A I L   FVKLV+WYDNE+GYS RV+DLI +++TK
Sbjct:    1 MTKPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKSQHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGG-AKKVIISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEKPASLDDIKKVIKAAADGPMKGILAYTEDQVVSTDFVSDTNSSIFDAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYIATK 340          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-3 (Glyceraldehyde-3-phosphate dehydrogenase 3 [Source:UniProtKB/Swiss-Prot;Acc:P17330])

HSP 1 Score: 489.189 bits (1258), Expect = 4.715e-174
Identity = 245/341 (71.85%), Postives = 277/341 (81.23%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVV-----DGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYD-PKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTK 1076
            MTKP VGINGFGRIGRLVLRAA+EK +V+VVA+NDPFI +DYMVY+F+YDSTHG+F G V  +   L+V       H I VYN ++P EI W      YVVESTGVFTTIEKA+ H K   AKKVIISAPSADAPM+V+GVNHEKYD     I+SNASCTTNCLAPLAKVI DNFGI+EGLMTT+HA TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP PDVSVVDLT +L KPA  D+IK  IK A++  MKGILAYTE++VVS DF  D +SSIFDA A I L   FVKLV+WYDNE+GYS RV+DLI +++TK
Sbjct:    1 MTKPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKSQHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGG-AKKVIISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEKPASLDDIKKVIKAAADGPMKGILAYTEDQVVSTDFVSDTNSSIFDAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYIATK 340          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-2 (Glyceraldehyde-3-phosphate dehydrogenase 2 [Source:UniProtKB/Swiss-Prot;Acc:P17329])

HSP 1 Score: 486.493 bits (1251), Expect = 5.290e-173
Identity = 244/341 (71.55%), Postives = 276/341 (80.94%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVV-----DGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYD-PKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTK 1076
            M KP VGINGFGRIGRLVLRAA+EK +V+VVA+NDPFI +DYMVY+F+YDSTHG+F G V  +   L+V       H I VYN ++P EI W      YVVESTGVFTTIEKA+ H K   AKKVIISAPSADAPM+V+GVNHEKYD     I+SNASCTTNCLAPLAKVI DNFGI+EGLMTT+HA TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP PDVSVVDLT +L KPA  D+IK  IK A++  MKGILAYTE++VVS DF  D +SSIFDA A I L   FVKLV+WYDNE+GYS RV+DLI +++TK
Sbjct:    1 MPKPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKSQHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGG-AKKVIISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEKPASLDDIKKVIKAAADGPMKGILAYTEDQVVSTDFVSDTNSSIFDAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYIATK 340          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-2 (Glyceraldehyde-3-phosphate dehydrogenase 2 [Source:UniProtKB/Swiss-Prot;Acc:P17329])

HSP 1 Score: 486.493 bits (1251), Expect = 5.290e-173
Identity = 244/341 (71.55%), Postives = 276/341 (80.94%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVV-----DGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYD-PKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTK 1076
            M KP VGINGFGRIGRLVLRAA+EK +V+VVA+NDPFI +DYMVY+F+YDSTHG+F G V  +   L+V       H I VYN ++P EI W      YVVESTGVFTTIEKA+ H K   AKKVIISAPSADAPM+V+GVNHEKYD     I+SNASCTTNCLAPLAKVI DNFGI+EGLMTT+HA TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP PDVSVVDLT +L KPA  D+IK  IK A++  MKGILAYTE++VVS DF  D +SSIFDA A I L   FVKLV+WYDNE+GYS RV+DLI +++TK
Sbjct:    1 MPKPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKSQHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGG-AKKVIISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEKPASLDDIKKVIKAAADGPMKGILAYTEDQVVSTDFVSDTNSSIFDAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYIATK 340          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-1 (Glyceraldehyde-3-phosphate dehydrogenase 1 [Source:UniProtKB/Swiss-Prot;Acc:P04970])

HSP 1 Score: 484.567 bits (1246), Expect = 3.472e-172
Identity = 246/342 (71.93%), Postives = 277/342 (80.99%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVV---DG---HAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKIS-IVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTK 1076
            M+K  VGINGFGRIGRLVLRAA+EK TV VVA+NDPFI +DYMVY+FKYDSTHG+F G V T DG  ++   DG   H I V+N K+P  I W   +  +VVESTGVFTT EKAS H +   AKKVIISAPSADAPMYV+GVNHEKYD     +VSNASCTTNCLAPLAKVI DNFGI+EGLMTT+HA TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP PDVSVVDLT +L KPA  D+IK  +K A++  MKGILAYTE++VVS DF  D HSSIFDA A I L   FVKLV+WYDNEYGYS RV+DLI +++T+
Sbjct:    1 MSKANVGINGFGRIGRLVLRAAVEKDTVQVVAVNDPFITIDYMVYLFKYDSTHGQFKGTV-TYDGDFLIVQKDGKSSHKIKVFNSKDPAAIAWGSVKADFVVESTGVFTTKEKASAHLQGG-AKKVIISAPSADAPMYVVGVNHEKYDASNDHVVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLEKPASMDDIKKVVKAAADGPMKGILAYTEDQVVSTDFVSDPHSSIFDAGACISLNPNFVKLVSWYDNEYGYSNRVVDLIGYIATR 340          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: Gapdh1 (gene:FBgn0001091 transcript:FBtr0100479)

HSP 1 Score: 488.419 bits (1256), Expect = 9.726e-174
Identity = 236/332 (71.08%), Postives = 277/332 (83.43%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            ++GINGFGRIGRLVLRAA++KG   VVA+NDPFI+++YMVY+FK+DSTHG+F G V  + G LVV+G  I+V+++++P  I W      YVVESTGVFTTI+KAS H K   AKKVIISAPSADAPM+V GVN + Y P + +VSNASCTTNCLAPLAKVI DNF IVEGLMTT+HA TATQKTVDGPS KLWRDGRGAAQNIIPA+TGAAKAVGKVIP LNGK+TGMAFRVP P+VSVVDLT +L K A YDEIKA ++ AS+  +KGIL YT+EEVVS DF  D HSS+FDAKAGI L D FVKL++WYDNE+GYS RVIDLI++M +KD
Sbjct:    3 KIGINGFGRIGRLVLRAAIDKGA-SVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYVVESTGVFTTIDKASTHLKGG-AKKVIISAPSADAPMFVCGVNLDAYSPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGATYDEIKAKVEEASKGPLKGILGYTDEEVVSTDFFSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: Gapdh1 (gene:FBgn0001091 transcript:FBtr0088903)

HSP 1 Score: 488.419 bits (1256), Expect = 9.726e-174
Identity = 236/332 (71.08%), Postives = 277/332 (83.43%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            ++GINGFGRIGRLVLRAA++KG   VVA+NDPFI+++YMVY+FK+DSTHG+F G V  + G LVV+G  I+V+++++P  I W      YVVESTGVFTTI+KAS H K   AKKVIISAPSADAPM+V GVN + Y P + +VSNASCTTNCLAPLAKVI DNF IVEGLMTT+HA TATQKTVDGPS KLWRDGRGAAQNIIPA+TGAAKAVGKVIP LNGK+TGMAFRVP P+VSVVDLT +L K A YDEIKA ++ AS+  +KGIL YT+EEVVS DF  D HSS+FDAKAGI L D FVKL++WYDNE+GYS RVIDLI++M +KD
Sbjct:    3 KIGINGFGRIGRLVLRAAIDKGA-SVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYVVESTGVFTTIDKASTHLKGG-AKKVIISAPSADAPMFVCGVNLDAYSPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGATYDEIKAKVEEASKGPLKGILGYTDEEVVSTDFFSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: Gapdh2 (gene:FBgn0001092 transcript:FBtr0074112)

HSP 1 Score: 488.034 bits (1255), Expect = 1.062e-173
Identity = 235/332 (70.78%), Postives = 277/332 (83.43%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            ++GINGFGRIGRLVLRAA++KG  +VVA+NDPFI+++YMVY+FK+DSTHG+F G V  + G LVV+G  I+V+++++P  I W      Y+VESTGVFTTI+KAS H K   AKKVIISAPSADAPM+V GVN + Y P + +VSNASCTTNCLAPLAKVI DNF IVEGLMTT+HA TATQKTVDGPS KLWRDGRGAAQNIIPASTGAAKAVGKVIP LNGK+TGMAFRVP P+VSVVDLT +L K A YDEIKA ++ A+   +KGIL YT+EEVVS DF  D HSS+FDAKAGI L D FVKL++WYDNE+GYS RVIDLI++M +KD
Sbjct:    3 KIGINGFGRIGRLVLRAAIDKGA-NVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYIVESTGVFTTIDKASTHLKGG-AKKVIISAPSADAPMFVCGVNLDAYKPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGASYDEIKAKVQEAANGPLKGILGYTDEEVVSTDFLSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: Gapdh2 (gene:FBgn0001092 transcript:FBtr0332618)

HSP 1 Score: 488.034 bits (1255), Expect = 1.062e-173
Identity = 235/332 (70.78%), Postives = 277/332 (83.43%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            ++GINGFGRIGRLVLRAA++KG  +VVA+NDPFI+++YMVY+FK+DSTHG+F G V  + G LVV+G  I+V+++++P  I W      Y+VESTGVFTTI+KAS H K   AKKVIISAPSADAPM+V GVN + Y P + +VSNASCTTNCLAPLAKVI DNF IVEGLMTT+HA TATQKTVDGPS KLWRDGRGAAQNIIPASTGAAKAVGKVIP LNGK+TGMAFRVP P+VSVVDLT +L K A YDEIKA ++ A+   +KGIL YT+EEVVS DF  D HSS+FDAKAGI L D FVKL++WYDNE+GYS RVIDLI++M +KD
Sbjct:    3 KIGINGFGRIGRLVLRAAIDKGA-NVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYIVESTGVFTTIDKASTHLKGG-AKKVIISAPSADAPMFVCGVNLDAYKPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGASYDEIKAKVQEAANGPLKGILGYTDEEVVSTDFLSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: CG9010 (gene:FBgn0034173 transcript:FBtr0087067)

HSP 1 Score: 428.328 bits (1100), Expect = 6.782e-150
Identity = 205/332 (61.75%), Postives = 250/332 (75.30%), Query Frame = 3
Query:   87 VGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 1082
            +GINGFGRIGR+  R AL +  V +VA+NDP ++  Y+ YM +YDSTHG+F+  +      LVV+G  I +  + + ++I W     + VVE +G FTT++    H  ++ AKKV+ISAPSADAPM+V GVN E Y P  +I+SNASCTTNCLAPLAKV+ DNF I EGLMTT+HA TATQK +DGPSSKLWRDGR    NIIPASTGAAKAVGKVIP+LNGK+TGMAFRVPVP+VSVVDLTC+LSKPAK D+IK  IK AS+  MKGIL Y EEEVVS DF G   +S+FDAKA I L D FVKL++WYDNE GYSCR++DL+ +    D 
Sbjct:    4 IGINGFGRIGRMFARQALVRKDVKIVAINDPSLDPKYLAYMLRYDSTHGQFNQKISVDGNNLVVNGKKIQLLKESDVKKIKWCDLGVHTVVECSGRFTTLKACQGHL-DSGAKKVVISAPSADAPMFVCGVNLEAYKPGTAIISNASCTTNCLAPLAKVVHDNFEICEGLMTTVHAATATQKIIDGPSSKLWRDGRSGMTNIIPASTGAAKAVGKVIPDLNGKLTGMAFRVPVPNVSVVDLTCRLSKPAKMDDIKKCIKAASKCEMKGILGYVEEEVVSTDFNGSRFASVFDAKACIALNDNFVKLISWYDNETGYSCRLLDLVLYAQLVDQ 334          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 508.064 bits (1307), Expect = 0.000e+0
Identity = 245/332 (73.80%), Postives = 280/332 (84.34%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VGINGFGRIGRLV RAA     V++VA+NDPFI+LDYMVYMF+YDSTHGK+ G V+ + GKLV+DGHAI+VY++++P  I W      YVVESTGVFTTIEKAS H K   AK+VIISAPSADAPM+VMGVNHEKYD  +++VSNASCTTNCLAPLAKVI DNF IVEGLM+T+HA TATQKTVDGPS KLWRDGRGA+QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLT +L KPAKYDEIK  +K A++  MKGIL YTE +VVS DF GD  SSIFDA AGI L D FVKLV WYDNE+GYS RV DL+ HM++K+
Sbjct:    3 KVGINGFGRIGRLVTRAAFLTKKVEIVAINDPFIDLDYMVYMFQYDSTHGKYKGEVKAEGGKLVIDGHAITVYSERDPANIKWGDAGATYVVESTGVFTTIEKASAHIKGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVINDNFVIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDEIKKVVKAAADGPMKGILGYTEHQVVSTDFNGDCRSSIFDAGAGIALNDHFVKLVTWYDNEFGYSNRVCDLMAHMASKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 508.064 bits (1307), Expect = 0.000e+0
Identity = 245/332 (73.80%), Postives = 280/332 (84.34%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VGINGFGRIGRLV RAA     V++VA+NDPFI+LDYMVYMF+YDSTHGK+ G V+ + GKLV+DGHAI+VY++++P  I W      YVVESTGVFTTIEKAS H K   AK+VIISAPSADAPM+VMGVNHEKYD  +++VSNASCTTNCLAPLAKVI DNF IVEGLM+T+HA TATQKTVDGPS KLWRDGRGA+QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLT +L KPAKYDEIK  +K A++  MKGIL YTE +VVS DF GD  SSIFDA AGI L D FVKLV WYDNE+GYS RV DL+ HM++K+
Sbjct:    3 KVGINGFGRIGRLVTRAAFLTKKVEIVAINDPFIDLDYMVYMFQYDSTHGKYKGEVKAEGGKLVIDGHAITVYSERDPANIKWGDAGATYVVESTGVFTTIEKASAHIKGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVINDNFVIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDEIKKVVKAAADGPMKGILGYTEHQVVSTDFNGDCRSSIFDAGAGIALNDHFVKLVTWYDNEFGYSNRVCDLMAHMASKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase, spermatogenic [Source:NCBI gene;Acc:406367])

HSP 1 Score: 492.271 bits (1266), Expect = 3.302e-175
Identity = 239/337 (70.92%), Postives = 277/337 (82.20%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPK-ISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            M++  VGINGFGRIGRLVLRA L+KG + V A+NDPFI+L YMVYMFKYDSTHG++ G V  +DGKL+VDG AISV+    P EIPW      YVVESTGVF +I+KAS H +   AK+V++SAPS DAPM+VMGVN +KYDP  ++IVSNASCTTNCLAPLAKVI DNFGI E LMTT+HAYTATQKTVDGPS+K WRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVPV DVSVVDLTC+L++PA Y  IK ++K A+   MKGIL YTE+ VVS DF GD HSSIFDA AGI L D FVKL++WYDNE+GYS RV DL+ +M +K+
Sbjct:    1 MSELCVGINGFGRIGRLVLRACLQKG-IKVTAINDPFIDLQYMVYMFKYDSTHGRYKGEVHMEDGKLIVDGQAISVFQCMKPAEIPWGDAGALYVVESTGVFLSIDKASAHIQGG-AKRVVVSAPSPDAPMFVMGVNQDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTRPASYANIKESVKKAAHGPMKGILGYTEDSVVSSDFVGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLMYMHSKE 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase, spermatogenic [Source:NCBI gene;Acc:406367])

HSP 1 Score: 492.271 bits (1266), Expect = 3.302e-175
Identity = 239/337 (70.92%), Postives = 277/337 (82.20%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPK-ISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            M++  VGINGFGRIGRLVLRA L+KG + V A+NDPFI+L YMVYMFKYDSTHG++ G V  +DGKL+VDG AISV+    P EIPW      YVVESTGVF +I+KAS H +   AK+V++SAPS DAPM+VMGVN +KYDP  ++IVSNASCTTNCLAPLAKVI DNFGI E LMTT+HAYTATQKTVDGPS+K WRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVPV DVSVVDLTC+L++PA Y  IK ++K A+   MKGIL YTE+ VVS DF GD HSSIFDA AGI L D FVKL++WYDNE+GYS RV DL+ +M +K+
Sbjct:    1 MSELCVGINGFGRIGRLVLRACLQKG-IKVTAINDPFIDLQYMVYMFKYDSTHGRYKGEVHMEDGKLIVDGQAISVFQCMKPAEIPWGDAGALYVVESTGVFLSIDKASAHIQGG-AKRVVVSAPSPDAPMFVMGVNQDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTRPASYANIKESVKKAAHGPMKGILGYTEDSVVSSDFVGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLMYMHSKE 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 380.178 bits (975), Expect = 2.033e-132
Identity = 182/238 (76.47%), Postives = 207/238 (86.97%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVS 797
            +VGINGFGRIGRLV RAA     V++VA+NDPFI+LDYMVYMF+YDSTHGK+ G V+ + GKLV+DGHAI+VY++++P  I W      YVVESTGVFTTIEKAS H K   AK+VIISAPSADAPM+VMGVNHEKYD  +++VSNASCTTNCLAPLAKVI DNF IVEGLM+T+HA TATQKTVDGPS KLWRDGRGA+QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VS
Sbjct:    3 KVGINGFGRIGRLVTRAAFLTKKVEIVAINDPFIDLDYMVYMFQYDSTHGKYKGEVKAEGGKLVIDGHAITVYSERDPANIKWGDAGATYVVESTGVFTTIEKASAHIKGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVINDNFVIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVS 239          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 509.99 bits (1312), Expect = 0.000e+0
Identity = 243/332 (73.19%), Postives = 283/332 (85.24%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            ++GINGFGRIGRLV RAA+  G  +VVA+NDPFI+LDYM YMFKYDSTHG+F G V  ++GKLV++G A++V+ +++P  I W      YVVESTGVFTT EKA +H K   AK+VIISAPSADAPM+V+GVNH+KYD  + +VSNASCTTNCLAPLAKVI DNFGI+EGLMTT+HA+TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLTC+LSKPAKYD+IKAAIK A+   MKGIL YTE++VVS DF GD HSSIFDA AGI L D FVKLV+WYDNE GYS RV+DL+ HM++K+
Sbjct:    4 KIGINGFGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGG-AKRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPMKGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHMASKE 334          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 501.516 bits (1290), Expect = 1.776e-178
Identity = 243/340 (71.47%), Postives = 282/340 (82.94%), Query Frame = 3
Query:   60 LLFNMTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            L +   KP    N FGRIGRLV RAA+  G  +VVA+NDPFI+LDYM YMFKYDSTHG+F G V  ++GKLV++G A++V+ +++P  I W      YVVESTGVFTT EKA +H K   AK+VIISAPSADAPM+V+GVNH+KYD  + +VSNASCTTNCLAPLAKVI DNFGI+EGLMTT+HA+TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLTC+LSKPAKYD+IKAAIK A+   MKGIL YTE++VVS DF GD HSSIFDA AGI L D FVKLV+WYDNE GYS RV+DL+ HM++K+
Sbjct:    6 LAWGFPKPTNEGNQFGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGG-AKRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPMKGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHMASKE 344          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 499.975 bits (1286), Expect = 6.468e-178
Identity = 239/326 (73.31%), Postives = 277/326 (84.97%), Query Frame = 3
Query:  102 FGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            FGRIGRLV RAA+  G  +VVA+NDPFI+LDYM YMFKYDSTHG+F G V  ++GKLV++G A++V+ +++P  I W      YVVESTGVFTT EKA +H K   AK+VIISAPSADAPM+V+GVNH+KYD  + +VSNASCTTNCLAPLAKVI DNFGI+EGLMTT+HA+TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLTC+LSKPAKYD+IKAAIK A+   MKGIL YTE++VVS DF GD HSSIFDA AGI L D FVKLV+WYDNE GYS RV+DL+ HM++K+
Sbjct:   17 FGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGG-AKRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPMKGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHMASKE 341          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 499.204 bits (1284), Expect = 7.539e-178
Identity = 239/326 (73.31%), Postives = 277/326 (84.97%), Query Frame = 3
Query:  102 FGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            FGRIGRLV RAA+  G  +VVA+NDPFI+LDYM YMFKYDSTHG+F G V  ++GKLV++G A++V+ +++P  I W      YVVESTGVFTT EKA +H K   AK+VIISAPSADAPM+V+GVNH+KYD  + +VSNASCTTNCLAPLAKVI DNFGI+EGLMTT+HA+TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLTC+LSKPAKYD+IKAAIK A+   MKGIL YTE++VVS DF GD HSSIFDA AGI L D FVKLV+WYDNE GYS RV+DL+ HM++K+
Sbjct:    7 FGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGG-AKRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPMKGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHMASKE 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 500.36 bits (1287), Expect = 9.652e-178
Identity = 239/326 (73.31%), Postives = 277/326 (84.97%), Query Frame = 3
Query:  102 FGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            FGRIGRLV RAA+  G  +VVA+NDPFI+LDYM YMFKYDSTHG+F G V  ++GKLV++G A++V+ +++P  I W      YVVESTGVFTT EKA +H K   AK+VIISAPSADAPM+V+GVNH+KYD  + +VSNASCTTNCLAPLAKVI DNFGI+EGLMTT+HA+TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLTC+LSKPAKYD+IKAAIK A+   MKGIL YTE++VVS DF GD HSSIFDA AGI L D FVKLV+WYDNE GYS RV+DL+ HM++K+
Sbjct:   40 FGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGG-AKRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPMKGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHMASKE 364          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:MGI Symbol;Acc:MGI:95640])

HSP 1 Score: 510.76 bits (1314), Expect = 0.000e+0
Identity = 244/344 (70.93%), Postives = 288/344 (83.72%), Query Frame = 3
Query:   48 LFSRLLFNMTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +F R +  M K  VG+NGFGRIGRLV RAA+  G V++VA+NDPFI+L+YMVYMF+YDSTHGKF+G V+ ++GKLV++G  I+++ +++P  I W      YVVESTGVFTT+EKA  H K   AK+VIISAPSADAPM+VMGVNHEKYD  + IVSNASCTTNCLAPLAKVI DNFGIVEGLMTT+HA TATQKTVDGPS KLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLTC+L KPAKYD+IK  +K ASE  +KGIL YTE++VVS DF  + HSS FDA AGI L D FVKL++WYDNEYGYS RV+DL+ +M++K+
Sbjct:   19 VFPRPVDKMVK--VGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE 359          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:MGI Symbol;Acc:MGI:95640])

HSP 1 Score: 509.99 bits (1312), Expect = 0.000e+0
Identity = 240/332 (72.29%), Postives = 283/332 (85.24%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VG+NGFGRIGRLV RAA+  G V++VA+NDPFI+L+YMVYMF+YDSTHGKF+G V+ ++GKLV++G  I+++ +++P  I W      YVVESTGVFTT+EKA  H K   AK+VIISAPSADAPM+VMGVNHEKYD  + IVSNASCTTNCLAPLAKVI DNFGIVEGLMTT+HA TATQKTVDGPS KLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLTC+L KPAKYD+IK  +K ASE  +KGIL YTE++VVS DF  + HSS FDA AGI L D FVKL++WYDNEYGYS RV+DL+ +M++K+
Sbjct:    3 KVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:MGI Symbol;Acc:MGI:95640])

HSP 1 Score: 509.99 bits (1312), Expect = 0.000e+0
Identity = 240/332 (72.29%), Postives = 283/332 (85.24%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VG+NGFGRIGRLV RAA+  G V++VA+NDPFI+L+YMVYMF+YDSTHGKF+G V+ ++GKLV++G  I+++ +++P  I W      YVVESTGVFTT+EKA  H K   AK+VIISAPSADAPM+VMGVNHEKYD  + IVSNASCTTNCLAPLAKVI DNFGIVEGLMTT+HA TATQKTVDGPS KLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLTC+L KPAKYD+IK  +K ASE  +KGIL YTE++VVS DF  + HSS FDA AGI L D FVKL++WYDNEYGYS RV+DL+ +M++K+
Sbjct:    3 KVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gm10358 (predicted gene 10358 [Source:MGI Symbol;Acc:MGI:3708786])

HSP 1 Score: 508.449 bits (1308), Expect = 0.000e+0
Identity = 239/332 (71.99%), Postives = 282/332 (84.94%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VG+NGFGRIGRLV RAA   G V++VA+NDPFI+L+YMVYMF+YDSTHGKF+G V+ ++GKLV++G  I+++ +++P  I W      YVVESTGVFTT+EKA  H K   AK+VIISAPSADAPM+VMGVNHEKYD  + IVSNASCTTNCLAPLAKVI DNFGIVEGLMTT+HA TATQKTVDGPS KLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VS+VDLTC+L KPAKYD+IK  +K ASE  +KGIL YTE++VVS DF  + HSS FDA AGI L D FVKL++WYDNEYGYS RV+DL+ +M++K+
Sbjct:    3 KVGVNGFGRIGRLVTRAATCSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSIVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gm3839 (predicted pseudogene 3839 [Source:MGI Symbol;Acc:MGI:3782011])

HSP 1 Score: 507.294 bits (1305), Expect = 0.000e+0
Identity = 238/332 (71.69%), Postives = 282/332 (84.94%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VG+NGFGRIGRLV RAA+  G V++VA+NDPFI+L+YMVYMF+YDSTHGKF+G V+ ++GKLV++G  I+++ +++P  I W      YVVESTGVFTT+EKA  H K   AK+VIISAPSADAPM+VMGVNHEKYD  + IVSNASCTTNCL+PLAKVI DNFGIVEGLMTT+HA TATQKTVDGPS KLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLTC+L  PAKYD+IK  +K ASE  +KGIL YTE++VVS DF  + HSS FDA AGI L D FVKL++WYDNEYGYS RV+DL+ +M++K+
Sbjct:    3 KVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLSPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLENPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|P20287|G3P_SCHMA (Glyceraldehyde-3-phosphate dehydrogenase OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 518.85 bits (1335), Expect = 0.000e+0
Identity = 248/337 (73.59%), Postives = 282/337 (83.68%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 1082
            M++ +VGINGFGRIGRLVLRAA  K TVDVV++NDPFI+L+YMVYM K DSTHG F G V T++GKL V+G  ISV+ +++P  IPWD D   YVVESTGVFTTI+KA  H KNNRAKKVIISAPSADAPM+V+GVN   Y+  +S+VSNASCTTNCLAPLAKVI D F IVEGLMTT+H++TATQK VDGPSSKLWRDGRGA QNIIPASTGAAKAVGKVIP LNGK+TGMAFRVP PDVSVVDLTC+L K A Y+EIKAA+K A+   +KGIL YTE+EVVS DF G   SSIFDAKAGI L + FVKLV+WYDNE+GYSCRV+DLI HM   DH
Sbjct:    1 MSRAKVGINGFGRIGRLVLRAAFLKNTVDVVSVNDPFIDLEYMVYMIKRDSTHGTFPGEVSTENGKLKVNGKLISVHCERDPANIPWDKDGAEYVVESTGVFTTIDKAQAHIKNNRAKKVIISAPSADAPMFVVGVNENSYEKSMSVVSNASCTTNCLAPLAKVIHDKFEIVEGLMTTVHSFTATQKVVDGPSSKLWRDGRGAMQNIIPASTGAAKAVGKVIPALNGKLTGMAFRVPTPDVSVVDLTCRLGKGASYEEIKAAVKAAASGPLKGILEYTEDEVVSSDFVGSTSSSIFDAKAGISLNNNFVKLVSWYDNEFGYSCRVVDLITHMHKVDH 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|P51469|G3P_XENLA (Glyceraldehyde-3-phosphate dehydrogenase OS=Xenopus laevis OX=8355 GN=gapdh PE=2 SV=2)

HSP 1 Score: 514.998 bits (1325), Expect = 0.000e+0
Identity = 244/332 (73.49%), Postives = 283/332 (85.24%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VGINGFG IGRLV RAA + G V VVA+NDPFI+LDYMVYMFKYDSTHG+F G V+ ++GKL+++   I+V+ +++P  I W      YVVESTGVFTT EKAS+H K   AK+V+ISAPSADAPM+V+GVNHEKY+  + +VSNASCTTNCLAPLAKVI DNFGIVEGLMTT+HA+TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGKITGMAFRVP P+VSVVDLTC+L KPAKYD+IKAAIK ASE  MKGIL YT+++VVS DF GD HSSIFDA AGI L + FVKLV+WYDNE GYS RV+DL+ HM++K+
Sbjct:    3 KVGINGFGCIGRLVTRAAFDSGKVQVVAINDPFIDLDYMVYMFKYDSTHGRFKGTVKAENGKLIINDQVITVFQERDPSSIKWGDAGAVYVVESTGVFTTTEKASLHLKGG-AKRVVISAPSADAPMFVVGVNHEKYENSLKVVSNASCTTNCLAPLAKVINDNFGIVEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPTPNVSVVDLTCRLQKPAKYDDIKAAIKTASEGPMKGILGYTQDQVVSTDFNGDTHSSIFDADAGIALNENFVKLVSWYDNECGYSNRVVDLVCHMASKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|Q4KYY3|G3P_SPECI (Glyceraldehyde-3-phosphate dehydrogenase OS=Spermophilus citellus OX=9997 GN=GAPDH PE=2 SV=3)

HSP 1 Score: 514.612 bits (1324), Expect = 0.000e+0
Identity = 243/332 (73.19%), Postives = 282/332 (84.94%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VG+NGFGRIGRLV RAA   G VD+VA+NDPFI+L+YMVYMF+YDSTHGKFHG V+ ++GKLV++G +IS++ +++P  I W      YVVESTGVFTT+EKA  H K   AK+VIISAPSADAPM+VMGVNHEKYD  + IVSNASCTTNCLAPLAKVI DNFGIVEGLMTT+HA TATQKTVDGPS KLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLTC+L K AKYD+IK  +K ASE  +KGIL YTE++VVS DF  D HSS FDA AGI L D FVKL++WYDNE+GYS RV+DL+ HM++K+
Sbjct:    3 KVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGKSISIFQERDPANIKWGDAGAEYVVESTGVFTTMEKAGAHLKGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKAAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMVHMASKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|Q05025|G3P_COTJA (Glyceraldehyde-3-phosphate dehydrogenase OS=Coturnix japonica OX=93934 GN=GAPDH PE=2 SV=2)

HSP 1 Score: 513.842 bits (1322), Expect = 0.000e+0
Identity = 244/332 (73.49%), Postives = 283/332 (85.24%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VG+NGFGRIGRLV RAA+  G V VVA+NDPFI+L+YMVYMFKYDSTHG F G V+ ++GKLV++G+AI+++ +++P  I W      YVVESTGVFTT+EKA  H K   AK+VIISAPSADAPM+VMGVNHEKYD  + IVSNASCTTNCLAPLAKVI DNFGIVEGLMTT+HA TATQKTVDGPS KLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLTC+L KPAKYD+IK  +K A+E  +KGIL YTE++VVS DF GD HSS FDA AGI L D FVKLV+WYDNE+GYS RV+DL+ HM++K+
Sbjct:    3 KVGVNGFGRIGRLVTRAAVLSGKVQVVAINDPFIDLNYMVYMFKYDSTHGHFKGTVKAENGKLVINGNAITIFQERDPSNIKWGDAGAEYVVESTGVFTTMEKAGAHLKGG-AKRVIISAPSADAPMFVMGVNHEKYDKSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKRVVKAAAEGPLKGILGYTEDQVVSCDFNGDSHSSTFDAGAGIALNDNFVKLVSWYDNEFGYSNRVVDLMVHMASKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|P04406|G3P_HUMAN (Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3)

HSP 1 Score: 513.457 bits (1321), Expect = 0.000e+0
Identity = 241/336 (71.73%), Postives = 283/336 (84.23%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            M K +VG+NGFGRIGRLV RAA   G VD+VA+NDPFI+L+YMVYMF+YDSTHGKFHG V+ ++GKLV++G+ I+++ +++P +I W      YVVESTGVFTT+EKA  H +   AK+VIISAPSADAPM+VMGVNHEKYD  + I+SNASCTTNCLAPLAKVI DNFGIVEGLMTT+HA TATQKTVDGPS KLWRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP  +VSVVDLTC+L KPAKYD+IK  +K ASE  +KGIL YTE +VVS DF  D HSS FDA AGI L D FVKL++WYDNE+GYS RV+DL+ HM++K+
Sbjct:    1 MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: D0VYP9 (Glyceraldehyde-3-phosphate dehydrogenase OS=Dugesia japonica OX=6161 GN=DjG3PDH PE=2 SV=1)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 317/337 (94.07%), Postives = 330/337 (97.92%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 1082
            MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHG+VE KDGKLVV+GHA+SVYNK+ PEEIPWDHDQCYYVVESTGVFTTIEKAS+HTKNNRAKKVIISAPSADAPM+VMGVNHEKY+P +SIVSNASCTTNCLAPLAKV+ D+FGI EGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKL KPAKYDEIKAAIKHASET+MKGILAYT+EEVVSQDFKGDH+SSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLI HMSTKDH
Sbjct:    1 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGNVEAKDGKLVVNGHAMSVYNKRAPEEIPWDHDQCYYVVESTGVFTTIEKASLHTKNNRAKKVIISAPSADAPMFVMGVNHEKYEPSLSIVSNASCTTNCLAPLAKVVNDHFGIEEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLKKPAKYDEIKAAIKHASETTMKGILAYTDEEVVSQDFKGDHNSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIPHMSTKDH 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: H1ZYM3 (Glyceraldehyde-3-phosphate dehydrogenase OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 635.565 bits (1638), Expect = 0.000e+0
Identity = 316/337 (93.77%), Postives = 326/337 (96.74%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 1082
            MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVE KDGKLVVDGHAISVYNK+ PEEIPWDHDQCYYVVES GVFTTIEKAS+H KNNRAKKVIISAPSADAPM+VMGVNHEKY+P +SIVSNASCTTNCLAPLAKV+ D+FGI EGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKL KPAKYDEIKAAIKHA ET+MKGILAYT+EEVVSQDFKGDH+SSIFDAKAGIQLTDTFVKLVAWYDNEYGYS RVIDLI HMSTKDH
Sbjct:    1 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVEAKDGKLVVDGHAISVYNKRAPEEIPWDHDQCYYVVESAGVFTTIEKASLHAKNNRAKKVIISAPSADAPMFVMGVNHEKYEPSLSIVSNASCTTNCLAPLAKVVNDHFGIEEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLKKPAKYDEIKAAIKHAFETTMKGILAYTDEEVVSQDFKGDHNSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSYRVIDLIHHMSTKDH 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: A0A4S2L017 (Glyceraldehyde-3-phosphate dehydrogenase OS=Opisthorchis felineus OX=147828 GN=CRM22_010319 PE=3 SV=1)

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 259/337 (76.85%), Postives = 299/337 (88.72%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 1082
            M+KP+VGINGFGRIGRLVLRAA++KGTVD+VA+NDPFI+L YMVYMFKYDSTHG F G V  ++ KL V+G  ISVYN+++PE IPWD D   YVVESTGVFTTI+KA  H KNNRA+KVIISAPSADAPM+V+GVNHE YD  +++VSNASCTTNCLAPLAKV+ +NFGI EGLMTT+H+YTATQK VDGPS+KLWRDGRGAAQNIIPASTGAA+AVGKVIP+LNGK+TGMA RVP PDVSVVDLTCKLSKPAKY++IKAAIK A+E  MKGIL YTE++VVS DF+G   SS+FDA+AGIQL DTFVKL++WYDNEYGYSCRV+DLI HM + DH
Sbjct:    1 MSKPKVGINGFGRIGRLVLRAAVKKGTVDIVAVNDPFIDLPYMVYMFKYDSTHGTFDGEVSIREKKLCVNGMMISVYNERSPETIPWDKDMAEYVVESTGVFTTIDKAQAHLKNNRARKVIISAPSADAPMFVVGVNHEVYDKCMNVVSNASCTTNCLAPLAKVVHENFGIEEGLMTTVHSYTATQKVVDGPSAKLWRDGRGAAQNIIPASTGAARAVGKVIPDLNGKLTGMALRVPTPDVSVVDLTCKLSKPAKYEQIKAAIKEAAEGPMKGILMYTEDQVVSMDFRGCSASSVFDAEAGIQLNDTFVKLISWYDNEYGYSCRVVDLILHMYSVDH 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: A0A074ZMY8 (Glyceraldehyde-3-phosphate dehydrogenase OS=Opisthorchis viverrini OX=6198 GN=T265_05806 PE=3 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 259/337 (76.85%), Postives = 298/337 (88.43%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 1082
            M+KP+VGINGFGRIGRLVLRAA+++GT+DVVA+NDPFI+L YMVYMFKYDSTHG F G V  ++ KL ++G  ISVYN+++PE IPWD D   YVVESTGVFTTI+KA  H KNNRA+KVIISAPSADAPM+V+GVNHE YD  +++VSNASCTTNCLAPLAKV+ +NFGI EGLMTT+H+YTATQK VDGPS KLWRDGRGAAQNIIPASTGAA+AVGKVIP+LNGK+TGMA RVP PDVSVVDLTCKLSKPAKY+EIKAAIK A+E  MKGIL YTE++VVS DF+G   SS+FDA+AGIQL DTFVKL++WYDNEYGYSCRVIDLI HM + DH
Sbjct:    1 MSKPKVGINGFGRIGRLVLRAAVKQGTIDVVAVNDPFIDLPYMVYMFKYDSTHGTFDGEVSIREKKLCINGMMISVYNERSPETIPWDKDMAEYVVESTGVFTTIDKAQAHLKNNRARKVIISAPSADAPMFVVGVNHEIYDKCMNVVSNASCTTNCLAPLAKVVHENFGIEEGLMTTVHSYTATQKVVDGPSGKLWRDGRGAAQNIIPASTGAARAVGKVIPDLNGKLTGMALRVPTPDVSVVDLTCKLSKPAKYEEIKAAIKEAAEGPMKGILMYTEDQVVSMDFRGCSASSVFDAEAGIQLNDTFVKLISWYDNEYGYSCRVIDLILHMYSVDH 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: A0A419PIU4 (Glyceraldehyde-3-phosphate dehydrogenase OS=Clonorchis sinensis OX=79923 GN=CSKR_3431s PE=3 SV=1)

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 257/337 (76.26%), Postives = 298/337 (88.43%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 1082
            M+KP+VGINGFGRIGRLVLRAA++KGT+DVVA+NDPFI+L YMVYMFKYDSTHG F G V  ++ KL ++G  ISVYN+++PE IPWD D   YVVESTGVFTTI+KA  H KNNRA+KVIISAPSADAPM+V+GVNH+ YD  +++VSNASCTTNCLAPLAKV+ +NFGI EGLMTT+H+YTATQK VDGPS KLWRDGRGAAQNIIPASTGAA+AVGKVIP+LNGK+TGMA RVP PDVSVVDLTCKLSKPAKY++IKAAIK A+E  MKGIL YTE++VVS DF+G   SS+FDA+AGIQL DTFVKL++WYDNEYGYSCRV+DLI HM + DH
Sbjct:    1 MSKPKVGINGFGRIGRLVLRAAVKKGTIDVVAVNDPFIDLPYMVYMFKYDSTHGTFDGEVSIREKKLCINGMMISVYNERSPETIPWDKDMAEYVVESTGVFTTIDKAQAHLKNNRARKVIISAPSADAPMFVVGVNHDVYDKCMNVVSNASCTTNCLAPLAKVVHENFGIEEGLMTTVHSYTATQKVVDGPSGKLWRDGRGAAQNIIPASTGAARAVGKVIPDLNGKLTGMALRVPTPDVSVVDLTCKLSKPAKYEQIKAAIKEAAEGPMKGILMYTEDQVVSMDFRGCSASSVFDAEAGIQLNDTFVKLISWYDNEYGYSCRVVDLILHMYSVDH 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:103027606])

HSP 1 Score: 509.99 bits (1312), Expect = 0.000e+0
Identity = 246/332 (74.10%), Postives = 279/332 (84.04%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VGINGFGRIGRLV RAA     V+VVA+NDPFI+LDYMVYMFKYDSTHGK+ G V+ + GKLV+DGHAI+V+++++P  I W      YVVESTGVFTTIEKAS H K   AK+VIISAPSADAPM+VMGVNHEKYD  + +VSNASCTTNCLAPLAKVI DNF I+EGLM+T+HA TATQKTVDGPS KLWRDGRGA+QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLT +L KPAKYD+IK  +K ASE  MKGIL YTE +VVS DF GD  SSIFDA AGI L D FVKLV WYDNE+GYS RV DL+ HM++K+
Sbjct:    3 KVGINGFGRIGRLVTRAAFHSKKVEVVAINDPFIDLDYMVYMFKYDSTHGKYKGEVKAEGGKLVIDGHAITVFSERDPANIKWGDAGADYVVESTGVFTTIEKASAHLKGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLKVVSNASCTTNCLAPLAKVINDNFVIIEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDDIKKVVKAASEGPMKGILGYTEHQVVSTDFNGDERSSIFDAGAGIALNDHFVKLVTWYDNEFGYSNRVCDLMAHMASKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: ENSAMXT00000050002.1 (glyceraldehyde-3-phosphate dehydrogenase-like [Source:NCBI gene;Acc:103041091])

HSP 1 Score: 489.574 bits (1259), Expect = 3.758e-174
Identity = 231/332 (69.58%), Postives = 274/332 (82.53%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VGINGFGRIGRLV R A     VD+VA+NDPFI+++YMVYMF YDSTHG+F G V++++GKL ++ H I+V+++K+P  I W      YVVESTGVFTT+EKAS H K   AK+VIISAPSADAPM+VMGVN   YD  + ++SNASCTTNCLAPLAKVI DNFGI+EGLM+T+HA TATQKTVDGPS KLWRDGRGA+QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLT +L KPAKY+ IK  +K A+E  ++GIL YT+E +VS DF GD HSS FDA AGI L+D FVKLV WYDNEYGYS RVIDL+ ++S K+
Sbjct:    3 KVGINGFGRIGRLVTRVAFLTEKVDIVAINDPFIDIEYMVYMFTYDSTHGRFKGEVKSENGKLFINNHPITVFSEKDPANIKWADTGAEYVVESTGVFTTVEKASAHLKGG-AKRVIISAPSADAPMFVMGVNQNVYDKSMKVISNASCTTNCLAPLAKVIHDNFGIIEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYERIKKVVKAAAEGPLRGILGYTDEPLVSTDFNGDSHSSYFDADAGIALSDNFVKLVTWYDNEYGYSSRVIDLMVYISAKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:111192112])

HSP 1 Score: 489.574 bits (1259), Expect = 3.908e-174
Identity = 238/337 (70.62%), Postives = 276/337 (81.90%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPK-ISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            M+   VGINGFGRIGRLVLRA L+KG + V A+NDPFI+L YMVYMFKYDSTHG++HG V  ++GKL+VD  AISV+    P EIPW      YVVESTGVF ++EKAS H +   AK+V++SAPS DAPM+VMGVN +KYDP  ++IVSNASCTTNCLAPLAKVI DNFGI E LMTT+HAYTATQKTVDGPS+K WRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVPV DVSVVDLTC+L+KPA Y +IK A+K A+   +KG L YTE+ VVS DF GD HSSIFDA AGI L D FVKL++WYDNE+GYS RV DL+ +M +K+
Sbjct:    1 MSDLCVGINGFGRIGRLVLRACLQKG-IKVTAINDPFIDLQYMVYMFKYDSTHGRYHGEVRQENGKLIVDDQAISVFQCMKPAEIPWGDAGAVYVVESTGVFLSVEKASSHIQGG-AKRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTKPASYADIKEAVKKAAHGPLKGFLGYTEDSVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLLYMHSKE 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:111192112])

HSP 1 Score: 489.574 bits (1259), Expect = 3.908e-174
Identity = 238/337 (70.62%), Postives = 276/337 (81.90%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPK-ISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            M+   VGINGFGRIGRLVLRA L+KG + V A+NDPFI+L YMVYMFKYDSTHG++HG V  ++GKL+VD  AISV+    P EIPW      YVVESTGVF ++EKAS H +   AK+V++SAPS DAPM+VMGVN +KYDP  ++IVSNASCTTNCLAPLAKVI DNFGI E LMTT+HAYTATQKTVDGPS+K WRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVPV DVSVVDLTC+L+KPA Y +IK A+K A+   +KG L YTE+ VVS DF GD HSSIFDA AGI L D FVKL++WYDNE+GYS RV DL+ +M +K+
Sbjct:    1 MSDLCVGINGFGRIGRLVLRACLQKG-IKVTAINDPFIDLQYMVYMFKYDSTHGRYHGEVRQENGKLIVDDQAISVFQCMKPAEIPWGDAGAVYVVESTGVFLSVEKASSHIQGG-AKRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTKPASYADIKEAVKKAAHGPLKGFLGYTEDSVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLLYMHSKE 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:111192112])

HSP 1 Score: 489.574 bits (1259), Expect = 3.908e-174
Identity = 238/337 (70.62%), Postives = 276/337 (81.90%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPK-ISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            M+   VGINGFGRIGRLVLRA L+KG + V A+NDPFI+L YMVYMFKYDSTHG++HG V  ++GKL+VD  AISV+    P EIPW      YVVESTGVF ++EKAS H +   AK+V++SAPS DAPM+VMGVN +KYDP  ++IVSNASCTTNCLAPLAKVI DNFGI E LMTT+HAYTATQKTVDGPS+K WRDGRGA QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVPV DVSVVDLTC+L+KPA Y +IK A+K A+   +KG L YTE+ VVS DF GD HSSIFDA AGI L D FVKL++WYDNE+GYS RV DL+ +M +K+
Sbjct:    1 MSDLCVGINGFGRIGRLVLRACLQKG-IKVTAINDPFIDLQYMVYMFKYDSTHGRYHGEVRQENGKLIVDDQAISVFQCMKPAEIPWGDAGAVYVVESTGVFLSVEKASSHIQGG-AKRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTKPASYADIKEAVKKAAHGPLKGFLGYTEDSVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLLYMHSKE 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Sea Lamprey
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 482.641 bits (1241), Expect = 1.570e-172
Identity = 228/304 (75.00%), Postives = 266/304 (87.50%), Query Frame = 3
Query:   87 VGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFV 998
            +GINGFGRIGRLV RAA++K  ++VVA+NDPFI+L+YMVYMFKYDSTHG+F G V+ +DGKL+++GHA+SVY++++P  IPW      YVVESTGVFTTI+KAS+H K   AK VIISAPSADAPM+VMGVNHEKYDP + +VSNASCTTNCLAPLAKVI DNFGIVEGLMTT+H+YTATQKTVDGPS+KLWRDGRGA+QNIIPASTGAAKAVG VIPELNGK+TGMAFRVP P+VSVVDLTC+L+KPA YDEIKA ++ AS+  +KGIL YTE+ VVS DF GD HSSIFDA+AGI L   FV
Sbjct:    4 IGINGFGRIGRLVARAAVQKEDINVVAINDPFIDLEYMVYMFKYDSTHGRFKGDVKVEDGKLLINGHAVSVYSERDPANIPWGKHGADYVVESTGVFTTIDKASLHLKGG-AKHVIISAPSADAPMFVMGVNHEKYDPSLKVVSNASCTTNCLAPLAKVINDNFGIVEGLMTTVHSYTATQKTVDGPSAKLWRDGRGASQNIIPASTGAAKAVGMVIPELNGKLTGMAFRVPTPNVSVVDLTCRLAKPASYDEIKAKVREASKGDLKGILGYTEDLVVSTDFNGDTHSSIFDAQAGIALNKQFV 306          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Sea Lamprey
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 405.986 bits (1042), Expect = 4.500e-143
Identity = 191/250 (76.40%), Postives = 222/250 (88.80%), Query Frame = 3
Query:   93 INGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYD 842
            IN FGRIGRLV RAA++K  ++VVA+NDPFI+L+YMVYMFKYDSTHG+F G V+ +DGKL+++GHA+SVY++++P  IPW      YVVESTGVFTTI+KAS+H K   AK VIISAPSADAPM+VMGVNHEKYDP + +VSNASCTTNCLAPLAKVI DNFGIVEGLMTT+H+YTATQKTVDGPS+KLWRDGRGA+QNIIPASTGAAKAVG VIPELNGK+TGMAFRVP P+VSVVDLTC+L+KP   D
Sbjct:    7 INQFGRIGRLVARAAVQKEDINVVAINDPFIDLEYMVYMFKYDSTHGRFKGDVKVEDGKLLINGHAVSVYSERDPANIPWGKHGADYVVESTGVFTTIDKASLHLKGG-AKHVIISAPSADAPMFVMGVNHEKYDPSLKVVSNASCTTNCLAPLAKVINDNFGIVEGLMTTVHSYTATQKTVDGPSAKLWRDGRGASQNIIPASTGAAKAVGMVIPELNGKLTGMAFRVPTPNVSVVDLTCRLAKPVTRD 255          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Yeast
Match: TDH3 (Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), isozyme 3; involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell wall; GAPDH-derived antimicrobial peptides secreted by S. cerevisiae are active against a wide variety of wine-related yeasts and bacteria; binds AU-rich RNA [Source:SGD;Acc:S000003424])

HSP 1 Score: 443.351 bits (1139), Expect = 8.300e-157
Identity = 213/329 (64.74%), Postives = 254/329 (77.20%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMS 1070
            RV INGFGRIGRLV+R AL +  V+VVALNDPFI  DY  YMFKYDSTHG++ G V   D  ++VDG  I+ Y +++P  +PW        ++STGVF  ++ A  H  +  AKKV+I+APS+ APM+VMGVN EKY   + IVSNASCTTNCLAPLAKVI D FGI EGLMTT+H+ TATQKTVDGPS K WR GR A+ NIIP+STGAAKAVGKV+PEL GK+TGMAFRVP  DVSVVDLT KL+K   YDEIK  +K A+E  +KG+L YTE+ VVS DF GD HSSIFDA AGIQL+  FVKLV+WYDNEYGYS RV+DL++H++
Sbjct:    3 RVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYAGEVSHDDKHIIVDGKKIATYQERDPANLPWGSSNVDIAIDSTGVFKELDTAQKHI-DAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSHSSIFDASAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHVA 330          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Yeast
Match: TDH2 (Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), isozyme 2; involved in glycolysis and gluconeogenesis; tetramer that catalyzes reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in cytoplasm and cell wall; protein abundance increases in response to DNA replication stress; GAPDH-derived antimicrobial peptides are active against a wide variety of wine-related yeasts and bateria; TDH2 has a paralog, TDH3, that arose from the whole genome duplication [Source:SGD;Acc:S000003769])

HSP 1 Score: 442.965 bits (1138), Expect = 9.158e-157
Identity = 212/329 (64.44%), Postives = 256/329 (77.81%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMS 1070
            RV INGFGRIGRLV+R AL++  V+VVALNDPFI  DY  YMFKYDSTHG++ G V   D  ++VDGH I+ + +++P  +PW        ++STGVF  ++ A  H  +  AKKV+I+APS+ APM+VMGVN EKY   + IVSNASCTTNCLAPLAKVI D FGI EGLMTT+H+ TATQKTVDGPS K WR GR A+ NIIP+STGAAKAVGKV+PEL GK+TGMAFRVP  DVSVVDLT KL+K   YDEIK  +K A+E  +KG+L YTE+ VVS DF GD +SSIFDA AGIQL+  FVKLV+WYDNEYGYS RV+DL++H++
Sbjct:    3 RVAINGFGRIGRLVMRIALQRKNVEVVALNDPFISNDYSAYMFKYDSTHGRYAGEVSHDDKHIIVDGHKIATFQERDPANLPWASLNIDIAIDSTGVFKELDTAQKHI-DAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSMTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSNSSIFDAAAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHVA 330          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Yeast
Match: TDH1 (Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), isozyme 1; involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell wall; protein abundance increases in response to DNA replication stress; GAPDH-derived antimicrobial peptides secreted by S. cerevisiae are active against a wide variety of wine-related yeasts and bateria [Source:SGD;Acc:S000003588])

HSP 1 Score: 437.187 bits (1123), Expect = 2.093e-154
Identity = 210/329 (63.83%), Postives = 256/329 (77.81%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMS 1070
            R+ INGFGRIGRLVLR AL++  ++VVA+NDPFI  DY  YM KYDSTHG++ G V   D  +++DG  I+ Y +++P  +PW   +    V+STGVF  ++ A  H  +  AKKV+I+APS+ APM+V+GVNH KY P   IVSNASCTTNCLAPLAKVI D FGI EGLMTT+H+ TATQKTVDGPS K WR GR A+ NIIP+STGAAKAVGKV+PEL GK+TGMAFRVP  DVSVVDLT KL K A YD+IK A+K A+E  MKG+L YTE+ VVS DF GD H+SIFDA AGIQL+  FVKL++WYDNEYGYS RV+DLI++++
Sbjct:    3 RIAINGFGRIGRLVLRLALQRKDIEVVAVNDPFISNDYAAYMVKYDSTHGRYKGTVSHDDKHIIIDGVKIATYQERDPANLPWGSLKIDVAVDSTGVFKELDTAQKHI-DAGAKKVVITAPSSSAPMFVVGVNHTKYTPDKKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSMTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLEKEATYDQIKKAVKAAAEGPMKGVLGYTEDAVVSSDFLGDTHASIFDASAGIQLSPKFVKLISWYDNEYGYSARVVDLIEYVA 330          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO40842 (Glyceraldehyde-3-phosphate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7S5Y2])

HSP 1 Score: 509.605 bits (1311), Expect = 0.000e+0
Identity = 244/330 (73.94%), Postives = 282/330 (85.45%), Query Frame = 3
Query:   90 GINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASET-SMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTK 1076
            GINGFGRIGRLV RA+LE+  V +VA+NDPFI+LDYMVYMFKYDSTHG+F G VE KDGKLV++G  +SV+  K+P +IPW      YVVESTGVFTT+EKA  H K   AKKVIISAPSADAPM+VMGVNHEKYDP +++VSNASCTTNCLAPL KVI DNFG+ EGLMTTIHAYTATQKTVDGPS+K WRDGRGA QN+IPASTGAAKAVGKVIPE+NGK+TGMAFRVPV DVSVVDLTC+L KPAKY+EIKA +K ASE+  M   L YTE++VVS DF G+  SS+FDA+AGIQL D FVKLV WYDNEYGYS RV+DL+++M+++
Sbjct:    5 GINGFGRIGRLVCRASLERDDVQIVAINDPFIDLDYMVYMFKYDSTHGRFKGTVEAKDGKLVINGKPVSVFACKDPTQIPWGETGADYVVESTGVFTTLEKAGFHLKGG-AKKVIISAPSADAPMFVMGVNHEKYDPSMTVVSNASCTTNCLAPLVKVINDNFGLEEGLMTTIHAYTATQKTVDGPSAKNWRDGRGAHQNVIPASTGAAKAVGKVIPEVNGKLTGMAFRVPVADVSVVDLTCRLKKPAKYEEIKAVVKKASESKEMGQYLGYTEDQVVSTDFIGERVSSVFDARAGIQLNDKFVKLVTWYDNEYGYSHRVVDLMRYMASR 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO29412 (Glyceraldehyde-3-phosphate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7T3Q4])

HSP 1 Score: 219.164 bits (557), Expect = 2.054e-69
Identity = 119/269 (44.24%), Postives = 175/269 (65.06%), Query Frame = 3
Query:  270 LVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPS--ADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMS 1070
            + +DG AI ++++++P ++ W       V E TG FT  E A++H     AKKV++SAP+  ADA + V GVNH+    + ++VSNASCTTNCLAPLAKV+ ++ GI EG+MTTIHAYT  Q   D  S+ ++R  R A  ++IP  TGAA+AVG V+PEL GK++G+A RVP  +VS+VDL+   ++    +EI   ++ AS+ S   I+ Y E  +VS DF     S IFD+    ++++  +K+ AWYDNE+G+S R++D    MS
Sbjct:    1 MYIDGDAIQIFSERDPHKLDWKSLDIDIVFECTGRFTEREAAAVHLAQG-AKKVLVSAPAKGADATI-VYGVNHDILTAEHTVVSNASCTTNCLAPLAKVLNEHIGITEGMMTTIHAYTNDQHLSDVYSNDIYR-ARAATLSMIPTRTGAAEAVGLVLPELKGKLSGLAVRVPTANVSLVDLSFTPARATHAEEINHLMREASQGSFSNIIEYNELPLVSVDFNHHPASCIFDSTQ-TRVSEGLIKVFAWYDNEWGFSNRMLDTALAMS 265          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO25919 (Glyceraldehyde-3-phosphate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7TDD3])

HSP 1 Score: 175.637 bits (444), Expect = 2.327e-52
Identity = 106/269 (39.41%), Postives = 152/269 (56.51%), Query Frame = 3
Query:  282 GHAISVYNKKNPEEIPWDH--DQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDP-KISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAI-KHASETSMKGILAYT-EEEVVSQDFKGDHHSSIFDAKAGIQLTD-TFVKLVAWYDNEYGYSCRVIDLIQHMS 1070
            G  + +     PEEI +     +   V+++TG FTT E    H  +  A KV+++AP    P  V GVNH +++P +++I S ASCTTN + P+  VI D  G+ +G + TIHAYT  Q  VD    K +R GR AA N++   TGA  AV K +P L GK+T  A RVPVP+ S+V L  ++ K    +E+   I K+A E  +   + Y+   E+VS D  G    SI+D+ A I   D   + +  WYDNEYGYS +VI L +++S
Sbjct:    1 GTTVHLITANGPEEIDYTQYGIEDALVIDNTGAFTTEEALQRHLTSKGATKVLLTAPGKGVPNIVYGVNHTEFNPDEVNIYSAASCTTNAITPILNVIEDTLGVTKGHIETIHAYTNDQNLVDNMHKK-YRRGRSAALNMVITETGAGSAVAKALPSLAGKLTSNAIRVPVPNGSLVVLNLEVDKTTTVEELNNIIKKYALEGKLVEQIKYSLNNELVSSDIVGTPAPSIYDSNATIVSADGKNIVMYVWYDNEYGYSHQVIRLAKYIS 268          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:101172760])

HSP 1 Score: 512.301 bits (1318), Expect = 0.000e+0
Identity = 244/332 (73.49%), Postives = 280/332 (84.34%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VGINGFGRIGRLV RAA     V++VA+NDPFI+LDYMVYMFKYDSTH +F G V+ + GKLV+DGH I+V+++++P  I W      YVVESTGVFTTIEKAS H K   AK+VIISAPSADAPM+VMGVNHEKYD  +++VSNASCTTNCLAPLAKV+ DNFGIVEGLM+T+HA TATQKTVDGPS KLWRDGRGA+QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLT +L KPAKYD+IK  +K ASE  MKG L YTE++VVS DF GD HSSIFDA AGI L D FVKLV+WYDNE+GYS RV DL+ HM+ K+
Sbjct:    3 KVGINGFGRIGRLVTRAAFTSKKVEIVAINDPFIDLDYMVYMFKYDSTHNRFKGEVKAEGGKLVIDGHQITVFHERDPTNIKWGEAGAQYVVESTGVFTTIEKASAHLKGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVVHDNFGIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDDIKKVVKAASEGPMKGFLGYTEDQVVSTDFNGDTHSSIFDAGAGIALNDHFVKLVSWYDNEFGYSNRVCDLMAHMAAKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:101172760])

HSP 1 Score: 512.301 bits (1318), Expect = 0.000e+0
Identity = 244/332 (73.49%), Postives = 280/332 (84.34%), Query Frame = 3
Query:   84 RVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            +VGINGFGRIGRLV RAA     V++VA+NDPFI+LDYMVYMFKYDSTH +F G V+ + GKLV+DGH I+V+++++P  I W      YVVESTGVFTTIEKAS H K   AK+VIISAPSADAPM+VMGVNHEKYD  +++VSNASCTTNCLAPLAKV+ DNFGIVEGLM+T+HA TATQKTVDGPS KLWRDGRGA+QNIIPASTGAAKAVGKVIPELNGK+TGMAFRVP P+VSVVDLT +L KPAKYD+IK  +K ASE  MKG L YTE++VVS DF GD HSSIFDA AGI L D FVKLV+WYDNE+GYS RV DL+ HM+ K+
Sbjct:    3 KVGINGFGRIGRLVTRAAFTSKKVEIVAINDPFIDLDYMVYMFKYDSTHNRFKGEVKAEGGKLVIDGHQITVFHERDPTNIKWGEAGAQYVVESTGVFTTIEKASAHLKGG-AKRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVVHDNFGIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDDIKKVVKAASEGPMKGFLGYTEDQVVSTDFNGDTHSSIFDAGAGIALNDHFVKLVSWYDNEFGYSNRVCDLMAHMAAKE 333          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:101167730])

HSP 1 Score: 496.893 bits (1278), Expect = 4.695e-177
Identity = 242/337 (71.81%), Postives = 278/337 (82.49%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPK-ISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            M    VGINGFGRIGRLVLRA L+KG + VVA+NDPFI+L YMVYMFKYDSTHG++HG V  +DGKL+VDG+AISV+    P EIPW      YVVESTGVF ++EKAS+H +   A++V++SAPS DAPM+VMGVN +KYDP  ++IVSNASCTTNCLAPLAKVI DNFGI E LMTT+HAYTATQKTVDGPS+K WRDGRGA  NIIPASTGAAKAVGKVIP LNGK+TGMAFRVPV DVSVVDLTC+LSK A Y EIK A+K A+   MKGIL YTE++VVS DF GD HSSIFDA AGI L D FVKL++WYDNEYGYS RV DL+ +M +K+
Sbjct:    1 MADLHVGINGFGRIGRLVLRACLQKG-IKVVAINDPFIDLQYMVYMFKYDSTHGRYHGEVSHEDGKLIVDGNAISVFQCMKPAEIPWGSAGAKYVVESTGVFLSVEKASLHIQGG-AQRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHANIIPASTGAAKAVGKVIPALNGKLTGMAFRVPVADVSVVDLTCRLSKAASYGEIKEAVKKAAHGPMKGILGYTEDQVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEYGYSTRVADLLLYMHSKE 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:101167730])

HSP 1 Score: 438.343 bits (1126), Expect = 1.247e-154
Identity = 212/295 (71.86%), Postives = 244/295 (82.71%), Query Frame = 3
Query:  198 MVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPK-ISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKD 1079
            MVYMFKYDSTHG++HG V  +DGKL+VDG+AISV+    P EIPW      YVVESTGVF ++EKAS+H +   A++V++SAPS DAPM+VMGVN +KYDP  ++IVSNASCTTNCLAPLAKVI DNFGI E LMTT+HAYTATQKTVDGPS+K WRDGRGA  NIIPASTGAAKAVGKVIP LNGK+TGMAFRVPV DVSVVDLTC+LSK A Y EIK A+K A+   MKGIL YTE++VVS DF GD HSSIFDA AGI L D FVKL++WYDNEYGYS RV DL+ +M +K+
Sbjct:    1 MVYMFKYDSTHGRYHGEVSHEDGKLIVDGNAISVFQCMKPAEIPWGSAGAKYVVESTGVFLSVEKASLHIQGG-AQRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHANIIPASTGAAKAVGKVIPALNGKLTGMAFRVPVADVSVVDLTCRLSKAASYGEIKEAVKKAAHGPMKGILGYTEDQVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEYGYSTRVADLLLYMHSKE 294          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000052353.1 (SMESG000052353.1)

HSP 1 Score: 699.508 bits (1804), Expect = 0.000e+0
Identity = 337/337 (100.00%), Postives = 337/337 (100.00%), Query Frame = 3
Query:   72 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 1082
            MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH
Sbjct:    1 MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000033355.1 (SMESG000033355.1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 282/335 (84.18%), Postives = 306/335 (91.34%), Query Frame = 3
Query:   78 KPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 1082
            K +VGINGFGRIGRLVLRAA+EK T+DVVA+NDPFI L+YMVYMFKYDSTHGKF G VE KD KL+V+GHAISV+N++NPEEIPWD   C YVVESTGVFTTI+KAS H KNNRAKKVIISAPSADAPM+VMGVN EKYDPK+ +VSNASCTTNCLAPLAKVI DNFGI EGLMTTIHAYTATQKTVDGPS+KLWRDGRGAAQNIIPASTGAAKAVG+VI ELNGK+TGMAFRVPV DVSVVDLTCKL KPAKY EIKAAIK ASETSMK IL YTE+EVVSQDF+GD HSSIFDA AGIQL DTFVKLV+WYDNE+GYSCRV+DLI +M T+DH
Sbjct:    2 KAQVGINGFGRIGRLVLRAAIEKETIDVVAINDPFINLEYMVYMFKYDSTHGKFPGTVEAKDDKLMVNGHAISVFNERNPEEIPWDKANCEYVVESTGVFTTIDKASAHIKNNRAKKVIISAPSADAPMFVMGVNQEKYDPKMKVVSNASCTTNCLAPLAKVINDNFGIEEGLMTTIHAYTATQKTVDGPSAKLWRDGRGAAQNIIPASTGAAKAVGQVITELNGKLTGMAFRVPVADVSVVDLTCKLKKPAKYSEIKAAIKKASETSMKNILGYTEDEVVSQDFRGDQHSSIFDANAGIQLNDTFVKLVSWYDNEFGYSCRVVDLIAYMMTRDH 336          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000034925.1 (SMESG000034925.1)

HSP 1 Score: 481.485 bits (1238), Expect = 5.540e-171
Identity = 234/336 (69.64%), Postives = 271/336 (80.65%), Query Frame = 3
Query:   75 TKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 1082
            +KP+VGINGFGRIGRLVLRA L K  V  V +NDPF+++DYMVYMFKYDSTHGKF   V+   G L+V   +I+V+ +K+P +IPWD  Q  YVVES+GVFTTI  AS H      KKVIISAPSADAPM+VMGVN +KY+  +++VSNASCTTNCLAPLAK+I DNFGI E LMTT+HA TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGK+TGMAFRVP PDVSVVDLT +L KP KY  IK A+K AS+  MKGI+ YTE++VVS D  GD  SSIFDA+AGIQL+DTFVKL++WYDNE+GYS RVIDLI HM   D+
Sbjct:    3 SKPKVGINGFGRIGRLVLRAGLLKKNVTFVGVNDPFVDVDYMVYMFKYDSTHGKFKDSVKADKGNLIVGDQSIAVFMEKDPTKIPWDKVQADYVVESSGVFTTIAAASAHLP--ATKKVIISAPSADAPMFVMGVNQDKYEKTMNVVSNASCTTNCLAPLAKIIHDNFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLKKPTKYQAIKEAVKKASQGPMKGIMGYTEDQVVSTDMCGDVRSSIFDAEAGIQLSDTFVKLISWYDNEFGYSNRVIDLICHMYKVDN 336          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000023748.1 (SMESG000023748.1)

HSP 1 Score: 466.077 bits (1198), Expect = 5.588e-165
Identity = 225/335 (67.16%), Postives = 265/335 (79.10%), Query Frame = 3
Query:   78 KPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 1082
            KP+VGINGFGRIGRLVLRA L +G VD V +NDPF++++YMVYMFKYDSTHG +   V  +DG LVV    I ++ +K+P +IPW      YVVES+G FTTI+ AS H  +  AKKVIISAPSADAPM+VMGVNH+ Y+  +++VSNASCTTNCLAPLAK+I D FGI E LMTT+HA TATQKTVD PS K WR GRGA QNIIP+STGAAKAVGKVIPELNGK+TG+AFRVP PDVSVVDLT +L  PAKY++I  AI+   E SM+GI+ +T+E +VS D  GD  SSIFDA AGIQL D FVKL++WYDNE+GYS RVIDLI HM   DH
Sbjct:    4 KPKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHLPS--AKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGIAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEGSMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRIDH 336          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000012145.1 (SMESG000012145.1)

HSP 1 Score: 427.172 bits (1097), Expect = 1.761e-149
Identity = 209/340 (61.47%), Postives = 249/340 (73.24%), Query Frame = 3
Query:   66 FNMTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYDSTHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTGVFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSNASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKLSKPAKYDEIKAAIKHASETSM-KGILAYTEEEVVSQDFKGDHHSSIFDAKAGIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH 1082
             NM+ PRVGINGFGRIGRL+LRAA     ++VVA+NDPFI +DYM YM KYDSTHG+F  ++  KD  L +D H I VYN +NPEEIPW + +  Y++ES+GVFTTIEKAS+H  ++  KKVIISAPS DAPM+VMGVNH KY P +++VSNASCTTNC               E LMTT+HA TATQKTVD PS+K WR GRGA QNIIPASTGAAKAVGK+IP L GK++GMAFRVP  +VSV DLTCKL     YD I  A++ A+     +GI+   ++ +VS D  GD HS IFD  AGI L D+FVKLVAWYDNE+GYS RVIDLI HM   D+
Sbjct:   20 LNMSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNC---------------EALMTTVHATTATQKTVDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDN 344          
The following BLAST results are available for this feature:
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GAPDH0.000e+071.73glyceraldehyde-3-phosphate dehydrogenase [Source:H... [more]
GAPDH0.000e+071.73glyceraldehyde-3-phosphate dehydrogenase [Source:H... [more]
GAPDH0.000e+071.73glyceraldehyde-3-phosphate dehydrogenase [Source:H... [more]
GAPDHS7.230e-17171.08glyceraldehyde-3-phosphate dehydrogenase, spermato... [more]
GAPDH1.808e-15872.11glyceraldehyde-3-phosphate dehydrogenase [Source:H... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpd-34.715e-17471.85Glyceraldehyde-3-phosphate dehydrogenase 3 [Sourc... [more]
gpd-34.715e-17471.85Glyceraldehyde-3-phosphate dehydrogenase 3 [Sourc... [more]
gpd-25.290e-17371.55Glyceraldehyde-3-phosphate dehydrogenase 2 [Sourc... [more]
gpd-25.290e-17371.55Glyceraldehyde-3-phosphate dehydrogenase 2 [Sourc... [more]
gpd-13.472e-17271.93Glyceraldehyde-3-phosphate dehydrogenase 1 [Sourc... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gapdh19.726e-17471.08gene:FBgn0001091 transcript:FBtr0100479[more]
Gapdh19.726e-17471.08gene:FBgn0001091 transcript:FBtr0088903[more]
Gapdh21.062e-17370.78gene:FBgn0001092 transcript:FBtr0074112[more]
Gapdh21.062e-17370.78gene:FBgn0001092 transcript:FBtr0332618[more]
CG90106.782e-15061.75gene:FBgn0034173 transcript:FBtr0087067[more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gapdh0.000e+073.80glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdh0.000e+073.80glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdhs3.302e-17570.92glyceraldehyde-3-phosphate dehydrogenase, spermato... [more]
gapdhs3.302e-17570.92glyceraldehyde-3-phosphate dehydrogenase, spermato... [more]
gapdh2.033e-13276.47glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbd30.000e+073.19methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
mbd31.776e-17871.47methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
mbd36.468e-17873.31methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
mbd37.539e-17873.31methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
mbd39.652e-17873.31methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gapdh0.000e+070.93glyceraldehyde-3-phosphate dehydrogenase [Source:M... [more]
Gapdh0.000e+072.29glyceraldehyde-3-phosphate dehydrogenase [Source:M... [more]
Gapdh0.000e+072.29glyceraldehyde-3-phosphate dehydrogenase [Source:M... [more]
Gm103580.000e+071.99predicted gene 10358 [Source:MGI Symbol;Acc:MGI:37... [more]
Gm38390.000e+071.69predicted pseudogene 3839 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20287|G3P_SCHMA0.000e+073.59Glyceraldehyde-3-phosphate dehydrogenase OS=Schist... [more]
sp|P51469|G3P_XENLA0.000e+073.49Glyceraldehyde-3-phosphate dehydrogenase OS=Xenopu... [more]
sp|Q4KYY3|G3P_SPECI0.000e+073.19Glyceraldehyde-3-phosphate dehydrogenase OS=Spermo... [more]
sp|Q05025|G3P_COTJA0.000e+073.49Glyceraldehyde-3-phosphate dehydrogenase OS=Coturn... [more]
sp|P04406|G3P_HUMAN0.000e+071.73Glyceraldehyde-3-phosphate dehydrogenase OS=Homo s... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D0VYP90.000e+094.07Glyceraldehyde-3-phosphate dehydrogenase OS=Dugesi... [more]
H1ZYM30.000e+093.77Glyceraldehyde-3-phosphate dehydrogenase OS=Dugesi... [more]
A0A4S2L0170.000e+076.85Glyceraldehyde-3-phosphate dehydrogenase OS=Opisth... [more]
A0A074ZMY80.000e+076.85Glyceraldehyde-3-phosphate dehydrogenase OS=Opisth... [more]
A0A419PIU40.000e+076.26Glyceraldehyde-3-phosphate dehydrogenase OS=Clonor... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gapdh0.000e+074.10glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
ENSAMXT00000050002.13.758e-17469.58glyceraldehyde-3-phosphate dehydrogenase-like [Sou... [more]
gapdhs3.908e-17470.62glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
gapdhs3.908e-17470.62glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
gapdhs3.908e-17470.62glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gapdh1.570e-17275.00glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdh4.500e-14376.40glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TDH38.300e-15764.74Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), ... [more]
TDH29.158e-15764.44Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), ... [more]
TDH12.093e-15463.83Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), ... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO408420.000e+073.94Glyceraldehyde-3-phosphate dehydrogenase [Source:... [more]
EDO294122.054e-6944.24Glyceraldehyde-3-phosphate dehydrogenase [Source:... [more]
EDO259192.327e-5239.41Glyceraldehyde-3-phosphate dehydrogenase [Source:... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gapdh0.000e+073.49glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdh0.000e+073.49glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdhs4.695e-17771.81glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
gapdhs1.247e-15471.86glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052353.10.000e+0100.00SMESG000052353.1[more]
SMESG000033355.10.000e+084.18SMESG000033355.1[more]
SMESG000034925.15.540e-17169.64SMESG000034925.1[more]
SMESG000023748.15.588e-16567.16SMESG000023748.1[more]
SMESG000012145.11.761e-14961.47SMESG000012145.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013107 ID=SMED30013107|Name=Glyceraldehyde-3-phosphate dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1188bp
AAAAGTCTAGGTAATCACGTACAACTTTATTAATTTTTGTAGTTATTTTA
TTCTCTAGATTATTATTCAATATGACCAAACCAAGAGTTGGAATCAATGG
CTTCGGAAGAATTGGACGATTGGTGTTGCGCGCTGCACTGGAGAAAGGCA
CAGTTGACGTTGTTGCTCTAAACGATCCATTTATTGAACTTGACTATATG
GTCTATATGTTCAAATACGATTCTACTCACGGTAAATTTCATGGACATGT
TGAAACCAAGGACGGCAAACTAGTAGTAGATGGCCATGCTATTTCGGTTT
ATAATAAAAAGAATCCAGAAGAGATTCCATGGGATCACGATCAATGCTAC
TATGTAGTCGAATCAACTGGTGTGTTTACAACTATTGAAAAAGCATCAAT
GCATACCAAAAACAACCGAGCAAAGAAAGTTATTATTTCAGCTCCATCTG
CTGATGCACCAATGTATGTAATGGGTGTTAACCATGAAAAATACGATCCG
AAAATTTCAATCGTATCTAACGCTAGCTGCACAACCAACTGTCTAGCTCC
ATTGGCGAAAGTTATTGTTGACAATTTCGGTATTGTAGAAGGATTGATGA
CAACCATTCATGCTTATACTGCAACCCAAAAAACCGTGGATGGTCCATCA
TCAAAATTGTGGAGAGATGGTCGAGGAGCAGCGCAAAACATTATTCCGGC
TTCAACTGGTGCAGCAAAAGCAGTAGGAAAGGTTATCCCAGAATTGAATG
GAAAAATCACTGGAATGGCCTTTAGAGTTCCAGTGCCTGACGTTTCAGTT
GTTGACTTGACATGTAAGCTAAGCAAACCGGCTAAATATGATGAAATCAA
GGCCGCTATTAAGCATGCTTCTGAAACCTCAATGAAAGGAATTTTGGCCT
ATACTGAAGAAGAAGTAGTAAGTCAAGATTTCAAGGGTGATCACCATTCA
TCCATTTTTGACGCAAAAGCTGGTATTCAATTGACCGATACGTTTGTCAA
ATTAGTTGCATGGTACGACAATGAATATGGTTACAGTTGCCGTGTAATCG
ATCTGATTCAGCATATGTCAACTAAAGATCATTAAACTCTTCGAAAGCTT
TAGTTTGGGATAGTTTAGATATTTTGGACCTGACTTTAATATGTTATAAA
TTTAATGTGGTTTAGTTAAATAAATTTCTTTGTCTCCT
back to top

protein sequence of SMED30013107-orf-1

>SMED30013107-orf-1 ID=SMED30013107-orf-1|Name=SMED30013107-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=338bp
MTKPRVGINGFGRIGRLVLRAALEKGTVDVVALNDPFIELDYMVYMFKYD
STHGKFHGHVETKDGKLVVDGHAISVYNKKNPEEIPWDHDQCYYVVESTG
VFTTIEKASMHTKNNRAKKVIISAPSADAPMYVMGVNHEKYDPKISIVSN
ASCTTNCLAPLAKVIVDNFGIVEGLMTTIHAYTATQKTVDGPSSKLWRDG
RGAAQNIIPASTGAAKAVGKVIPELNGKITGMAFRVPVPDVSVVDLTCKL
SKPAKYDEIKAAIKHASETSMKGILAYTEEEVVSQDFKGDHHSSIFDAKA
GIQLTDTFVKLVAWYDNEYGYSCRVIDLIQHMSTKDH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0016620oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0004365glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0016491oxidoreductase activity
GO:0050661NADP binding
GO:0051287NAD binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0000418head
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0003116parenchymal cell
PLANA:0007547anterior pole progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR006424Glyceraldehyde-3-P_DH_1
IPR036291NAD(P)-bd_dom_sf
IPR020831GlycerAld/Erythrose_P_DH
IPR020828GlycerAld_3-P_DH_NAD(P)-bd
IPR020829GlycerAld_3-P_DH_cat
IPR016040NAD(P)-bd_dom
IPR020830GlycerAld_3-P_DH_AS
IPR023627Rcmb_RecR
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006006glucose metabolic process
GO:0006096glycolytic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020831Glyceraldehyde/Erythrose phosphate dehydrogenase familyPRINTSPR00078G3PDHDRGNASEcoord: 112..125
score: 56.0
coord: 174..190
score: 77.18
coord: 147..165
score: 87.04
coord: 231..248
score: 74.32
coord: 271..286
score: 61.14
IPR020831Glyceraldehyde/Erythrose phosphate dehydrogenase familyPIRSFPIRSF000149GAPDHcoord: 2..337
e-value: 8.4E-125
score: 414.1
IPR020831Glyceraldehyde/Erythrose phosphate dehydrogenase familyPANTHERPTHR10836GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASEcoord: 5..337
IPR020828Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domainSMARTSM00846gp_dh_n_7coord: 4..153
e-value: 4.4E-84
score: 295.3
IPR020828Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domainPFAMPF00044Gp_dh_Ncoord: 5..104
e-value: 8.5E-37
score: 125.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 5..329
e-value: 4.0E-156
score: 520.9
NoneNo IPR availableGENE3DG3DSA:3.30.360.10coord: 152..315
e-value: 4.0E-156
score: 520.9
NoneNo IPR availablePANTHERPTHR10836:SF79GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE, TESTIS-SPECIFICcoord: 5..337
NoneNo IPR availableSUPERFAMILYSSF55347Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domaincoord: 152..315
IPR006424Glyceraldehyde-3-phosphate dehydrogenase, type ITIGRFAMTIGR01534TIGR01534coord: 5..327
e-value: 3.3E-131
score: 435.3
IPR020829Glyceraldehyde 3-phosphate dehydrogenase, catalytic domainPFAMPF02800Gp_dh_Ccoord: 158..315
e-value: 8.5E-71
score: 236.7
IPR020830Glyceraldehyde 3-phosphate dehydrogenase, active sitePROSITEPS00071GAPDHcoord: 151..158
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 5..174