DDE_Tnp_1_7 domain-containing protein

Overview
NameDDE_Tnp_1_7 domain-containing protein
Smed IDSMED30013095
Length (bp)2095
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DDE_Tnp_1_7 domain-containing protein (SMED30013095) t-SNE clustered cells

Violin plots show distribution of expression levels for DDE_Tnp_1_7 domain-containing protein (SMED30013095) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DDE_Tnp_1_7 domain-containing protein (SMED30013095) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DDE_Tnp_1_7 domain-containing protein (SMED30013095) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013095

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013095SMESG000080622.1 SMESG000068757.1 SMESG000055125.1 SMESG000038294.1 SMESG000032747.1 SMESG000023322.1 dd_Smed_v4_3830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30013095SMESG000080622.1 SMESG000068757.1 SMESG000055125.1 SMESG000038294.1 SMESG000032747.1 SMESG000023322.1 dd_Smed_v4_3830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013095SMESG000080622.1 SMESG000068757.1 SMESG000055125.1 SMESG000038294.1 SMESG000032747.1 SMESG000023322.1 dd_Smed_v4_3830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013095SMESG000080622.1 SMESG000068757.1 SMESG000055125.1 SMESG000038294.1 SMESG000032747.1 SMESG000023322.1 dd_Smed_v4_3830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013095SMESG000080622.1 SMESG000068757.1 SMESG000055125.1 SMESG000038294.1 SMESG000032747.1 SMESG000023322.1 dd_Smed_v4_3830_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013095SMESG000080622.1 SMESG000038294.1 SMESG000032747.1 SMESG000038602.1 Contig18287newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013095SMESG000080622.1 SMESG000038294.1 SMESG000032747.1 SMESG000038602.1 Contig18287uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013095SMESG000080622.1 SMESG000068757.1 SMESG000038294.1 SMESG000032747.1 SMESG000025690.1 SMESG000025689.1 SMESG000023322.1 Contig18510newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30013095SMESG000080622.1 SMESG000068757.1 SMESG000038294.1 SMESG000032747.1 SMESG000025690.1 SMESG000025689.1 SMESG000023322.1 Contig18510uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30013095SMESG000080622.1 SMESG000068757.1 SMESG000055125.1 SMESG000038294.1 SMESG000032747.1 SMESG000023322.1 dd_Smed_v4_3830_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01072083.2 (dual specificity phosphatase 26 [Source:NCBI gene;Acc:570815])

HSP 1 Score: 89.7373 bits (221), Expect = 3.456e-18
Identity = 48/119 (40.34%), Postives = 68/119 (57.14%), Query Frame = 2
Query: 1739 ETILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTI 2095
            E ++  +N EG ++Y   +  L   +L AF GILIL GVYR+  ES+D LW    GR IFR TM+L  FK   R++ F   D   G+   DKLA +  + D +VE     Y PG+++T+
Sbjct:  139 EMLMQISNLEGKRVYGAAWKDLDWTDLQAFIGILILIGVYRSKHESVDSLWDGVLGRPIFRATMALYTFKSWSRVICFRKRDPEPGQKSGDKLAPILNVWDKWVERLPLMYNPGQNLTV 257          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Xenopus
Match: npffr2 (neuropeptide FF receptor 2 [Source:Xenbase;Acc:XB-GENE-994428])

HSP 1 Score: 56.9954 bits (136), Expect = 5.644e-8
Identity = 32/91 (35.16%), Postives = 48/91 (52.75%), Query Frame = 2
Query: 1823 AFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTI 2095
            AF  IL ++ +    G  +D  WS      + + TM  +RF  I + LRFD+ DTR  R+  DK AA+  +   F +N  + + PGE +TI
Sbjct:    2 AFISILFVKAIMCPVGAIVD-CWSENFLVPVIKETMPRDRFISIMQHLRFDDKDTRAERVKTDKFAAISDIRTRFNKNCAESFTPGEHMTI 91          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. TrEMBL
Match: A0A267DYR7 (DDE_Tnp_1_7 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004292g1 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 2.808e-29
Identity = 75/175 (42.86%), Postives = 104/175 (59.43%), Query Frame = 2
Query: 1571 SANILRPSPGIIRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTI 2095
            + NILR  PGI ++AT R+ +      F LLF                       ++TI++ETNRE +++    +   +  E+  + G+  LRGV++   ESI+ELWSA+ GR IF  TMSL+RFK + R LRFDN +TR  RL RDKLAAVRLL+D  V NSQ+ Y+P  +VT+
Sbjct:  102 AGNILRLRPGITQFATARLHDEE--SAFKLLFDA-------------------DMVDTIVVETNREATRVLGQAWLPTTRVEMYGYIGLCFLRGVFKGNMESIEELWSADCGRKIFAETMSLSRFKSLLRFLRFDNRETRAARLQRDKLAAVRLLLDGLVSNSQRSYVPSGAVTV 255          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. TrEMBL
Match: A0A146PBZ2 (PiggyBac transposable element-derived protein 3 OS=Fundulus heteroclitus OX=8078 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 6.930e-26
Identity = 70/177 (39.55%), Postives = 102/177 (57.63%), Query Frame = 2
Query: 1568 NSANILRPSPGIIRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIE-TNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTI 2095
            +SAN+++ +PG  R+A  RI E  +   F L                     +   +E I++E TN EG +++  ++  L   +LNA+ G+L+L GVYR+ GE+   LW+ E+GR IFR TMSL  F +I R++RFDN DTR GR  RDKLAA+R + D +VE     Y PG  V++
Sbjct:  102 SSANVIKMTPGPTRFAITRIDE--IHSAFQLF--------------------ISPPIERIILEMTNLEGRRVFQEKWKPLDRTDLNAYIGVLLLAGVYRSKGEATASLWNEENGRPIFRATMSLETFHMISRVIRFDNRDTRAGRRERDKLAAIRDVWDKWVETLPLLYNPGPYVSV 256          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. TrEMBL
Match: A0A3B3INT3 (DDE_Tnp_1_7 domain-containing protein OS=Oryzias latipes OX=8090 GN=LOC101160710 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 6.190e-25
Identity = 69/177 (38.98%), Postives = 102/177 (57.63%), Query Frame = 2
Query: 1568 NSANILRPSPGIIRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIE-TNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTI 2095
            +S+NI++ +PG  R+A  R+  + +   F L                     +   +E I+++ TN EG +++  ++ +L   +LNA+ GILIL GVYR+ GE+   LW+ E+GR IFR TMSL  F +I R++RFDN DTR GR   DKLAA+R + D +VE     Y PG  VT+
Sbjct:   99 SSSNIIKMTPGPTRFAVTRV--DDIQSAFQLF--------------------ISQPIERIILDMTNLEGRRVFQEKWKSLDQTDLNAYIGILILAGVYRSKGEATSSLWNEENGRPIFRATMSLETFHMISRVIRFDNRDTRVGRRESDKLAAIRDVWDKWVEILPLLYNPGPHVTV 253          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. TrEMBL
Match: A0A3P9QE71 (DDE_Tnp_1_7 domain-containing protein OS=Poecilia reticulata OX=8081 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 3.453e-24
Identity = 68/187 (36.36%), Postives = 105/187 (56.15%), Query Frame = 2
Query: 1550 HTRK*DNSANILRPSPGIIRWATQRIGENSVLDCFNLLFIKCKSIYY----VH*IKVIIFF*LLATMETILIE-TNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTI 2095
             T+K  ++   L    G I+W+T      + L   N++ +      +    V  I+      +   ME I+++ TN EG +++  ++  L  ++L+A+ GIL+L GVYR+ GE+   LW+ E+GR IFR TMSL  F +I R++RFDN DTR GR  +DKLAA+R + D +V      Y PG  VT+
Sbjct:   67 ETQKSPSTEGTLTSKDGQIKWSTSPHQSRARLSSSNVIKMTPGPTSFALSRVDDIESAFQLFISPPMEKIILDMTNLEGRRVFQEKWKPLDPSDLHAYIGILVLAGVYRSKGEATASLWNEEYGRPIFRATMSLETFHMISRVIRFDNRDTRAGRREKDKLAAIRDVWDKWVNILPLLYNPGPHVTV 253          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. TrEMBL
Match: A0A0V0ZP09 (PiggyBac transposable element-derived protein 4 OS=Trichinella patagoniensis OX=990121 GN=PGBD4 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 4.203e-24
Identity = 55/122 (45.08%), Postives = 80/122 (65.57%), Query Frame = 2
Query: 1733 TMETILIE-TNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTI 2095
            T E +++E TN +G       +  L + +L A+ G+LIL GVYR+ GE+   LW+AE+GR IF   MSL +F LI R++RFD+  +R  R  +DKLAAVR++ D +V+N  K Y P E+VT+
Sbjct:   27 TSENVILEMTNLKGRSCCPETWKPLDVTDLRAYIGLLILTGVYRSRGEATKSLWNAENGRAIFPAVMSLKQFHLISRMIRFDDHSSRASRRSKDKLAAVRVIWDTWVKNLPKMYNPSENVTV 148          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Cavefish
Match: nsd3 (nuclear receptor binding SET domain protein 3 [Source:ZFIN;Acc:ZDB-GENE-050324-2])

HSP 1 Score: 84.7297 bits (208), Expect = 1.184e-16
Identity = 47/120 (39.17%), Postives = 71/120 (59.17%), Query Frame = 2
Query: 1736 METILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTI 2095
            ++ IL  TN  G +  +  ++ +   E+ A+ G+LIL GVYR+ GES   LW  ++GR +FR TMS  RF+LI   LRFD+  TR  R   DKL+A   + D +V+     + PGE++ +
Sbjct:  338 IQLILQMTNLHGRRSVSG-WSDVDETEIRAYMGLLILAGVYRSKGESTRSLWDDQNGRPVFRATMSHKRFQLISASLRFDDRLTRPCRHKEDKLSAFCNMWDKWVQRLPLLFNPGENICV 456          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000039501.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:21564630:21575712:1 gene:ENSAMXG00000031759.1 transcript:ENSAMXT00000039501.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.7962 bits (190), Expect = 2.218e-14
Identity = 38/98 (38.78%), Postives = 57/98 (58.16%), Query Frame = 2
Query: 1802 LSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTI 2095
            L+  EL AF  +  +RG+       +D+ WS++ G  IF  T++  RF+ I R LRFD+ +TR  R   DK A +  L   FV+NS   Y+PGE++T+
Sbjct:  600 LTAAELKAFVALTYMRGITGGKTMKLDDYWSSDLGNPIFLKTLTRQRFRDIMRHLRFDDKNTRAARHETDKFAMISELFYKFVQNSIASYVPGENITV 697          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000037833.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:101160710])

HSP 1 Score: 121.324 bits (303), Expect = 2.330e-28
Identity = 69/177 (38.98%), Postives = 102/177 (57.63%), Query Frame = 2
Query: 1568 NSANILRPSPGIIRWATQRIGENSVLDCFNLLFIKCKSIYYVH*IKVIIFF*LLATMETILIE-TNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTI 2095
            +S+NI++ +PG  R+A  R+  + +   F L                     +   +E I+++ TN EG +++  ++ +L   +LNA+ GILIL GVYR+ GE+   LW+ E+GR IFR TMSL  F +I R++RFDN DTR GR   DKLAA+R + D +VE     Y PG  VT+
Sbjct:   99 SSSNIIKMTPGPTRFAVTRV--DDIQSAFQLF--------------------ISQPIERIILDMTNLEGRRVFQEKWKSLDQTDLNAYIGILILAGVYRSKGEATSSLWNEENGRPIFRATMSLETFHMISRVIRFDNRDTRVGRRESDKLAAIRDVWDKWVEILPLLYNPGPHVTV 253          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000029842.1 (piggyBac transposable element-derived protein 4 [Source:NCBI gene;Acc:101157644])

HSP 1 Score: 82.0333 bits (201), Expect = 1.181e-15
Identity = 49/119 (41.18%), Postives = 66/119 (55.46%), Query Frame = 2
Query: 1745 ILIETNREGSKLYNNQFTALSLNE--LNAFFGILILRGVYRAAGESIDELWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTI 2095
            ILI TNR  +   +   T   ++E  L A+ G+LIL GVYR+ GE++  LW  E GR IF  TMSL  F      LRFD+  TR  R   D+LAAVR + + + +   + Y  G  VT+
Sbjct:  386 ILIATNRHSADKAHALKTPKPMDEIELRAYVGLLILAGVYRSRGEALVSLWEPECGRPIFGATMSLRSFYQRSATLRFDDRSTRASRSASDRLAAVREVWEEWCDRLPRLYDIGPEVTV 504          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027888.1 (pep primary_assembly:ASM223467v1:17:9217998:9219211:-1 gene:ENSORLG00000025878.1 transcript:ENSORLT00000027888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 2.854e-8
Identity = 30/56 (53.57%), Postives = 36/56 (64.29%), Query Frame = 2
Query: 1928 MSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLLIDNFVENSQKCYMPGESVTI 2095
            MSL  F +I R++RFDN DTR GR   DKLAA+R L D +VE     Y PG  VT+
Sbjct:    1 MSLETFHMISRVIRFDNRDTRVGRRESDKLAAIRDLWDKWVEILPLLYNPGPHVTV 56          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000025524.1 (SMESG000025524.1)

HSP 1 Score: 441.039 bits (1133), Expect = 1.862e-164
Identity = 227/273 (83.15%), Postives = 244/273 (89.38%), Query Frame = 3
Query:  270 NRKPDEINTNTRIKPANDKSVKSSYEPGKDIKTGRQKNLLDMMKQVTRATNSQETKSRYYSNQAKQKREYNEIHDARMNYRXXXXXXXXXXXXXXPKWTRNKNTTEILKGVTKMITNYTKGSKSIAEISILMKRMPILFTIIDMAGNSLRHHAIESENEERTMEIIEAMNQCGQHRNIRNEKGQTPMMTAVSRDASTKILRKLLKTGSTLNEKDNKGKTMLNYIMMSREASAIEFVTINAIQEDIEIVGKNLNPIIGAIERGYGEAAAKLINW 1088
            N KPDEINTNTRIKPAND SVKSSYEPGKD+ TGRQKNLLDM KQ+  A NSQETKS+YY+NQAKQ+REYNEI++ RMNYRK M+ IIKITKEIMPKWT NKN TEIL+GVTKMITNY KGSKS AEISIL  RMP LFT+ID+AGN L HHAIESENEERTMEIIE MNQCGQH NIRNEKGQTPMM AVSRD  TKILR+LLKTGSTLNEKDNKGKTMLNYIMMSREA AI+FVTINAIQ+DIEI+G+NLNPI+ AIERGY EAA KLI W
Sbjct:  331 NWKPDEINTNTRIKPANDTSVKSSYEPGKDMTTGRQKNLLDMTKQINGAANSQETKSKYYNNQAKQEREYNEIYNDRMNYRKQMEAIIKITKEIMPKWTGNKNITEILEGVTKMITNYAKGSKSTAEISILRNRMPTLFTMIDIAGNKLPHHAIESENEERTMEIIEIMNQCGQHTNIRNEKGQTPMMIAVSRDTPTKILRELLKTGSTLNEKDNKGKTMLNYIMMSREARAIDFVTINAIQDDIEIIGQNLNPILEAIERGYEEAAEKLIKW 603          

HSP 2 Score: 159.073 bits (401), Expect = 1.862e-164
Identity = 98/162 (60.49%), Postives = 121/162 (74.69%), Query Frame = 1
Query: 1093 KKSDNEIINVNKFESNENILLQRAINSEYALPKTMKALLKRREIKFTDNNREPERIGCRKKELETLVGE*HRIQRKSSGRKQEMDDIRNGREMMIKMYLDIIKEISVEDKRIEKARCXXXXXXXXXXXXXXXXXXXXXXXXXXXSNKKQNSVAYKEIRQLSK 1578
            +KSDNEII+VNKFESNENIL++RA+ SEYALPKT+KAL             EPERI  RK+EL+TLVGE HRIQ K SG+K+E+DDIRNGR+M+IKMY DIIKEI+ ED RIEKARC        ++++D+K++D+ E      + KKQ SVAYKEI Q SK
Sbjct:  606 RKSDNEIIDVNKFESNENILVKRAMKSEYALPKTIKAL-------------EPERIVSRKEELDTLVGEWHRIQGKPSGKKREIDDIRNGRKMLIKMYKDIIKEINAEDNRIEKARC--------NKNQDKKEDDNEEGENRDRNKKKQISVAYKEIGQQSK 746          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000009321.1 (SMESG000009321.1)

HSP 1 Score: 332.028 bits (850), Expect = 1.794e-111
Identity = 182/231 (78.79%), Postives = 197/231 (85.28%), Query Frame = 3
Query:  417 TNSQETKSRY-------YSNQAKQKREYNEIHDARMNYRXXXXXXXXXXXXXXPKWTRNKNTTEILKGVTKMITNYTKGSKSIAEISILMKRMPILFTIIDMAGNSLRHHAIESENEERTMEIIEAMNQCGQHRNIRNEKGQTPMMTAVSRDASTKILRKLLKTGSTLNEKDNKGKTMLNYIMMSREASAIEFVTINAIQEDIEIVGKNLNPIIGAIERGYGEAAAKLINW 1088
            T  Q+TK  Y        +NQAKQ+REYNEI++ RMNYRK M+ IIKITKEIMPKWTRNKN TEIL+GVTKMI +Y KGSKS AEISIL K MPILFTIID+AGN+  HHAIESENEERTMEIIEAMNQ GQH NIRNEKGQTPM  AVSRDASTK LR+LLKTGSTLNEKDNKGKTMLNYIMMSREASAIEFVTINAIQEDIEI+G+NL  I+G I RGY +AAAKLI W
Sbjct:  251 TKPQQTKKVYGQSIRKLTNNQAKQEREYNEIYNDRMNYRKQMEAIIKITKEIMPKWTRNKNITEILEGVTKMIKSYAKGSKSTAEISILKKIMPILFTIIDIAGNTPLHHAIESENEERTMEIIEAMNQGGQHTNIRNEKGQTPMNIAVSRDASTKTLRELLKTGSTLNEKDNKGKTMLNYIMMSREASAIEFVTINAIQEDIEIIGQNLKTILGEIGRGYDKAAAKLIKW 481          

HSP 2 Score: 91.6633 bits (226), Expect = 1.794e-111
Identity = 44/55 (80.00%), Postives = 51/55 (92.73%), Query Frame = 1
Query: 1093 KKSDNEIINVNKFESNENILLQRAINSEYALPKTMKALLKRREIKFTDNNREPER 1257
            +KSDN+II+VNKFESNENILL+RAINSEYALP+T+KAL+KR EIKF DN REP R
Sbjct:  484 RKSDNKIIDVNKFESNENILLKRAINSEYALPRTIKALIKRGEIKFMDNKREPRR 538          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000069970.1 (SMESG000069970.1)

HSP 1 Score: 330.487 bits (846), Expect = 4.827e-107
Identity = 176/225 (78.22%), Postives = 183/225 (81.33%), Query Frame = 3
Query:  201 MTRNCPNKQTQNPSGTVRLMRESNRKPDEINTNTRIKPANDKSVKSSYEPGKDIKTGRQKNLLDMMKQVTRATNSQETKSRYYSNQAKQKREYNEIHDARMNYRXXXXXXXXXXXXXXPKWTRNKNTTEILKGVTKMITNYTKGSKSIAEISILMKRMPILFTIIDMAGNSLRHHAIESENEERTMEIIEAMNQCGQHRNIRNEKGQTPMMTAVSRDASTKILRK 875
            MTRNC +KQTQNPSGTV LMR SNRK +EI TNTRIKPAND SVKSSYEPGKD+ TGRQKNLLD  KQVTR  NSQETKSRYY NQ K KRE+NEIHD               TKEIMPKWTRNKNTTEIL GVTKMITNY KGSKS AEISIL KRMPILFTIID+AGN+  HHAIESENEERTMEIIE MNQC QH NIRNE GQTPMM  VSRD STKILR+
Sbjct:    1 MTRNCRHKQTQNPSGTVGLMRGSNRKSNEIKTNTRIKPANDTSVKSSYEPGKDMTTGRQKNLLDTTKQVTRVVNSQETKSRYYRNQVKLKREHNEIHDI--------------TKEIMPKWTRNKNTTEILGGVTKMITNYAKGSKSTAEISILKKRMPILFTIIDIAGNTPLHHAIESENEERTMEIIEVMNQCRQHTNIRNETGQTPMMIEVSRDMSTKILRE 211          

HSP 2 Score: 116.701 bits (291), Expect = 5.281e-28
Identity = 79/112 (70.54%), Postives = 87/112 (77.68%), Query Frame = 1
Query: 1243 REPERIGCRKKELETLVGE*HRIQRKSSGRKQEMDDIRNGREMMIKMYLDIIKEISVEDKRIEKARCXXXXXXXXXXXXXXXXXXXXXXXXXXXSNKKQNSVAYKEIRQLSK 1578
            REPERI  RK+ELETLVGE HRIQ K SG+KQE+DDIRNGR+M+IKMY DIIKEI+ ED RIEKARC              KKE+DNE+GENRDSNKKQ SVAYKEI Q SK
Sbjct:  210 REPERIVSRKEELETLVGEWHRIQGKPSGKKQEIDDIRNGRKMLIKMYEDIIKEINAEDNRIEKARC---------NKNQDKKEEDNEEGENRDSNKKQISVAYKEIGQQSK 312          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000028578.1 (SMESG000028578.1)

HSP 1 Score: 248.825 bits (634), Expect = 3.853e-106
Identity = 152/289 (52.60%), Postives = 183/289 (63.32%), Query Frame = 3
Query:  222 KQTQNPSGTVRLMRESNRKPDEINTNTRIKPANDKSVKSSYEPGKDIKTGRQKNLLDMMKQVTRATNSQETKSRYYSNQAKQKREYNEIHDARMNYRXXXXXXXXXXXXXXPKWTRNKNTTEILKGVTKMITNYTKGSKSIAEISILMKRMPILFTIIDMAGNSLRHHAIESENEERTMEIIEAMNQCGQHRNIRNEKGQTPMMTAVSRDASTKILRKLLKTGSTLNEKDNKGKTMLNYIMMSREASAIEFVTINAIQEDIEIVGKNLNPIIGAIERGYGEAAAKLINW 1088
            K+TQNPSGTV LMR SNRKP+EINTNTRIKPAND SVKSSYEPGKD+ TGRQKNLLDM KQ+  A NSQETKS+YYSNQAKQ+REYNEI++ RMNYRK M+ IIKITKEIMPKWTRNKN  EIL+G       +T        I     + P++  +                + + + +I+  + + G   N ++ KG+T                                  MLNYIMMS E  AI+FVTIN IQ+ I+I+G+NLNPI+ AIERGY EAAAKLI W
Sbjct:  129 KKTQNPSGTVGLMRGSNRKPNEINTNTRIKPANDTSVKSSYEPGKDMTTGRQKNLLDMKKQINGAANSQETKSKYYSNQAKQEREYNEIYNDRMNYRKQMEAIIKITKEIMPKWTRNKNIAEILEGAMNQCGQHTN-------IRNEKGQTPMMIAV----------------SRDASTKILRELLKTGSTLNEKDNKGKT----------------------------------MLNYIMMSLETRAIDFVTINGIQDYIQIIGQNLNPILEAIERGYDEAAAKLIKW 360          

HSP 2 Score: 157.147 bits (396), Expect = 3.853e-106
Identity = 96/162 (59.26%), Postives = 119/162 (73.46%), Query Frame = 1
Query: 1093 KKSDNEIINVNKFESNENILLQRAINSEYALPKTMKALLKRREIKFTDNNREPERIGCRKKELETLVGE*HRIQRKSSGRKQEMDDIRNGREMMIKMYLDIIKEISVEDKRIEKARCXXXXXXXXXXXXXXXXXXXXXXXXXXXSNKKQNSVAYKEIRQLSK 1578
            +KSDNEII+VNKFESNEN+L++RA+ S+YALPKT+KAL             EPERI  RK+ELETLV E HRIQ K SG+KQE+DDIRNGR+M+IKMY DIIKEI+ ED RIEKARC        ++++D K++++ E      + KKQ SVAYKEI Q SK
Sbjct:  363 RKSDNEIIDVNKFESNENVLVKRAMKSKYALPKTIKAL-------------EPERIVSRKEELETLVVEWHRIQGKPSGKKQEIDDIRNGRKMLIKMYEDIIKEINAEDNRIEKARC--------NKNQDNKEDENEEGENRDRNKKKQISVAYKEIGQQSK 503          
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Planmine SMEST
Match: SMESG000071655.1 (SMESG000071655.1)

HSP 1 Score: 248.825 bits (634), Expect = 2.888e-104
Identity = 118/139 (84.89%), Postives = 130/139 (93.53%), Query Frame = 3
Query:  672 MPILFTIIDMAGNSLRHHAIESENEERTMEIIEAMNQCGQHRNIRNEKGQTPMMTAVSRDASTKILRKLLKTGSTLNEKDNKGKTMLNYIMMSREASAIEFVTINAIQEDIEIVGKNLNPIIGAIERGYGEAAAKLINW 1088
            MPILFTI D+A N+  HHAIES+N+E+TMEIIEA+NQCGQH NIRNEKGQTPMM AVSRDASTKILR+LLKTG+TLNEKDNKGKTMLNYIMMSREASAIEF+TINAIQEDIEI+G+NLNPI+ AIERGY EAAAKLI W
Sbjct:    1 MPILFTITDIADNTPLHHAIESKNKEQTMEIIEAINQCGQHTNIRNEKGQTPMMIAVSRDASTKILRELLKTGTTLNEKDNKGKTMLNYIMMSREASAIEFITINAIQEDIEIIGQNLNPILEAIERGYNEAAAKLIKW 139          

HSP 2 Score: 150.984 bits (380), Expect = 2.888e-104
Identity = 107/169 (63.31%), Postives = 122/169 (72.19%), Query Frame = 1
Query: 1093 KKSDNEIINVNKFESNENILLQRAINSEYALPKTMKALLKRREIKFTDNNREPERIGCRKKELETLVGE*HRIQRKSSGRKQEMDDIRNGREMMIKMYLDIIKEISVEDKRIEKARCXXXXXXXXXXXXXXXXXXXXXXXXXXXSNKKQNSVAYKEIRQLSKHSPPISW 1599
            +KSDN+II+VNKFESNENILL+RAINSE                       EPERI  RK+ELETLVGE HRIQRKSSGRKQE+D+IRNGR+M+IKMY +IIKEI+VED +IE  RC          +KDRKKEDDNE+GENRDSNKKQNSVAYKEIRQ      P+ W
Sbjct:  142 RKSDNKIIDVNKFESNENILLKRAINSE-----------------------EPERIESRKEELETLVGEWHRIQRKSSGRKQEIDEIRNGRKMIIKMYEEIIKEINVEDNKIENDRC----------NKDRKKEDDNEEGENRDSNKKQNSVAYKEIRQPPALIAPLKW 277          
The following BLAST results are available for this feature:
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABZ01072083.23.456e-1840.34dual specificity phosphatase 26 [Source:NCBI gene;... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
npffr25.644e-835.16neuropeptide FF receptor 2 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DYR72.808e-2942.86DDE_Tnp_1_7 domain-containing protein OS=Macrostom... [more]
A0A146PBZ26.930e-2639.55PiggyBac transposable element-derived protein 3 OS... [more]
A0A3B3INT36.190e-2538.98DDE_Tnp_1_7 domain-containing protein OS=Oryzias l... [more]
A0A3P9QE713.453e-2436.36DDE_Tnp_1_7 domain-containing protein OS=Poecilia ... [more]
A0A0V0ZP094.203e-2445.08PiggyBac transposable element-derived protein 4 OS... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nsd31.184e-1639.17nuclear receptor binding SET domain protein 3 [Sou... [more]
ENSAMXT00000039501.12.218e-1438.78pep primary_assembly:Astyanax_mexicanus-2.0:19:215... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000037833.12.330e-2838.98piggyBac transposable element-derived protein 4-li... [more]
ENSORLT00000029842.11.181e-1541.18piggyBac transposable element-derived protein 4 [S... [more]
ENSORLT00000027888.12.854e-853.57pep primary_assembly:ASM223467v1:17:9217998:921921... [more]
back to top
BLAST of DDE_Tnp_1_7 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025524.11.862e-16483.15SMESG000025524.1[more]
SMESG000009321.11.794e-11178.79SMESG000009321.1[more]
SMESG000069970.14.827e-10778.22SMESG000069970.1[more]
SMESG000028578.13.853e-10652.60SMESG000028578.1[more]
SMESG000071655.12.888e-10484.89SMESG000071655.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013095 ID=SMED30013095|Name=DDE_Tnp_1_7 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2095bp
AATGTGGAAAGGAAAAATTACAATGCATGACTACAAAACCACAACGATCG
AAGAAATTACATGGACAATCGATACAAAAGCTAACAAAAGAACGACTACT
ATCGACATCAAATAAGCCAACTATTCGGGAAGAGAGGACACGTAAATAGA
TTTTGTAACAAAAGACGCGGAAAATCTTTTAACTGTCTAAAATGGGACAT
ATGACTCGGAATTGTCCAAATAAACAGACTCAGAACCCATCCGGAACAGT
AAGACTAATGAGAGAAAGCAATAGGAAACCAGATGAGATCAATACTAACA
CCAGAATAAAGCCAGCAAACGATAAAAGTGTCAAATCAAGCTACGAACCA
GGAAAAGACATTAAAACTGGAAGGCAGAAAAACCTATTAGACATGATGAA
ACAAGTTACTAGAGCAACAAACAGCCAAGAGACAAAATCAAGATATTATA
GTAATCAGGCGAAACAGAAACGAGAATATAACGAAATCCACGATGCTAGA
ATGAATTACCGGAAATAGATGAAAGAAATCATTAAAATAACTAAGGAAAT
AATGCCGAAATGGACCAGAAACAAGAATACCACAGAAATATTAAAAGGAG
TAACAAAGATGATCACGAACTACACAAAAGGCTCAAAATCAATAGCAGAA
ATCAGCATCTTAATGAAAAGAATGCCAATATTATTCACAATAATTGACAT
GGCGGGTAATTCACTACGACACCATGCCATAGAAAGCGAAAACGAAGAAC
GAACGATGGAAATTATCGAGGCAATGAACCAATGTGGACAACATAGAAAT
ATCAGAAATGAGAAAGGACAAACACCCATGATGACTGCAGTGTCAAGAGA
TGCGTCAACGAAAATTCTGAGGAAATTATTAAAAACAGGATCAACTCTAA
ACGAGAAGGACAATAAAGGAAAAACGATGTTAAATTATATTATGATGTCG
CGAGAAGCAAGTGCAATAGAGTTCGTTACGATAAATGCAATTCAAGAAGA
CATCGAAATAGTAGGCAAAAATTTAAATCCAATCATTGGAGCAATCGAGA
GAGGATACGGTGAAGCAGCAGCAAAACTGATCAATTGGAGAAAAAAAATC
CGATAATGAAATCATAAACGTAAACAAATTCGAAAGCAATGAAAATATAT
TACTACAAAGAGCAATAAATTCCGAGTATGCATTACCAAAGACGATGAAA
GCGTTGTTAAAGAGAAGAGAAATAAAGTTCACGGACAATAATAGAGAGCC
TGAGAGAATAGGGTGCAGAAAGAAAGAGTTAGAAACCTTGGTAGGAGAAT
GACACCGGATACAACGAAAATCTAGCGGTAGAAAACAAGAAATGGATGAC
ATCAGAAATGGAAGGGAAATGATGATCAAGATGTATTTGGATATAATCAA
AGAAATAAGTGTCGAGGACAAAAGGATTGAGAAGGCTCGATGTAATAAAG
ACCAGGACAAAAAGGACGATGAGGACAAAGACAGGAAAAAGGAAGATGAT
AACGAAAAGGGAGAAAACCGAGATAGTAATAAAAAGCAAAATTCAGTAGC
ATACAAGGAAATAAGACAACTCAGCAAACATTCTCCGCCCATCTCCTGGT
ATAATCCGTTGGGCTACTCAAAGGATTGGGGAAAATTCCGTGTTAGACTG
CTTTAATCTTCTATTCATAAAATGTAAGTCAATTTATTATGTACACTAAA
TAAAAGTTATAATATTCTTTTGACTTTTAGCAACAATGGAAACAATTTTG
ATTGAGACAAATCGAGAAGGATCAAAGTTGTATAACAACCAATTTACAGC
GCTCTCGTTAAATGAGTTGAATGCCTTTTTTGGCATTCTCATTCTTCGAG
GAGTATATCGTGCTGCTGGAGAAAGTATAGATGAATTGTGGTCAGCTGAA
CATGGACGTTTTATCTTCCGGAATACTATGTCTCTCAATCGATTTAAACT
TATCCGACGTATTCTGCGGTTTGATAATCCCGACACAAGAAAAGGAAGGC
TGTTACGTGATAAATTGGCGGCTGTTAGATTGCTGATCGATAATTTTGTT
GAAAATAGCCAAAAGTGTTATATGCCCGGTGAATCTGTCACTATA
back to top

protein sequence of SMED30013095-orf-1

>SMED30013095-orf-1 ID=SMED30013095-orf-1|Name=SMED30013095-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MDDIRNGREMMIKMYLDIIKEISVEDKRIEKARCNKDQDKKDDEDKDRKK
EDDNEKGENRDSNKKQNSVAYKEIRQLSKHSPPISWYNPLGYSKDWGKFR
VRLL*
back to top

protein sequence of SMED30013095-orf-2

>SMED30013095-orf-2 ID=SMED30013095-orf-2|Name=SMED30013095-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MGHMTRNCPNKQTQNPSGTVRLMRESNRKPDEINTNTRIKPANDKSVKSS
YEPGKDIKTGRQKNLLDMMKQVTRATNSQETKSRYYSNQAKQKREYNEIH
DARMNYRK*
back to top

protein sequence of SMED30013095-orf-3

>SMED30013095-orf-3 ID=SMED30013095-orf-3|Name=SMED30013095-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=120bp
METILIETNREGSKLYNNQFTALSLNELNAFFGILILRGVYRAAGESIDE
LWSAEHGRFIFRNTMSLNRFKLIRRILRFDNPDTRKGRLLRDKLAAVRLL
IDNFVENSQKCYMPGESVTI
back to top

protein sequence of SMED30013095-orf-4

>SMED30013095-orf-4 ID=SMED30013095-orf-4|Name=SMED30013095-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=196bp
MKEIIKITKEIMPKWTRNKNTTEILKGVTKMITNYTKGSKSIAEISILMK
RMPILFTIIDMAGNSLRHHAIESENEERTMEIIEAMNQCGQHRNIRNEKG
QTPMMTAVSRDASTKILRKLLKTGSTLNEKDNKGKTMLNYIMMSREASAI
EFVTINAIQEDIEIVGKNLNPIIGAIERGYGEAAAKLINWRKKIR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR029526PGBD
IPR020683Ankyrin_rpt-contain_dom
IPR002110Ankyrin_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004930G-protein coupled receptor activity
GO:0004965G-protein coupled GABA receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane