Monocarboxylate transporter, putative

Overview
NameMonocarboxylate transporter, putative
Smed IDSMED30013090
Length (bp)1699
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013090

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
whole organismSMED30013090 Contig40421uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30013090 Contig40421newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Monocarboxylate transporter, putative vs. Ensembl Human
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 177.563 bits (449), Expect = 1.640e-48
Identity = 120/469 (25.59%), Postives = 226/469 (48.19%), Query Frame = 3
Query:  189 KDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKR-SNLLLSYFQMMK-NPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFH--LYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRKTKFQ 1583
            K     + +RST+     D GWGW+IV   F+  + +  +     +   E+  ++        W+ SI+  V  L +PL S +    S +   + G ++++ G     F + L  L L+  V+ G+GF+L Y P+I +V  +F ++++ A GIA+ GSG GTF+ +P+++LLI    W+  + ILG  +L L +C +               +     +D+   E  +  +  K +   V+   ++            + +  S LL+S F ++  + +F+ Y  S +F    ++ PY      A+  G++  + +FL+S +G+ + IG + FG+L  ++ +  +    Y   V + GL  +    +++   ++ ++  +G   GA+VTL  V+  +I G   L     +      +  L+ PPI G + D+T SY  AF +CG  ++FS +++  A L +  RKT+ Q
Sbjct:   29 KTMAKVNRARSTSP---PDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVTMLCAPLGSVVSNHLSCQVGIMLGGLLASTGLILSSFATSLKHLYLTLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGA-------------LMRPITLKEDHTTPEQNHVCRTQKEDIKRVSPYSSLTKEWAQTCLCCCLQQEYSFLLMSDFVVLAVSVLFMAYGCSPLFV---YLVPY------ALSVGVSHQQAAFLMSILGVIDIIGNITFGWLTDRRCLKNYQYVCYLFAVGMDGLCYLCLPMLQSLPLLVPFSCTFGYFDGAYVTLIPVVTTEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGRLVDTTGSYTAAFLLCGFSMIFSSVLLGFARLIKRMRKTQLQ 472          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Human
Match: SLC16A14 (solute carrier family 16 member 14 [Source:HGNC Symbol;Acc:HGNC:26417])

HSP 1 Score: 162.54 bits (410), Expect = 5.279e-43
Identity = 120/492 (24.39%), Postives = 225/492 (45.73%), Query Frame = 3
Query:  150 MTTNNENVETTADKDHEDASESRSTTKRNQK-DQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKN--------ERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLL-----------------------SYF---QMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISS-IGIGNCIGRVGFGYLATKKRV---NRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCG 1508
            M T++E++      D ED  + + T K +   D GW W++V +SF  H++  G   + GVL  E+++ +  SR    W+ S+ + +  ++ P           R  AI G +++++G+    + + + +L ++  V  G+G  + YLP++++V  +F K+R+ A G++  G+GFGTFL + +++ L    GW+  M I G   L L +C +              K   + G+ ++   P +  + +K+        E++     E    +   ++       R N+                          YF    +  N +F+ +I   +FA  SF+ P++   +      ++     F ++S I I +  G+V  G +A    +   N F L N T++LS  +L     +  Y  + +  ++ G  +G F +L  V+  D+ G + L   + + +   GIS L+GPP  G+IYD T  YD +F +CG
Sbjct:    1 MYTSHEDI----GYDFEDGPKDKKTLKPHPNIDGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEFHQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMRPLSP------GKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKDGGLGNEETLCDLQAQECPDQAGHRKNMCALRILKTVSWLTMRVRKGFEDWYSGYFGTASLFTNRMFVAFIFWALFAYSSFVIPFIHLPEIVNLYNLSEQNDVFPLTSIIAIVHIFGKVILGVIADLPCISVWNVFLLANFTLVLSIFILP---LMHTYAGLAVICALIGFSSGYF-SLMPVVTEDLVGIEHLANAYGIIICANGISALLGPPFAGWIYDITQKYDFSFYICG 478          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Human
Match: SLC16A6 (solute carrier family 16 member 6 [Source:HGNC Symbol;Acc:HGNC:10927])

HSP 1 Score: 151.369 bits (381), Expect = 5.681e-39
Identity = 110/468 (23.50%), Postives = 210/468 (44.87%), Query Frame = 3
Query:  213 SRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSN-FDNXXXXXXXXXXXN--EGQDNLNTEPPNE--------LKLLKNERNAVXXXXXXXXXXXXXDDRSDM-----------SKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILV--DIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYM 1544
            S++       D GWGW +  + F   + + GI+ ++GV   + +  +  S + + W+ SI V V+   +PL + L  RF +R V + G ++ + G  A  F  E+  + ++  ++ G+G+   +LP++ I++ +F K+RS    +A  G  F  F F+P I  L   +GW++++  +G   L +VI  +     F       K    +N  E Q  L  E            ++L  + +N               + ++DM           S++   LL  F ++K   F+ Y    +FA + F AP L+     I  GI   + +FL+S++ I    GR+G G++  ++ + + ++  I V+L  + L        +  ++  +  +G M G        +L   D+ G +K+     + +  Q I+ L GPP+ G + D +  Y  AF  C   +  + + + +
Sbjct:   10 SKANVYTEVPDGGWGWAVAVSFFFVEVFTYGIIKTFGVFFNDLMDSFNESNSRISWIISICVFVLTFSAPLATVLSNRFGHRLVVMLGGLLVSTGMVAASFSQEVSHMYVAIGIISGLGYCFSFLPTVTILSQYFGKRRSIVTAVASTGECFAVFAFAPAIMALKERIGWRYSLLFVGLLQLNIVIFGALLRPIFIRGPASPKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNV------PTHTNLELEPKADMQQVLVKTSPRPSEKKAPLLD-FSILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMAIAEVFGRIGAGFVLNREPIRKIYIELICVILLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPLLAEDDVVGIEKMSSAAGVYIFIQSIAGLAGPPLAGLLVDQSKIYSRAFYSCAAGMALAAVCLAL 470          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Human
Match: SLC16A6 (solute carrier family 16 member 6 [Source:HGNC Symbol;Acc:HGNC:10927])

HSP 1 Score: 151.369 bits (381), Expect = 5.681e-39
Identity = 110/468 (23.50%), Postives = 210/468 (44.87%), Query Frame = 3
Query:  213 SRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSN-FDNXXXXXXXXXXXN--EGQDNLNTEPPNE--------LKLLKNERNAVXXXXXXXXXXXXXDDRSDM-----------SKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILV--DIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYM 1544
            S++       D GWGW +  + F   + + GI+ ++GV   + +  +  S + + W+ SI V V+   +PL + L  RF +R V + G ++ + G  A  F  E+  + ++  ++ G+G+   +LP++ I++ +F K+RS    +A  G  F  F F+P I  L   +GW++++  +G   L +VI  +     F       K    +N  E Q  L  E            ++L  + +N               + ++DM           S++   LL  F ++K   F+ Y    +FA + F AP L+     I  GI   + +FL+S++ I    GR+G G++  ++ + + ++  I V+L  + L        +  ++  +  +G M G        +L   D+ G +K+     + +  Q I+ L GPP+ G + D +  Y  AF  C   +  + + + +
Sbjct:   10 SKANVYTEVPDGGWGWAVAVSFFFVEVFTYGIIKTFGVFFNDLMDSFNESNSRISWIISICVFVLTFSAPLATVLSNRFGHRLVVMLGGLLVSTGMVAASFSQEVSHMYVAIGIISGLGYCFSFLPTVTILSQYFGKRRSIVTAVASTGECFAVFAFAPAIMALKERIGWRYSLLFVGLLQLNIVIFGALLRPIFIRGPASPKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNV------PTHTNLELEPKADMQQVLVKTSPRPSEKKAPLLD-FSILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMAIAEVFGRIGAGFVLNREPIRKIYIELICVILLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPLLAEDDVVGIEKMSSAAGVYIFIQSIAGLAGPPLAGLLVDQSKIYSRAFYSCAAGMALAAVCLAL 470          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Human
Match: SLC16A6 (solute carrier family 16 member 6 [Source:HGNC Symbol;Acc:HGNC:10927])

HSP 1 Score: 145.976 bits (367), Expect = 4.112e-37
Identity = 109/467 (23.34%), Postives = 209/467 (44.75%), Query Frame = 3
Query:  213 SRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSN-FDNXXXXXXXXXXXN--EGQDNLNTEPPNE--------LKLLKNERNAVXXXXXXXXXXXXXDDRSDM-----------SKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFG-EDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYM 1544
            S++       D GWGW +  + F   + + GI+ ++GV   + +  +  S + + W+ SI V V+   +PL + L  RF +R V + G ++ + G  A  F  E+  + ++  ++ G+G+   +LP++ I++ +F K+RS    +A  G  F  F F+P I  L   +GW++++  +G   L +VI  +     F       K    +N  E Q  L  E            ++L  + +N               + ++DM           S++   LL  F ++K   F+ Y    +FA + F AP L+     I  GI   + +FL+S++ I    GR+G G++  ++ + + ++  I V+L  + L        +  ++  +  +G M G    L+   L+ +     K+     + +  Q I+ L GPP+ G + D +  Y  AF  C   +  + + + +
Sbjct:   10 SKANVYTEVPDGGWGWAVAVSFFFVEVFTYGIIKTFGVFFNDLMDSFNESNSRISWIISICVFVLTFSAPLATVLSNRFGHRLVVMLGGLLVSTGMVAASFSQEVSHMYVAIGIISGLGYCFSFLPTVTILSQYFGKRRSIVTAVASTGECFAVFAFAPAIMALKERIGWRYSLLFVGLLQLNIVIFGALLRPIFIRGPASPKIVIQENRKEAQYMLENEKTRTSIDSIDSGVELTTSPKNV------PTHTNLELEPKADMQQVLVKTSPRPSEKKAPLLD-FSILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMAIAEVFGRIGAGFVLNREPIRKIYIELICVILLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGLTFHCLLRMMSWALKMSSAAGVYIFIQSIAGLAGPPLAGLLVDQSKIYSRAFYSCAAGMALAAVCLAL 469          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Celegans
Match: mct-6 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:O17328])

HSP 1 Score: 143.28 bits (360), Expect = 2.618e-36
Identity = 70/186 (37.63%), Postives = 104/186 (55.91%), Query Frame = 3
Query:  237 QKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNF 794
              D GWGWV+V  SF  H+ +DG VYS+GVL    ++ +  S      + S+L  +     PL S +C ++  R   I G  ++ VG A  YF + +W ++++  V+ G GF L+Y P+I+IV M+F+ KRS A GIAV G+G GT LF+PI    I   GW+         + ILV+C+   + F
Sbjct:   17 PPDGGWGWVVVLGSFFVHVFADGFVYSFGVLVETLMEEFHASNTMAALIISLLTGLTLGSGPLASAVCNKYGCRITTITGAGVAFVGCALSYFATAMWHIVITVGVIMGTGFGLMYCPAIVIVTMYFENKRSLATGIAVAGAGVGTVLFAPINAFFINNYGWRSVFLAF---LFILVLCALCGATF 199          

HSP 2 Score: 113.62 bits (283), Expect = 2.339e-26
Identity = 62/200 (31.00%), Postives = 113/200 (56.50%), Query Frame = 3
Query:  975 SNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKK-----------RVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMY 1541
            SN+L    +++  P FLL+  S +  ++ F +P  F    A + G+   +GS ++S+ G+ N +GR+ FG +A  K             NR  +YNI++ + GL+ +  +    +I +  Y++++G    +++ L+SVILVD+ G DKL   F L L +QG+  + GPP+ GY+ D T +Y ++F  CG  ++ S ++++
Sbjct:  379 SNML--SLELLLEPTFLLFAISNLLTSVGFNSPLYFLPLHATKIGLEPIQGSKVLSAFGVSNTVGRIIFGVVADHKLPLPGGIGNDTARNRLWMYNISLTICGLLTVFCYQFNGFIPLATYSALFGFSIASYICLTSVILVDLLGLDKLTNAFGLLLLWQGVGTVFGPPVSGYLADMTGNYTLSFVFCGVNLLASGLMLF 576          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 142.51 bits (358), Expect = 1.000e-35
Identity = 76/236 (32.20%), Postives = 126/236 (53.39%), Query Frame = 3
Query:   57 DINYRSGNENQTRTQAFDENVDQNNENESQKMTTNNENVETTADKDHE---DASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSI 755
            D N  S   + T++   + N + N E + Q + + N+   T     +       +          D G+GWVIVFA+F+S+L+ DGI  ++      Y + Y+ S     ++GS+++    L+ PL S LC ++  R V +AG +IS + F        ++  +L   V+ G+GF +IYLP+I++V  +FD KR+ A GI+V GSG GTFL   I ++ I  +GW+ T+++L   I
Sbjct:    6 DPNRSSQPTSPTKSLKSERNGESNFEEDDQDIGSLNDGQLTNYSSQYSINMGVQQVEPLLVPQAPDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLTVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMI 241          

HSP 2 Score: 96.6709 bits (239), Expect = 9.087e-21
Identity = 53/180 (29.44%), Postives = 98/180 (54.44%), Query Frame = 3
Query:  996 FQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRII 1535
              ++KN   ++   S +   + F  P +F KD +    +  S   FL+   G+ N IGRV FG+L  +K ++   + N+++++SGL+ +    + +      Y  ++G +  A++ L+S++L D+ G + L  +F L +  +GI+ L+GPP  G +YD T SYD AF   G  ++ + +I
Sbjct:  505 LNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFFGWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDITGSYDTAFYFGGLVLLVAGLI 684          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 142.124 bits (357), Expect = 2.183e-35
Identity = 76/237 (32.07%), Postives = 126/237 (53.16%), Query Frame = 3
Query:   54 ADINYRSGNENQTRTQAFDENVDQNNENESQKMTTNNENVETTADKDHE---DASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSI 755
             D N  S   + T++   + N + N E + Q + + N+   T     +       +          D G+GWVIVFA+F+S+L+ DGI  ++      Y + Y+ S     ++GS+++    L+ PL S LC ++  R V +AG +IS + F        ++  +L   V+ G+GF +IYLP+I++V  +FD KR+ A GI+V GSG GTFL   I ++ I  +GW+ T+++L   I
Sbjct:    5 PDPNRSSQPTSPTKSLKSERNGESNFEEDDQDIGSLNDGQLTNYSSQYSINMGVQQVEPLLVPQAPDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLTVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMI 241          

HSP 2 Score: 97.4413 bits (241), Expect = 6.673e-21
Identity = 53/180 (29.44%), Postives = 98/180 (54.44%), Query Frame = 3
Query:  996 FQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRII 1535
              ++KN   ++   S +   + F  P +F KD +    +  S   FL+   G+ N IGRV FG+L  +K ++   + N+++++SGL+ +    + +      Y  ++G +  A++ L+S++L D+ G + L  +F L +  +GI+ L+GPP  G +YD T SYD AF   G  ++ + +I
Sbjct:  505 LNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFFGWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDITGSYDTAFYFGGLVLLVAGLI 684          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 138.272 bits (347), Expect = 2.738e-34
Identity = 66/171 (38.60%), Postives = 105/171 (61.40%), Query Frame = 3
Query:  243 DQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSI 755
            D G+GWVIVFA+F+S+L+ DGI  ++      Y + Y+ S     ++GS+++    L+ PL S LC ++  R V +AG +IS + F        ++  +L   V+ G+GF +IYLP+I++V  +FD KR+ A GI+V GSG GTFL   I ++ I  +GW+ T+++L   I
Sbjct:   16 DGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLTVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMI 186          

HSP 2 Score: 97.0561 bits (240), Expect = 6.786e-21
Identity = 53/180 (29.44%), Postives = 98/180 (54.44%), Query Frame = 3
Query:  996 FQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRII 1535
              ++KN   ++   S +   + F  P +F KD +    +  S   FL+   G+ N IGRV FG+L  +K ++   + N+++++SGL+ +    + +      Y  ++G +  A++ L+S++L D+ G + L  +F L +  +GI+ L+GPP  G +YD T SYD AF   G  ++ + +I
Sbjct:  450 LNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFFGWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDITGSYDTAFYFGGLVLLVAGLI 629          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 138.272 bits (347), Expect = 2.738e-34
Identity = 66/171 (38.60%), Postives = 105/171 (61.40%), Query Frame = 3
Query:  243 DQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSI 755
            D G+GWVIVFA+F+S+L+ DGI  ++      Y + Y+ S     ++GS+++    L+ PL S LC ++  R V +AG +IS + F        ++  +L   V+ G+GF +IYLP+I++V  +FD KR+ A GI+V GSG GTFL   I ++ I  +GW+ T+++L   I
Sbjct:   16 DGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERYQESDGLTVFIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASPNIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMI 186          

HSP 2 Score: 97.0561 bits (240), Expect = 6.786e-21
Identity = 53/180 (29.44%), Postives = 98/180 (54.44%), Query Frame = 3
Query:  996 FQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRII 1535
              ++KN   ++   S +   + F  P +F KD +    +  S   FL+   G+ N IGRV FG+L  +K ++   + N+++++SGL+ +    + +      Y  ++G +  A++ L+S++L D+ G + L  +F L +  +GI+ L+GPP  G +YD T SYD AF   G  ++ + +I
Sbjct:  450 LNLLKNKTMMILCISNLLGMMGFYIPIMFLKDLSESMKLDMSLAMFLVPIFGVFNTIGRVFFGWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDITGSYDTAFYFGGLVLLVAGLI 629          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Fly
Match: Mct1 (gene:FBgn0023549 transcript:FBtr0342765)

HSP 1 Score: 153.68 bits (387), Expect = 1.434e-39
Identity = 76/194 (39.18%), Postives = 116/194 (59.79%), Query Frame = 3
Query:  189 KDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVI 770
            +   +A E     +    D GWGWV+VF SF+ H+++DG+ YS+G+   E++ ++   +    W+ SI+V V F   P++S    R+  R+V IAG+I++        F   +  LI++     G+GF LIYLP+I+ V  +F+ KRS A GIAVCGSGFGTF+F+P+ E LI   GW+  M I+G  +L  +I
Sbjct:   12 QQQHEACEMDMERQPTPPDGGWGWVVVFGSFMIHIVTDGMTYSFGIFYNEFLDYFNEGKGYTAWIASIMVGVTFSSGPISSSFVNRYGCRAVTIAGSILAASCIIVSMFAQNVLTLIITIGFGTGLGFGLIYLPAIVSVTQYFEAKRSLATGIAVCGSGFGTFVFAPLTEFLIGNYGWRGAMLIIGGIVLNCII 205          

HSP 2 Score: 126.331 bits (316), Expect = 2.461e-30
Identity = 69/182 (37.91%), Postives = 107/182 (58.79%), Query Frame = 3
Query:  996 FQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMY 1541
            F ++K+ +F+++  S    +I F  PYL+    A    +T +  S+LIS+IG+ N +GR+  GY++ K  VNR  +YN+ +   G+         ++ ++  Y  ++G   GA+V L+SVILVD+ G DKL   F L L FQGI+  IGPPI G++YD T SY  AF + G  I  S ++M+
Sbjct:  420 FSLLKDMVFVIFSVSNFCTSIGFNVPYLYVVAYAETLKLTKTDASYLISTIGVANTVGRIILGYISDKPWVNRLLVYNVCLTACGVSTAMVPLCHDFQSLAFYCCVFGFTIGAYVGLTSVILVDLLGLDKLTNAFGLLLLFQGIASFIGPPIGGWMYDLTDSYAPAFLMAGLMIAISGLVMF 601          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Fly
Match: Mct1 (gene:FBgn0023549 transcript:FBtr0070393)

HSP 1 Score: 153.68 bits (387), Expect = 1.434e-39
Identity = 76/194 (39.18%), Postives = 116/194 (59.79%), Query Frame = 3
Query:  189 KDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVI 770
            +   +A E     +    D GWGWV+VF SF+ H+++DG+ YS+G+   E++ ++   +    W+ SI+V V F   P++S    R+  R+V IAG+I++        F   +  LI++     G+GF LIYLP+I+ V  +F+ KRS A GIAVCGSGFGTF+F+P+ E LI   GW+  M I+G  +L  +I
Sbjct:   12 QQQHEACEMDMERQPTPPDGGWGWVVVFGSFMIHIVTDGMTYSFGIFYNEFLDYFNEGKGYTAWIASIMVGVTFSSGPISSSFVNRYGCRAVTIAGSILAASCIIVSMFAQNVLTLIITIGFGTGLGFGLIYLPAIVSVTQYFEAKRSLATGIAVCGSGFGTFVFAPLTEFLIGNYGWRGAMLIIGGIVLNCII 205          

HSP 2 Score: 126.331 bits (316), Expect = 2.461e-30
Identity = 69/182 (37.91%), Postives = 107/182 (58.79%), Query Frame = 3
Query:  996 FQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMY 1541
            F ++K+ +F+++  S    +I F  PYL+    A    +T +  S+LIS+IG+ N +GR+  GY++ K  VNR  +YN+ +   G+         ++ ++  Y  ++G   GA+V L+SVILVD+ G DKL   F L L FQGI+  IGPPI G++YD T SY  AF + G  I  S ++M+
Sbjct:  420 FSLLKDMVFVIFSVSNFCTSIGFNVPYLYVVAYAETLKLTKTDASYLISTIGVANTVGRIILGYISDKPWVNRLLVYNVCLTACGVSTAMVPLCHDFQSLAFYCCVFGFTIGAYVGLTSVILVDLLGLDKLTNAFGLLLLFQGIASFIGPPIGGWMYDLTDSYAPAFLMAGLMIAISGLVMF 601          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Fly
Match: CG13907 (gene:FBgn0035173 transcript:FBtr0072593)

HSP 1 Score: 144.436 bits (363), Expect = 4.506e-36
Identity = 72/177 (40.68%), Postives = 108/177 (61.02%), Query Frame = 3
Query:  240 KDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVI 770
             D G+GWVI FASF+ ++I DGI Y++G+   E++ ++   + TV W+GS+L  V     P+ S L  ++  R+V IAG+II+ + F    F + +  L+ +   + G GF +IYLP+++ V  +F+ KRS A GIAVCGSGFGTF F+P+   L+   GWK  + I    IL   I
Sbjct:   72 PDGGYGWVICFASFMCNMIVDGIAYTFGIFLEEFVAYFHEGKGTVAWVGSLLSGVYLSAGPIVSALANKYGCRAVCIAGSIIACIAFVLSTFSTNVSMLMATYGFMGGFGFGMIYLPAVVAVGYYFETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALLIFAGLILNCAI 248          

HSP 2 Score: 102.834 bits (255), Expect = 1.420e-22
Identity = 61/182 (33.52%), Postives = 103/182 (56.59%), Query Frame = 3
Query: 1002 MMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMA 1547
            ++K+P+F+L   S +F       P+++  D A ++ I  +  + L+S IGI N +GRV  G++A   +VN   L N  +L+S + +  +    +Y A I  +  +G+    +++L+S+ILVD+ G DKL   F L + F+G + LIG P+ G IYD T +YD+ F + G     S I  ++A
Sbjct:  566 LLKDPVFMLIGVSNIFGMAGLYVPFVYLVDAAKEHDIPKNDAAMLLSIIGITNTVGRVFCGWVADLPQVNSLLLNNCCLLVSTIAVTLTPLCYSYAAYITMSIFFGLAISGYISLTSIILVDLLGLDKLTNAFGLLILFRGFAALIGTPLAGAIYDMTHTYDLPFYMAGALFGISTITSFLA 747          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Fly
Match: CG13907 (gene:FBgn0035173 transcript:FBtr0345005)

HSP 1 Score: 144.436 bits (363), Expect = 4.506e-36
Identity = 72/177 (40.68%), Postives = 108/177 (61.02%), Query Frame = 3
Query:  240 KDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVI 770
             D G+GWVI FASF+ ++I DGI Y++G+   E++ ++   + TV W+GS+L  V     P+ S L  ++  R+V IAG+II+ + F    F + +  L+ +   + G GF +IYLP+++ V  +F+ KRS A GIAVCGSGFGTF F+P+   L+   GWK  + I    IL   I
Sbjct:   72 PDGGYGWVICFASFMCNMIVDGIAYTFGIFLEEFVAYFHEGKGTVAWVGSLLSGVYLSAGPIVSALANKYGCRAVCIAGSIIACIAFVLSTFSTNVSMLMATYGFMGGFGFGMIYLPAVVAVGYYFETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALLIFAGLILNCAI 248          

HSP 2 Score: 102.834 bits (255), Expect = 1.420e-22
Identity = 61/182 (33.52%), Postives = 103/182 (56.59%), Query Frame = 3
Query: 1002 MMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMA 1547
            ++K+P+F+L   S +F       P+++  D A ++ I  +  + L+S IGI N +GRV  G++A   +VN   L N  +L+S + +  +    +Y A I  +  +G+    +++L+S+ILVD+ G DKL   F L + F+G + LIG P+ G IYD T +YD+ F + G     S I  ++A
Sbjct:  566 LLKDPVFMLIGVSNIFGMAGLYVPFVYLVDAAKEHDIPKNDAAMLLSIIGITNTVGRVFCGWVADLPQVNSLLLNNCCLLVSTIAVTLTPLCYSYAAYITMSIFFGLAISGYISLTSIILVDLLGLDKLTNAFGLLILFRGFAALIGTPLAGAIYDMTHTYDLPFYMAGALFGISTITSFLA 747          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Fly
Match: chk (gene:FBgn0033095 transcript:FBtr0302166)

HSP 1 Score: 142.124 bits (357), Expect = 3.413e-35
Identity = 67/201 (33.33%), Postives = 121/201 (60.20%), Query Frame = 3
Query:  201 DASESRSTTKRNQK--DQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFD 797
            D+ +S ST K+  K  D G+GWV+VFAS +  LI+DG+ +S+G++  E ++++  S +   W+ S+  +V  L+ P+ S L  ++  R + I G ++S  GFA   F + +  L+++  ++ G+G  + Y+ +++ +  WFDKKR+FA GI   G+G GTF+++ +   LI + GW+    ILG ++L   +C +   + D
Sbjct:  118 DSIDSSSTEKKTPKMPDGGYGWVVVFASLVVSLIADGLSFSFGLINVELLEYFGESTSKTAWISSLFFSVPLLMGPIWSNLVDKYGCRKMTILGGVVSAFGFALSSFCNSIEMLMVTFGIISGLGLGIGYVTAVVSIAFWFDKKRTFATGIGASGTGIGTFVYARLTSYLIESYGWRGATLILGGTMLNACVCGALMRDPD 318          

HSP 2 Score: 84.7297 bits (208), Expect = 9.678e-17
Identity = 58/184 (31.52%), Postives = 89/184 (48.37%), Query Frame = 3
Query:  996 FQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGL-VLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYM 1544
            F +  +  F L+  ST+F  I FI PYL+  D   Q     S+ + LIS +GI   +G +G GYL     +N    Y++ +L+ G  V      I NY+ +++   I+G    +  + +  ILV I   D     + L L  QG+ ++ GPPI G IY+ T  +D  F   G  I  S +  Y+
Sbjct:  685 FSLFLDMKFALFNLSTLFLFIWFIIPYLYLPDYMKQYKYDVSQSAELISDVGIAQTVGMIGLGYLGDLSWMNINICYSLCMLVCGASVFFMPLLITNYMGLMVMCVIFGFTFASSFSFTPSILVSIVDLDDFTCAYGLVLLVQGVGMIAGPPIAGVIYEYTGRWDDTFYYAGIFIALSGVCSYL 868          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Zebrafish
Match: slc16a9a (solute carrier family 16 member 9a [Source:ZFIN;Acc:ZDB-GENE-040426-1364])

HSP 1 Score: 169.474 bits (428), Expect = 1.002e-45
Identity = 123/471 (26.11%), Postives = 217/471 (46.07%), Query Frame = 3
Query:  243 DQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNF-----------------DNXXXXXXXXXXXNEGQDNLNTEP----------------PNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSF-LISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYL 1553
            D GWGW+IV ASF++  +S G   S GVL  E++  ++  +    W+GS++  V  + SP+ S     F  R V I   ++   G     F   + FLI S  +V G+G  L+Y  ++ I   +FDK+R  A+GI   G+  G F+++ +   LI   G +  + I+G   L L+ C+                       D +    K      E   +L T+P                P EL+  + ER    +  +I         +  M           +++++ IF+ +  +    ++    P LF +D A   G+        L+S + +   IG++  G LA  + VN  +LY +T++ SG  L+     K+Y+ + I ++  G  +G + +L+S I   I G ++L +   + + F G  + +GPP++G+ +D T SYD+AF + G C++ S + +++A L
Sbjct:   11 DGGWGWMIVVASFMAQFLSFGSPQSVGVLYPEWLSAFQEGKGMTAWVGSMVSGVALITSPVCSACVDNFGARPVTIFSGVMVAGGLMLSAFAPNISFLIFSYGIVVGMGCGLVYAATLTITCQYFDKRRGLALGIVTTGTSVGGFIYATLQNELIELFGLEGCLLIIGALALNLMACAGPMRPLNLPGYYLKQRAALQRTEDPEPLYSKPTAVIIESGSDLKTKPGLAENTTTVKLLINKDPIELQDSEGERKVHILSSSIIARAI----KKWMRPYGQYFCETVELLQDRIFMAFCIAMFLFSLGAFPPVLFMEDVAQSEGLIDGIALIPLVSIVAMTTGIGKLILGVLADMRWVNSLYLYALTLIGSGTALLLIPVSKSYLGLQILSASVGFFSGNW-SLTSYITTKIVGIERLGQAHGILMCFGGFGIALGPPVVGWFFDWTQSYDLAFYLSGTCVLVSGVFLFLAAL 476          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Zebrafish
Match: slc16a12b (solute carrier family 16 member 12b [Source:NCBI gene;Acc:449947])

HSP 1 Score: 164.466 bits (415), Expect = 3.750e-44
Identity = 105/425 (24.71%), Postives = 200/425 (47.06%), Query Frame = 3
Query:  240 KDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFH--LYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCG 1508
             D GWGW+IV   F+  + +  +     +   E+  H+    +   W+ S++     L +PL S +  + S R   I G  +++VG     F + L +L  +  ++ G+GF+L Y P+I +V ++F ++++ A GIA+ GSG GTF+ +P+++LLI    W+  + ILG  +L L +C +       K +        +E     + +PP         R+A                 SD  +R    +  +  +  P FL+  GS +  A     P+++    A+  G+     +FL+S +G+ + +G + FG+L  ++ + ++    Y   V + GL  +    ++ ++ ++ ++ +YG   GA+V L  V+  D+ G   L     +      +  L+ PPI G++ D+T +Y   F + G
Sbjct:   24 PDGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFAKDYSGTAWIHSLVDCTTMLCAPLGSLIGNQLSCRIAVILGGFLASVGLVLSSFATSLEYLYATLGLLTGLGFALCYTPAIAMVGIYFCERKALAYGIAMSGSGIGTFILAPVVQLLIEHYSWRGALLILGGFVLNLCVCGALLRPIILKEEEACPLPVDSE--CGYSVKPPTLNG--GPTRSAA----------------SDAKQRCFQSMQEYHFLLMPDFLVLAGSFLLLASGCSLPFVYLVPYALDVGVGHQHAAFLMSILGVIDIVGNITFGWLTDRRCLKKYRNICYMFAVGMEGLCCLFIPLLRTFVWLVPFSVLYGYFDGAYVALIPVVTSDVVGRQYLSSALGVVYFLHAVPYLVSPPIGGWLVDTTGTYTATFFLSG 428          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Zebrafish
Match: slc16a9b (solute carrier family 16 member 9b [Source:ZFIN;Acc:ZDB-GENE-040801-69])

HSP 1 Score: 163.696 bits (413), Expect = 7.901e-44
Identity = 118/454 (25.99%), Postives = 215/454 (47.36%), Query Frame = 3
Query:  231 RNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNE-GQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXD----------DRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNG-ITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLS 1556
            +   D GWGW IV ASF+   ++ G   S GVL  E++  ++ S+    W+GS++  V  + SP+ S     F  R V I   ++ + G     F   + FLI S  +V G+G  L+Y  ++ I   +FDK+R  A+GI   G+  G FL++      I   G    + ++G   L ++ C+         +   K + +  E  ++N+  + P     +K  ++ V I  + +                  +    + S  L S  Q+++N +FL    S     +    P LF +D A   G IT      L+S + I   +G++  G +   + +N  +LY +T+L +G+ L+     KNY  + + +++ G  +G + ++   +   + G D+L + + + + F G S+++GPP+ G+IYD   SYD+AF   GG ++     ++++ LS
Sbjct:    7 KPAPDGGWGWAIVVASFMGQFLAYGSPQSVGVLYPEWLNTFQDSKGMTAWVGSLVSGVGLIASPICSACVVNFGARPVTIFSGVMVSGGLMLSAFAPNVQFLIFSYGIVVGLGCGLVYAATVTITCQYFDKRRGLALGIVTTGTSVGGFLYAAAQNEFIALFGLDGCLLLIGCFALNIIACAGLMRPLHLPAYYLKQRAAMAEKAEENVLEKSPVVEDPVKKTQSIVLITGDTKDTHEKRKLLNYVTLVRLMKKKQKQYSEYLHSIGQVLQNRVFLATCVSLFAYCLGAYTPLLFLEDLAQSEGLITGISTIPLVSIMSIAAGVGKLLLGVMMDVRWMNSIYLYAVTLLGTGVALLIIPVTKNYAGLQVISAVLGFFSGNW-SVIPYMTTKVVGMDRLTEAYGILMFFGGFSIMLGPPVAGWIYDWMHSYDLAFYFSGGFVLLGGAGLFLSALS 459          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Zebrafish
Match: slc16a8 (solute carrier family 16 member 8 [Source:ZFIN;Acc:ZDB-GENE-121128-1])

HSP 1 Score: 152.91 bits (385), Expect = 3.784e-40
Identity = 111/463 (23.97%), Postives = 207/463 (44.71%), Query Frame = 3
Query:  210 ESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKK--RVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMA---YLSRDFRKTKFQ 1583
            E R T      D GWGWV++   F+    S     +  V   E +  +        W+ SI++A+++   P++S +  +F  R V + G +++++G  +  F + +  L +++ V+ G+G +L + PS++++  +FDK+R  A G+A  GS       SP+ +LL+   GW+    I G  +L    C +                   + +   N E    L     + N V             ++ +D       LL  F ++++   ++YI +     +    P +   + A   G+   + +FL+S IG  +   R   G +A  K  R    + +++ +L +GL  + S    +Y  +II+   +G+  G    L   +L+ I G  K      L L F+ ++VLIGPP  GY+ D   +Y++ F + GG ++ + I + +A    +S+  RK   Q
Sbjct:    6 EDRETA--GAPDGGWGWVVLLGGFVITGFSYAFPKAISVYFKELMHDFGCGYKDTAWISSIILAMLYGSGPISSIMVNKFGCRPVMLVGGLLASLGMISASFATSIIHLYITAGVITGLGLALNFQPSLIMLGAYFDKRRPLANGLAAAGSPVFLSALSPLGQLLLDQYGWRGGFLITGGLLLNCCTCGAVMRPLK------------LKERKACNQELKEMLPPEAGQENIV------------CENNNDKQPSKKKLLD-FSVLRDKGLIIYIIAKFIVVLGLFVPTILLVNYAKDQGVPDKEAAFLLSIIGFIDIFARPTCGVVAGLKWVRPKMSYFFSLALLFNGLTDVCSATSTDYKGLIIFCVFFGLSYGMVGALQFEVLMGIVGTSKFSSALGLVLLFEAVAVLIGPPSAGYLVDKYKNYELIFYMAGGELITAGIFLALASFCCISQKKRKDSPQ 441          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Zebrafish
Match: slc16a8 (solute carrier family 16 member 8 [Source:ZFIN;Acc:ZDB-GENE-121128-1])

HSP 1 Score: 152.91 bits (385), Expect = 3.784e-40
Identity = 111/463 (23.97%), Postives = 207/463 (44.71%), Query Frame = 3
Query:  210 ESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKK--RVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMA---YLSRDFRKTKFQ 1583
            E R T      D GWGWV++   F+    S     +  V   E +  +        W+ SI++A+++   P++S +  +F  R V + G +++++G  +  F + +  L +++ V+ G+G +L + PS++++  +FDK+R  A G+A  GS       SP+ +LL+   GW+    I G  +L    C +                   + +   N E    L     + N V             ++ +D       LL  F ++++   ++YI +     +    P +   + A   G+   + +FL+S IG  +   R   G +A  K  R    + +++ +L +GL  + S    +Y  +II+   +G+  G    L   +L+ I G  K      L L F+ ++VLIGPP  GY+ D   +Y++ F + GG ++ + I + +A    +S+  RK   Q
Sbjct:    6 EDRETA--GAPDGGWGWVVLLGGFVITGFSYAFPKAISVYFKELMHDFGCGYKDTAWISSIILAMLYGSGPISSIMVNKFGCRPVMLVGGLLASLGMISASFATSIIHLYITAGVITGLGLALNFQPSLIMLGAYFDKRRPLANGLAAAGSPVFLSALSPLGQLLLDQYGWRGGFLITGGLLLNCCTCGAVMRPLK------------LKERKACNQELKEMLPPEAGQENIV------------CENNNDKQPSKKKLLD-FSVLRDKGLIIYIIAKFIVVLGLFVPTILLVNYAKDQGVPDKEAAFLLSIIGFIDIFARPTCGVVAGLKWVRPKMSYFFSLALLFNGLTDVCSATSTDYKGLIIFCVFFGLSYGMVGALQFEVLMGIVGTSKFSSALGLVLLFEAVAVLIGPPSAGYLVDKYKNYELIFYMAGGELITAGIFLALASFCCISQKKRKDSPQ 441          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Xenopus
Match: atf6b (activating transcription factor 6 beta [Source:Xenbase;Acc:XB-GENE-1013925])

HSP 1 Score: 171.4 bits (433), Expect = 2.669e-46
Identity = 128/479 (26.72%), Postives = 227/479 (47.39%), Query Frame = 3
Query:  186 DKDHEDASESRSTTKRNQK----DQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFD-------NXXXXXXXXXXXNEGQ-DNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDD--RSDMSK--------------RSNLLL---SYF---QMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISS-IGIGNCIGRVGFGYLATKKRVNRFHLY---NITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCG 1508
            D   E A +++S T+  +     D+GW W++V +SF+ HL+  G   + G+L  E+++ +K SR    W+ S+ + +  ++ P+          R  A+ G  ++++G+    +   + FL  S  V  GIG  ++YLP+++ V  +F K+R+ A G++  G+GFGTFL + +++ L   +GW+  M I G   L L +C +     D       +  +     K   EG   N+N    N     + E  A          E   +D   +DM+K              RS       SYF    +  N +F+ ++   + A  SF+ P++   +     G+T     F ++S I I +  G+V  G+L     V+ ++++   N T+ +S L+L     +  Y ++ +  ++ G  +G F +L  V+  D+ G  +L   + + +   GIS L+GPP  G+IYD T  YD +F VCG
Sbjct:    7 DMGKELAKDTKSKTQMKKVNPNIDRGWAWMVVLSSFLVHLLVMGSQMALGILNLEWLEEFKQSRGLTAWISSLSMGITLIVGPIIGLFINTCGCRKTAMIGGFLTSLGWVLSAYAPNVHFLFFSFGVTAGIGSGMVYLPAVVTVGHYFQKRRALAQGLSTTGTGFGTFLITVLLKYLCRELGWRNAMIIQGAVTLNLCVCGALMRPLDHDEEHLKDHEEAAVDPKDAKEGALLNVNAIKANSELHEEEEGKASADTAVSWSKEETRNDIFINDMNKLSIMKTLTHMTVSVRSGFFAWYSSYFGASSLFTNKVFVAFVFWALLAYCSFVIPFIHLPEIVEMYGLTEQNNIFPLTSIIAIVHIFGKVILGFLGDLPCVSAWNVFIASNFTLGVSILILP---LMHVYSSLALVCALIGFSSGYF-SLMPVVTEDLVGIKQLANAYGIIICANGISALLGPPFAGWIYDITQKYDYSFYVCG 481          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Xenopus
Match: mad2l1 (mitotic arrest deficient 2 like 1 [Source:Xenbase;Acc:XB-GENE-947153])

HSP 1 Score: 152.91 bits (385), Expect = 9.605e-40
Identity = 116/444 (26.13%), Postives = 200/444 (45.05%), Query Frame = 3
Query:  234 NQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSY-----FQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKK--RVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYM 1544
               D GWGW++V  +FIS   S     +  V   E  +H+  S + + W+ SIL+A ++   P++S L  R+  R V I G ++S VG     F S +  L +   V+ G GFSL   PS+++V  +F KKR  A G+A+ GS       +P+ + L    GW+ + FILG    +L+ C  + + F         K  K   QD L  +  NE  L  N+               +   + + +K+   L  +       + K+  F++Y+   V    +F AP +F    A   G+     +FL+S + I +   R G G +A  K  R    + ++ +V  +G   +       Y+ +++Y+  +G+  G    L    L+D+ G  +      L    + + +L+GPPI G I D+   Y   +  CG  +V + + +++
Sbjct:   12 TPPDGGWGWMVVLGAFISMGFSYAFSKAITVFFKEIQEHFGASYSEIAWISSILLAAMYAGGPVSSILVNRYGSRPVVIFGGLLSGVGMIIATFSSSILQLYIFIGVIAGFGFSLNLQPSVIVVGKYFLKKRPIANGLAMAGSPVVLSTLAPLNQFLFDKFGWRGSFFILGA---LLLNCCVAGALFRPIGPSTTDKIQKKPAQD-LAEKGTNETLLTANKLPP------------SYGTKMEETKQETCLQKFNKVLDLTLFKHRGFMIYLVGNVVMFFAFYAPIVFLTPYAKHLGVDEYSAAFLLSILAIVDMFARPGTGLIANTKWVRPKIQYFFSFSVTFNGFCHLMCPFATGYVGLVVYSVFFGLAFGMVCALLFETLMDLVGVKRFSSAVGLVTIVECVPLLLGPPIGGAIVDAFGDYKYMYFECGAIMVLAGLFLFV 439          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Xenopus
Match: SLC16A6 (solute carrier family 16 member 6 [Source:NCBI gene;Acc:100494933])

HSP 1 Score: 148.673 bits (374), Expect = 4.597e-38
Identity = 115/471 (24.42%), Postives = 208/471 (44.16%), Query Frame = 3
Query:  213 SRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLI-YLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDN---------------------LNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNL-LLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIG---SWGIKNYIAM-IIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYM 1544
            SR+       D GWGW +  A F   + + G++ S+GV   E + ++  S + + W+ SI V V+   +PL++ L  RF +R V + G ++ + G  A  F   +  + ++  ++ G       Y P IL  + +F+++RS    +A  G  F  F F+P I  L   +GW+  + ++G   L +V+C S       K        +K E  ++                     ++T P N    LK  R+                +R + ++R     L  F +++NP F+ Y    +FA + F AP L+    ++  GI      +++S++ I    GR+G G++  KK V + ++    V L  + L+    +W     +A  + +  + G +TG  + L  V   DI G DK+     + +  Q ++ L GPP+ G + D T +Y  AF  C   +    + + +
Sbjct:   11 SRANVYTKVPDGGWGWAVAGAFFFVEVFTYGVIKSFGVFFNELVGYFDESNSRISWIISICVFVMTFTAPLSTVLSNRFGHRPVVMVGGLLISTGMMAASFARSVGEMYVAIGLISGGPTHYTRYCPRIL--SQYFERRRSLVTAVASTGECFAVFAFAPAITALNDLIGWRCCLLMVGALQLNIVVCGSLLRPITIKPPDVAKSPAKGEALESAYMLENEQTLTSIDSIDSGVEVSTSPKNLPTGLKPARSP-----------EPPRERKETAERPEPEPLLDFSVLRNPSFICYALFGLFATLGFFAPSLYIIPLSLSLGIDRELSPYMLSAMAISEVFGRIGAGWILNKKPVRKIYIELAFVALLCVALLAFPFAWNFGGLMACSVFFGGMLGTVTGTHIPL--VAEDDIVGIDKMASGVGVYVFIQSVAGLAGPPLGGVLVDWTQNYGSAFYSCAAGMALGALFLAL 466          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Xenopus
Match: SLC16A6 (solute carrier family 16 member 6 [Source:NCBI gene;Acc:100494933])

HSP 1 Score: 147.902 bits (372), Expect = 7.699e-38
Identity = 117/477 (24.53%), Postives = 211/477 (44.23%), Query Frame = 3
Query:  213 SRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCG-IGFS------LIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDN---------------------LNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNL-LLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIG---SWGIKNYIAM-IIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYM 1544
            SR+       D GWGW +  A F   + + G++ S+GV   E + ++  S + + W+ SI V V+   +PL++ L  RF +R V + G ++ + G  A  F   +  + ++  ++ G +G S        Y P IL  + +F+++RS    +A  G  F  F F+P I  L   +GW+  + ++G   L +V+C S       K        +K E  ++                     ++T P N    LK  R+                +R + ++R     L  F +++NP F+ Y    +FA + F AP L+    ++  GI      +++S++ I    GR+G G++  KK V + ++    V L  + L+    +W     +A  + +  + G +TG  + L  V   DI G DK+     + +  Q ++ L GPP+ G + D T +Y  AF  C   +    + + +
Sbjct:    8 SRANVYTKVPDGGWGWAVAGAFFFVEVFTYGVIKSFGVFFNELVGYFDESNSRISWIISICVFVMTFTAPLSTVLSNRFGHRPVVMVGGLLISTGMMAASFARSVGEMYVAIGLISGKLGGSGGPTHYTRYCPRIL--SQYFERRRSLVTAVASTGECFAVFAFAPAITALNDLIGWRCCLLMVGALQLNIVVCGSLLRPITIKPPDVAKSPAKGEALESAYMLENEQTLTSIDSIDSGVEVSTSPKNLPTGLKPARSP-----------EPPRERKETAERPEPEPLLDFSVLRNPSFICYALFGLFATLGFFAPSLYIIPLSLSLGIDRELSPYMLSAMAISEVFGRIGAGWILNKKPVRKIYIELAFVALLCVALLAFPFAWNFGGLMACSVFFGGMLGTVTGTHIPL--VAEDDIVGIDKMASGVGVYVFIQSVAGLAGPPLGGVLVDWTQNYGSAFYSCAAGMALGALFLAL 469          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Xenopus
Match: slc16a7 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:100127205])

HSP 1 Score: 137.502 bits (345), Expect = 1.603e-34
Identity = 110/447 (24.61%), Postives = 196/447 (43.85%), Query Frame = 3
Query:  222 TTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKK--RVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVI---LVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMA 1547
            T +    D GWGWV+VF SFIS   S     +  V   E  + +  S + + W+ SI++AV++   P++S L  ++  R V I G ++ ++   +  F + +  L +   V+ G G +    PS+ I+  +F KKR  A G+A+ GS       +P+ + L    GW+ +  ILG  +L   +  S                     + ++   P       K++ N                 +  + +  N  L    + K+  FL+Y+   V   I F AP +F    A   GI     +FL+S +   + + R   G +A  +  R    + ++  +L +G+  +      +Y  ++IY   +G    AF  +SSV+   L+DI G  +      L+   +   VLIGPP+ G++ D T +Y   + VCG  ++ + I +++ 
Sbjct:    7 TLQYTPPDGGWGWVVVFGSFISIGFSYAFPKAITVFFKEIQEIFNTSYSEIAWISSIMLAVMYAGGPISSILVNKYGSRPVVIGGGVLCSLAMISASFCNSVMQLYICIGVMGGFGLAFNLQPSLTIIGKYFFKKRPIANGLAMAGSPVFLSTLAPLNQFLFNQFGWRGSFLILGGLLLNCCVAGS-----------LMRPIGPKPVKKDIEKAP-------KDDEN--------------HKKKESVCQSINKYLD-LSLFKHRGFLIYLSGNVIMFIGFFAPIVFLAPYAKHMGIDQYSSAFLLSILAFVDMVARPTMGMVANTRFIRPRIQYFFSFAILYNGVCHLLCPLANDYTGLVIYAVFFGF---AFGMVSSVLFETLMDIVGAARFSSAVGLTTIVECCPVLIGPPLGGFLVDVTGNYKYMYFVCGVIVIIASIWLFIG 417          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Mouse
Match: Slc16a12 (solute carrier family 16 (monocarboxylic acid transporters), member 12 [Source:MGI Symbol;Acc:MGI:2147716])

HSP 1 Score: 177.563 bits (449), Expect = 6.994e-49
Identity = 116/454 (25.55%), Postives = 225/454 (49.56%), Query Frame = 3
Query:  234 NQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNF---DNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMK-NPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVN--RFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRKTK 1577
            +  D GWGW+IV   F+  + +  +     +   E+  ++    +   W+ SI+  +  L +PL S +  + S ++  + G ++++ GF    F + L  L LS  V+ G+GF+L Y P+I +V  +F ++++ A GIA+ GSG GTF+ +P+++LLI    W+  + ILG  +L L +C +        +++S   K+   +++ +D     P + L     E                    S   +   LL+S F ++  + +F+ Y  S +F    ++ PY      A+  G++  + +FL+S +G+ + +G + FG+L  ++ +   R+  Y   V L GL  +    ++ +  ++ ++  +G   GA+VTL  V+  +I G   L     +      +  L+ PPI G++ D+T SY  AF +CG  ++FS I++    + +  ++T+
Sbjct:   11 SPPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFAQDYSQTAWIHSIVDCMTMLCAPLGSVVSNQLSCQAGIMLGGLLASTGFILGSFATSLKHLYLSLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDRSVPEKNHNRESQREDCKQASPYSPLTKECTETRLCC---------------SLQQEYGFLLMSDFVVLAVSVLFMAYGCSPLFV---YLVPY------ALSVGVSHHQAAFLMSILGVIDIVGNITFGWLTDRRCLKNYRYVCYLFAVALDGLCYLCLPMLQTFPLLVPFSCTFGYFDGAYVTLIPVVTAEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGWLVDTTGSYTAAFLLCGFAMIFSSILLGFVRIVKRMKRTQ 440          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Mouse
Match: Slc16a6 (solute carrier family 16 (monocarboxylic acid transporters), member 6 [Source:MGI Symbol;Acc:MGI:2144585])

HSP 1 Score: 166.007 bits (419), Expect = 2.041e-44
Identity = 109/469 (23.24%), Postives = 215/469 (45.84%), Query Frame = 3
Query:  213 SRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELK-LLKNERN-----------AVXXXXXXXXXXXXXDDRSDMSKRSNLL-----------LSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILV--DIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYM 1544
            +R+       D GWGW +  + F   + + GI+ S+GV   + +  +  S + + W+ SI V V+   +PL++ L  RF +R V +AG ++ ++G     F   ++ + +S  V+ G+G+   +LP++ I++ +FDK+RS    +A  G  F  F F+P I  L   +GW++++  +G   L +++C +          R    +   +    +  EP  E++ +L+NE+             +        +E   +  +   ++  L+           L  F ++K   F+ Y    +FA + F AP L+     I  GI   + +FL+S++ I    GR+G G++  ++ + + ++  I V+L    L        +  +++ +  +G M G        +L   D+ G +K+     + +  Q IS L GPP+ G + D +  Y  AF  C   +  + + + +
Sbjct:   10 ARANVYTQVPDGGWGWAVAVSFFFVEVFTYGIIKSFGVFFNDLMDSFDESNSKISWIISICVFVLTFTAPLSTVLSNRFGHRLVVMAGGLLISLGMITASFSQRVYHMYISIGVISGLGYCFSFLPTVTILSQYFDKRRSVVTAVASTGECFAVFAFAPAITALKEHIGWRYSLLFVGLLQLNIMVCGA--------LLRPIIIQGPGQSPKAVTLEPRREVQYMLENEKTRTSIDSIDSGVELTTSPKNVPSEAKMEQETRAEQQQTLVTAPKHSQMKAPLLDFSVLKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDPDRAAFLLSTMAIAEVFGRIGAGFVLNREPIRKIYIELICVILLTASLFAFTFATEFWGLMLCSVFFGSMVGTIGGTHIPMLAEDDVVGIEKMSSAAGVYVFIQSISGLAGPPLAGLLVDQSKIYSRAFYSCAAGMCLAAVCLAL 470          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Mouse
Match: Slc16a6 (solute carrier family 16 (monocarboxylic acid transporters), member 6 [Source:MGI Symbol;Acc:MGI:2144585])

HSP 1 Score: 166.007 bits (419), Expect = 7.018e-44
Identity = 116/521 (22.26%), Postives = 226/521 (43.38%), Query Frame = 3
Query:   75 GNENQTRTQAFDENVDQNNENESQKMT--TNNENVETTADKDHEDASESRSTTKRNQ----KDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELK-LLKNERN-----------AVXXXXXXXXXXXXXDDRSDMSKRSNLL-----------LSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILV--DIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYM 1544
            G + +   +A            SQ M         ET   +       S+   + N      D GWGW +  + F   + + GI+ S+GV   + +  +  S + + W+ SI V V+   +PL++ L  RF +R V +AG ++ ++G     F   ++ + +S  V+ G+G+   +LP++ I++ +FDK+RS    +A  G  F  F F+P I  L   +GW++++  +G   L +++C +               +   +    +  EP  E++ +L+NE+             +        +E   +  +   ++  L+           L  F ++K   F+ Y    +FA + F AP L+     I  GI   + +FL+S++ I    GR+G G++  ++ + + ++  I V+L    L        +  +++ +  +G M G        +L   D+ G +K+     + +  Q IS L GPP+ G + D +  Y  AF  C   +  + + + +
Sbjct:   42 GPDPRGPARAHQAGPLLAGARRSQHMVGGAPPRPAETGCSRSRMTQKNSKLCARANVYTQVPDGGWGWAVAVSFFFVEVFTYGIIKSFGVFFNDLMDSFDESNSKISWIISICVFVLTFTAPLSTVLSNRFGHRLVVMAGGLLISLGMITASFSQRVYHMYISIGVISGLGYCFSFLPTVTILSQYFDKRRSVVTAVASTGECFAVFAFAPAITALKEHIGWRYSLLFVGLLQLNIMVCGALLRPI--------IIQGPGQSPKAVTLEPRREVQYMLENEKTRTSIDSIDSGVELTTSPKNVPSEAKMEQETRAEQQQTLVTAPKHSQMKAPLLDFSVLKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDPDRAAFLLSTMAIAEVFGRIGAGFVLNREPIRKIYIELICVILLTASLFAFTFATEFWGLMLCSVFFGSMVGTIGGTHIPMLAEDDVVGIEKMSSAAGVYVFIQSISGLAGPPLAGLLVDQSKIYSRAFYSCAAGMCLAAVCLAL 554          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Mouse
Match: Slc16a14 (solute carrier family 16 (monocarboxylic acid transporters), member 14 [Source:MGI Symbol;Acc:MGI:1919031])

HSP 1 Score: 159.073 bits (401), Expect = 5.030e-42
Identity = 115/488 (23.57%), Postives = 226/488 (46.31%), Query Frame = 3
Query:  150 MTTNNENVETTADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSS-----SYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLL-----------------------SYF---QMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISS-IGIGNCIGRVGFGYLATKKRV---NRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCG 1508
            M T++E++    + D + A   ++       D GW W++V +SF  H++  G   + GVL  E+++ +  SR    W+ S+ + +  ++ P           R  AI G +++++G+    + + +  L ++  V  G+G  + YLP++++V  +F K+R+ A G++  G+GFGTFL + +++ L    GW+  MFI G   L L +C +     S    +N  +  +         +++ +  P  +   ++ R      E +  +   ++ +     R N+                          YF    +  N +F+ +I   +FA  SF+ P++   +      ++    +F ++S I I +  G+V  G +A    +   N F + N T++LS  +L     +  Y ++ +  ++ G  +G F +L  V+  D+ G + L   + + +   GIS L+GPP  G+I+D T  YD +F +CG
Sbjct:    1 MYTSHEDIGYDLEDDRK-AKNKKTLKPHPDIDGGWAWMMVLSSFFVHILIMGSQMALGVLNVEWLEEFHQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAANVQSLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMFIQGALSLNLCVCGALMRPLSPEKLENCPEAEEPCALPAYSTESVKSGGPLGMAEEQDRRPG---NEEMVCDLQTQECQGQTHPRKNVCAFRVLKTVSQLTVQVRRGFRDWHSGYFGTASLFTNRMFVAFIFWALFAYSSFVIPFIHLPEIVSLYNLSEQNDTFPLTSIIAILHIFGKVILGAVADLPCISVWNVFLIANFTLVLSIFLLP---LMHTYASLAVICALIGFSSGYF-SLMPVVTEDLVGTEHLANAYGIIICANGISALLGPPFAGWIFDITQKYDFSFYICG 480          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Mouse
Match: Slc16a9 (solute carrier family 16 (monocarboxylic acid transporters), member 9 [Source:MGI Symbol;Acc:MGI:1914109])

HSP 1 Score: 150.599 bits (379), Expect = 5.316e-39
Identity = 127/481 (26.40%), Postives = 204/481 (42.41%), Query Frame = 3
Query:  231 RNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQD-----NLNTEPPNEL------------KLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYF--QMMKNP--IFLLYIGST-------VFAAISFIA----------PYLFTKDRAIQNGITASKGSF-LISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLS 1556
            +   D GWGWVIV  SF +  +S G   + GVL  E++  +   +    W+GS+   V  L SP+ S     F  R V I    +   G         ++FL  S  +V G+G  L+Y  ++ I   +FD +R  A+G+   GS  G F+++ +  +LI   G    + I+G   L ++ C S              K +     D     N   + P E             K L N                      +  K+  +  + F  Q+ K    ++  Y G T       VF+A+ FIA          P L  +D A    +     +  LIS  GI   +G++  G LA  K +N  +LY  T++++GL L      K+Y+ + I + I G +TG + ++   +     G DKL   + + + F G+   +GPPI+G+ YD T +YD+AF   G C++    I+ +A L 
Sbjct:    4 QKSPDGGWGWVIVVVSFFTQFLSYGSPLAVGVLYVEWLDAFGEGKGKTAWVGSLASGVGLLASPVCSLFVSSFGARPVTIFSGFLVAGGLMLSSLAPNIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDSRRGLALGLISTGSSVGLFIYAALQRMLIEFYGLDGCLLIVGALALNILACGSLMRPLQTSDCPFPEKTAPENVPDRYSMYNEKEKNPEETMNFQDKGYSSEDKCLPNGDWGRETSLPKSLAIAAHTKEPETYKKKVVEQTNFCKQLAKRKWQLYRNYCGETASLFKNKVFSAL-FIAILLFDIGGFPPSLLMEDVARSYHVREEDLTMPLISIFGIMTAVGKLLLGILADFKWINTLYLYVATLIITGLALCAIPFAKSYVTLAILSGILGFLTGNW-SIFPYVTTKTVGIDKLAHAYGILMFFAGLGNSLGPPIVGWFYDWTQTYDIAFYFSGFCVLLGGFILLLAILP 482          
BLAST of Monocarboxylate transporter, putative vs. UniProt/SwissProt
Match: sp|Q8BGC3|MOT12_MOUSE (Monocarboxylate transporter 12 OS=Mus musculus OX=10090 GN=Slc16a12 PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 4.892e-48
Identity = 116/454 (25.55%), Postives = 225/454 (49.56%), Query Frame = 3
Query:  234 NQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNF---DNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMK-NPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVN--RFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRKTK 1577
            +  D GWGW+IV   F+  + +  +     +   E+  ++    +   W+ SI+  +  L +PL S +  + S ++  + G ++++ GF    F + L  L LS  V+ G+GF+L Y P+I +V  +F ++++ A GIA+ GSG GTF+ +P+++LLI    W+  + ILG  +L L +C +        +++S   K+   +++ +D     P + L     E                    S   +   LL+S F ++  + +F+ Y  S +F    ++ PY      A+  G++  + +FL+S +G+ + +G + FG+L  ++ +   R+  Y   V L GL  +    ++ +  ++ ++  +G   GA+VTL  V+  +I G   L     +      +  L+ PPI G++ D+T SY  AF +CG  ++FS I++    + +  ++T+
Sbjct:   11 SPPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFAQDYSQTAWIHSIVDCMTMLCAPLGSVVSNQLSCQAGIMLGGLLASTGFILGSFATSLKHLYLSLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDRSVPEKNHNRESQREDCKQASPYSPLTKECTETRLCC---------------SLQQEYGFLLMSDFVVLAVSVLFMAYGCSPLFV---YLVPY------ALSVGVSHHQAAFLMSILGVIDIVGNITFGWLTDRRCLKNYRYVCYLFAVALDGLCYLCLPMLQTFPLLVPFSCTFGYFDGAYVTLIPVVTAEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGWLVDTTGSYTAAFLLCGFAMIFSSILLGFVRIVKRMKRTQ 440          
BLAST of Monocarboxylate transporter, putative vs. UniProt/SwissProt
Match: sp|D4A734|MOT12_RAT (Monocarboxylate transporter 12 OS=Rattus norvegicus OX=10116 GN=Slc16a12 PE=2 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 5.147e-48
Identity = 117/454 (25.77%), Postives = 225/454 (49.56%), Query Frame = 3
Query:  234 NQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSN---LLLSYFQMMK-NPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVN--RFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRKTK 1577
            +  D GWGW+IV   F+  + +  +     +   E+  ++    +   W+ SI+  +  L +PL S +  + S ++  + G ++++ G     F + L  L LS  V+ G+GF+L Y P+I +V  +F ++++FA GIA+ GSG GTF+ +P+++LLI    W+  + ILG  +L L +C +       K      +KS +      + +  +    L  E                 + R   S +     LL+S F ++  + +F+ Y  S +F    ++ PY      A+  G++  + +FL+S +G+ + +G + FG+L  ++ +   R+  Y   V L GL  +    ++++  ++ ++  +G   GA+VTL  V+  +I G   L     +      +  L+ PPI G++ D+T SY  AF +CG  ++FS I++  A +++  ++T+
Sbjct:   11 SPPDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFAQDYSQTAWIHSIVDCMTMLCAPLGSVVSNQLSCQAGIMLGGLLASTGLILGSFATSLKHLYLSLGVLTGLGFALCYSPAIAMVGKYFSRRKAFAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGALMRPITLKEDPSGPEKSHDRDAQREDCKQASPYSPLTKEWT---------------ETRLCCSLQQGYGFLLMSDFVVLAVSVLFMAYGCSPLFV---YLVPY------ALSVGVSHHQAAFLMSILGVIDIVGNITFGWLTDRRCLKNYRYVCYLFAVALDGLCYLCLPMLQSFPLLVPFSCTFGYFDGAYVTLIPVVTAEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGWLVDTTGSYTAAFLLCGFAMIFSSILLGFAKIAKRMKRTQ 440          
BLAST of Monocarboxylate transporter, putative vs. UniProt/SwissProt
Match: sp|Q6ZSM3|MOT12_HUMAN (Monocarboxylate transporter 12 OS=Homo sapiens OX=9606 GN=SLC16A12 PE=1 SV=3)

HSP 1 Score: 177.563 bits (449), Expect = 7.873e-48
Identity = 120/469 (25.59%), Postives = 226/469 (48.19%), Query Frame = 3
Query:  189 KDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKR-SNLLLSYFQMMK-NPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFH--LYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRKTKFQ 1583
            K     + +RST+     D GWGW+IV   F+  + +  +     +   E+  ++        W+ SI+  V  L +PL S +    S +   + G ++++ G     F + L  L L+  V+ G+GF+L Y P+I +V  +F ++++ A GIA+ GSG GTF+ +P+++LLI    W+  + ILG  +L L +C +               +     +D+   E  +  +  K +   V+   ++            + +  S LL+S F ++  + +F+ Y  S +F    ++ PY      A+  G++  + +FL+S +G+ + IG + FG+L  ++ +  +    Y   V + GL  +    +++   ++ ++  +G   GA+VTL  V+  +I G   L     +      +  L+ PPI G + D+T SY  AF +CG  ++FS +++  A L +  RKT+ Q
Sbjct:   29 KTMAKVNRARSTSP---PDGGWGWMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVTMLCAPLGSVVSNHLSCQVGIMLGGLLASTGLILSSFATSLKHLYLTLGVLTGLGFALCYSPAIAMVGKYFSRRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVLNLCVCGA-------------LMRPITLKEDHTTPEQNHVCRTQKEDIKRVSPYSSLTKEWAQTCLCCCLQQEYSFLLMSDFVVLAVSVLFMAYGCSPLFV---YLVPY------ALSVGVSHQQAAFLMSILGVIDIIGNITFGWLTDRRCLKNYQYVCYLFAVGMDGLCYLCLPMLQSLPLLVPFSCTFGYFDGAYVTLIPVVTTEIVGTTSLSSALGVVYFLHAVPYLVSPPIAGRLVDTTGSYTAAFLLCGFSMIFSSVLLGFARLIKRMRKTQLQ 472          
BLAST of Monocarboxylate transporter, putative vs. UniProt/SwissProt
Match: sp|Q6P2X9|MOT12_XENTR (Monocarboxylate transporter 12 OS=Xenopus tropicalis OX=8364 GN=slc16a12 PE=2 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 3.245e-46
Identity = 109/457 (23.85%), Postives = 212/457 (46.39%), Query Frame = 3
Query:  207 SESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKK--RVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRK 1571
            ++ +    +   D GWGW+IV   F   + +  +     +   E+  ++        W+ SI+     L +P+ SY+   FS +   I G ++++ G     F + L +L L+  V+ G+GF+L Y P+I +V  +F+K+++ A GIA+ GSG GTF+ +P+++LLI    W+  + ILG  +  L +C +               +     +D+L+      LK  + E                  D S   +        +  +  P F++   S +F A     P+++    A+  G++  + +FL+S +GI + +G + FG++   +  + +R+  Y I V L GL  +    +  +  ++ ++ ++G   GA+V L  V+  D+ G   L     +      +  L+ PPI G++ D+T  Y  AF + G  ++F  +++ +A +    +K
Sbjct:    2 TQEKRNLHKAPPDGGWGWMIVIGCFFVTVCTRAVTRCISIFFVEFQSYFAQDYARTAWIHSIVDCSTMLCAPIGSYVSNHFSCQVGIILGGVLASTGLVLSSFATSLEYLYLTLGVLTGLGFALCYSPAIAMVGKYFEKRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGA-------------LMRPITLKEDSLH----YPLKQEQMENEPTQSGRLDSSCSPLCQDCSH-KRLCYCTKKEYSFLLKPKFMVLAVSFLFLAYGCSPPFVYLVPYALNVGVSNQEAAFLMSILGIIDIVGNITFGWVTDTRFLKKHRYCCYLIAVGLDGLCCLFLPILTRFQLLVPFSVMFGYFDGAYVALIPVVTGDVVGTSSLSSALGVVFFLHAVPYLVSPPIAGWLVDTTGDYTAAFLLSGFSMIFCAVLLALAKIINRIKK 440          
BLAST of Monocarboxylate transporter, putative vs. UniProt/SwissProt
Match: sp|Q6GM59|MOT12_XENLA (Monocarboxylate transporter 12 OS=Xenopus laevis OX=8355 GN=slc16a12 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 6.593e-46
Identity = 110/457 (24.07%), Postives = 214/457 (46.83%), Query Frame = 3
Query:  207 SESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKK--RVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRK 1571
            ++ + +  +   D GWGW+IV   F   + +  +     +   E+  ++        W+ SI+     L +P+ SY+   FS +   I G ++++ G     F + L +L L+  V+ G+GF+L Y P+I +V  +F+K+++ A GIA+ GSG GTF+ +P+++LLI    W+  + ILG  +  L +C +               +  +  +D+L+     E +L                      D S   K        +  +  P F++   S +F A     P+++    ++  G++  + +FL+S +GI + +G + FG++  ++  + +R+  Y I V L GL  +    +  +  ++ ++ ++G   GA+V L  VI  D+ G   L     +      +  L+ PPI G++ D+T  Y  AF + G  ++F  I++ +A +    +K
Sbjct:    2 TQEKRSLHKTPPDGGWGWMIVIGCFFVTVCTRAVTRCISIFFVEFQSYFAQDYARTAWIHSIVDCSTMLCAPIGSYVSNHFSCQVGIILGGVLASTGLVLSSFATSLEYLYLTLGVLTGLGFALCYSPAIAMVGKYFEKRKALAYGIAMSGSGIGTFILAPVVQLLIEQFSWRGALLILGGFVSNLCVCGA-------------LMRPISLKEDSLHYPLKREPQL-------------DSSCSPLCQDCSH-KKLCYCTTKEYHFLLKPKFIILAVSFLFLAYGCSPPFVYLVPYSLSVGVSHQEAAFLMSILGIVDIVGNITFGWVTDRRFLKKHRYCCYLIAVGLDGLCCLFLPILTCFQLLVPFSVMFGYFDGAYVALIPVITGDVVGTSNLSSALGVVFFLHAVPYLLSPPIAGWLVDTTGDYTAAFLLSGFSMIFCSILLGLAKIINRIKK 431          
BLAST of Monocarboxylate transporter, putative vs. TrEMBL
Match: A0A0H3YIZ7 (Slc16a-6 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc16a-6 PE=2 SV=1)

HSP 1 Score: 803.127 bits (2073), Expect = 0.000e+0
Identity = 397/527 (75.33%), Postives = 454/527 (86.15%), Query Frame = 3
Query:    3 TPVTSCLYEVVNSHETDADINYRSGNENQTRTQAFDENVDQNNENESQKMTTNNENVETTADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPN-ELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRKTKF 1580
            TPVTSCLYEVVNSHETDADINYRSGNENQTRTQAFDENVDQNNENESQKMTTNNENVETTADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTF+FSP IE L+T  GW+  M I G+ IL+L +CS+SY NF++ +   + +  KNE    +N +  + EL L   + + VN+EE +     + +           L SY +M+KNP+F++++ S+VF++I+F APY+F KDRAIQ+GI+ S+GSFLISSIGIGNC GRVGFGYLAT KRVNRFH+YNITV+LSGL L+ SWG+K YI MI YT IYGMM+GAFVTLSSV+LVD+FGEDKL+ TFAL+L  QG++VLIGPPI+G+IYD+TLS++VAFAVC  C+VFSR+ MY+AY+ + FRK KF
Sbjct:    1 TPVTSCLYEVVNSHETDADINYRSGNENQTRTQAFDENVDQNNENESQKMTTNNENVETTADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFMFSPFIEFLLTKGGWQQAMLITGSLILVLALCSASYCNFESVNSTSEVEAVKNE----INEKNEHVELSLFSRQMSNVNVEECVDKPGEHLEKVETSDNHLFSLRSYVEMLKNPVFIIFLISSVFSSIAFNAPYMFAKDRAIQSGISDSRGSFLISSIGIGNCFGRVGFGYLATMKRVNRFHIYNITVVLSGLALLVSWGMKMYILMIGYTFIYGMMSGAFVTLSSVVLVDMFGEDKLDVTFALTLSVQGLAVLIGPPIVGFIYDATLSFNVAFAVCEACLVFSRVFMYLAYVFKSFRKIKF 523          
BLAST of Monocarboxylate transporter, putative vs. TrEMBL
Match: A0A0H3YJ01 (Slc16a-11 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc16a-11 PE=2 SV=1)

HSP 1 Score: 509.605 bits (1311), Expect = 1.011e-173
Identity = 252/494 (51.01%), Postives = 341/494 (69.03%), Query Frame = 3
Query:  132 ENESQKMTTNNENVETTADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTE----------PPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRKTKFQ 1583
            EN+ + +  +NEN+E   ++ H               D GWGW++VFAS I+ L+SDG++YSYGVLT E+IKHY +SR TVGWMGSILVA    + PL S LC++  YR   + G+II+ + F+ PYFYSELWFLIL SSV+CGIGF L+YLPSI+IVN+WFDKKRS A+GIAVCGSG GTF+ SP++E LI+T GW+  M ++G  +L+++ C  +Y+N  +     + +  +N    N NT           P NE + L N+                 ++     ++     S+ +MMK+ IF+L++ S + ++I F APY++ KDRAI  G++ SKGSFLISSIGIG+CIGR+GFGYLAT K VNRFHL+N T++LSG+ LI SW + +YI+MIIYT I+GMM GAFVTL+SVIL+D+FG   ++  F+++L  QGISVL+GPPI G+IYDSTLSY+V FA CGGCI  S +IMY+AY S+DFRK  F+
Sbjct:    1 ENKLKTVANDNENIEINKEQVHIP-----------PPDGGWGWMVVFASLIASLLSDGVIYSYGVLTPEFIKHYNLSRTTVGWMGSILVATALAVGPLASILCKKLGYRVCGVIGSIIAAISFSLPYFYSELWFLILCSSVLCGIGFGLVYLPSIIIVNVWFDKKRSLAMGIAVCGSGLGTFVMSPLMEYLISTFGWQLAMLVIGLILLLMIPCCMTYTNVKS-KSLIEKEAERNAMDSNDNTMSATECEKIEIPSNEGEYLMNKYGIGTNYTTECEIIQIPEETEQCEEKK----SFIEMMKDFIFILFLLSNILSSIGFNAPYMYAKDRAILQGMSDSKGSFLISSIGIGSCIGRIGFGYLATFKFVNRFHLFNATIVLSGVSLIASWIMTSYISMIIYTLIFGMMGGAFVTLTSVILIDLFGLINVDTAFSITLVVQGISVLVGPPIAGFIYDSTLSYNVPFAACGGCIALSGVIMYLAYFSKDFRKKTFK 478          
BLAST of Monocarboxylate transporter, putative vs. TrEMBL
Match: A0A0H3YJ05 (Slc16a-16 OS=Schmidtea mediterranea OX=79327 GN=slc16a-16 PE=2 SV=1)

HSP 1 Score: 391.349 bits (1004), Expect = 6.174e-128
Identity = 200/471 (42.46%), Postives = 291/471 (61.78%), Query Frame = 3
Query:  186 DKDHE-----DASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRKTKFQ 1583
            +KD E     + +E+R    R   D GWGWV+VFA+ +S  + DG+ YSYGVLTTE+I H+ +SR T+G MGS+L+ +     P+  YLC+++ YR V I G  IS++ F AP+FY+ELWFL L+SS++ GIGF +IYL  ++IVN +F+K+R  A+GIAVCGSG GTF+F P+I+ LI   GW+  M I G  +  L+ C   +              + NE   NLN +  N +K                                N +    ++  NPIF+LY  S  F+ + F AP+++ KDRAI  GI A K SFL+SS+GIGN  GR+ FG++AT++  N FHLYN ++++ G  LI SWG+ +Y +MI+YT I+G+M G++VT++S++LV++FG + L   F L    QG++V IGPP+ GYIYDST S++ AF  CGG +  + ++MY+AY  + FRK+  Q
Sbjct:   14 EKDSEINIEIEVNETRVNVAR-PPDGGWGWVVVFAALVSSALFDGVTYSYGVLTTEFIDHFDVSRTTIGLMGSLLIGMTLCPGPIVGYLCKKYGYRFVMILGGSISSISFMAPFFYAELWFLFLTSSLLTGIGFGMIYLTCVVIVNNYFEKRRGLAVGIAVCGSGLGTFIFGPLIQFLIELYGWRGAMLIAGGILFNLIPCGLLFQKLPT--------HTLNE-ASNLNKKKENSIK--------------------------------NTIKLVLKLFSNPIFILYGLSNFFSCVGFNAPFIYVKDRAITAGIPAIKASFLLSSMGIGNFFGRIAFGFIATRELFNGFHLYNASLIICGATLICSWGVTSYASMIVYTLIFGVMAGSYVTMTSIVLVELFGLNDLGLLFGLINICQGVAVFIGPPLAGYIYDSTHSFNAAFLFCGGFLSIAGLMMYIAYFFKGFRKSHCQ 442          
BLAST of Monocarboxylate transporter, putative vs. TrEMBL
Match: A0A0H3YJ62 (Slc16a-24 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc16a-24 PE=2 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 1.358e-112
Identity = 199/418 (47.61%), Postives = 277/418 (66.27%), Query Frame = 3
Query:  291 LISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEP---PNELKLLKNERNAVXXXXXXXXXXXXXDD-RSD--------MSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCG 1508
            +I+DGIV+SYG+LT EYI ++ ISR T   +GSILV +   ++P+  YL   F +R V++ G+++S +GF  PY Y ELWF++L++SV+CGIGF LIYLPSI IVN+WF+  +  AIGIAV GSG GTF FS I E L   VG K+TM I G  +L+L+ CS  Y                   QDN N+      N ++L+ +ERN            N+ +  RS+        +SK S    S ++++KNPI LL + S V + I F +PY+FTK+RAI  G+  ++  FLIS+IG+G C+GRVGFGYLAT K VNRFHLYN+++++SGL+L  +    N+I ++ YT+IYG++TG+FVTL+SVIL+DIFG+D  +K FALSL  QG++ LIGPPII  +Y  T S+D+AF +CG
Sbjct:    1 MITDGIVFSYGILTKEYISNFGISRLTASLIGSILVGLTLSLAPIAYYLSVIFDHRIVSLIGSLLSIIGFTIPYLYHELWFVVLNTSVLCGIGFGLIYLPSIAIVNVWFENVKPLAIGIAVSGSGLGTFAFSLIFEYLPIIVGLKYTMLITGGILLLLLPCSLIYRPIP--------------CQDNENSTRNTLENCIELMIDERNCEENYLENSCGMNSVNTGRSNKFQIPQTVISKES----SMYELLKNPIILLLLFSNVLSGIGFNSPYVFTKERAILLGVPVNESKFLISTIGLGTCLGRVGFGYLATLKVVNRFHLYNVSLVISGLILAMTRWTNNFIFIVSYTTIYGIVTGSFVTLTSVILLDIFGKDNAQKAFALSLVSQGLAALIGPPIIALMYAKTQSFDLAFTICG 400          
BLAST of Monocarboxylate transporter, putative vs. TrEMBL
Match: A0A0R3U4H9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1556 PE=4 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 3.244e-74
Identity = 165/510 (32.35%), Postives = 249/510 (48.82%), Query Frame = 3
Query:  126 NNENESQKMTTNNENVETTADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGS-----------------GFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNE--GQDNLNTEPPNELKLLKNE------------------------------RNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYF----------QMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLA-TKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTG--AFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYD 1469
            N  N  Q+ +    N   TA K +    E          D GWGWV+VFASF+ H + DG+ YS+GV TT+ ++HY ISR +VGW+ SILV V  +  PL S LC  + +R+ AI G +++  G AA +F+S L FL+  +SV CG G  L YLP+I IV+ +F  KR+ A+G+AVCGS                   GTF+F+P++  LI    W+  M +    +L   +C + +    +     + +  K       + N E P    L  NE                              R  V+   + +            +KR +   S F           ++KNP F+++  S    ++ F AP+LF  DRA   G+  +   FL++SIGIGN +GRV  G LA T+ R  R HLY  +++L G++   S   + Y  M+ Y   +G + G  ++VTL  V LVD+ G + LE++  LSL   G+++ IGPP+ G + +
Sbjct:   18 NRHNNRQQPSGEGSNHPATASKANPAGHE-------GAPDGGWGWVVVFASFLVHFLVDGLAYSFGVFTTDLVEHYDISRQSVGWINSILVGVTHISGPLASRLCEAYGFRATAITGGVVAATGLAAVFFFSSLPFLVTMASVCCGHGCGLAYLPAICIVSEYFTGKRALAVGLAVCGSGIGGQSGIYLTVSFVIFAPGTFVFAPLMSHLIRIYSWRGAMLLEAGLVLNCCVCGALFRPLKSPGHEMELRLRKPHPLSASSYNLEGPPSASL--NEEGETTSYQTAGGSASTPRQVVNYIIFRFLTRKPVSAYNSEKPIRRQLSHDQPHAKRQSACRSRFHESLRSVLSLHLLKNPAFIVFAVSNFLTSLGFNAPFLFVMDRATLMGVDEASAGFLVASIGIGNTLGRVVVGVLAMTRHRKLRLHLYTGSLVLCGVITAMSCWAQRYPLMVAYAVAFGFLCGKRSYVTLFPVTLVDLVGIEFLEESLGLSLLVMGVAIFIGPPVAGTLQN 518          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Cavefish
Match: slc16a12b (solute carrier family 16 member 12 [Source:NCBI gene;Acc:111192338])

HSP 1 Score: 180.259 bits (456), Expect = 6.392e-50
Identity = 113/442 (25.57%), Postives = 207/442 (46.83%), Query Frame = 3
Query:  204 ASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEP-----PNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFH--LYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCG 1508
            A E +        D GWGW+IV   F+  + +  +     +   E+  H+    +   W+ S++     L +PL S +    S R   I G  ++++G     F + L +L LS  V+ G+GF+L Y P+I +V ++F +++S A GIA+ GSG GTF+ +P++++LI    W+  + ILG  +  L +C +       K +        +E     +T+P     P E K L+ ER+                 + D  +R    +  +  +  P FL+  GS +F A     P+++    A+  G++    +FL+S +G+ + +G + FG+L  ++ + ++    Y + V + GL       +  +  ++ ++ +YG   GA+V L  V+  D+ G   L     +      I  L+ PPI G++ D+T +Y   F + G
Sbjct:    2 AQERKKKAGVLPPDGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFARDYSGTAWIHSLVDCTTMLCAPLGSLIGNHLSCRVAVILGGFLASIGLVLSSFATSLEYLYLSLGVLTGLGFALCYTPAIAMVGIYFCERKSLAYGIAMSGSGIGTFILAPVVQMLIEHYSWRGALLILGGLVSNLCVCGALLRPITLKEEEACPLPVDSEC--GYSTKPLVAISPAEEKQLEAERS---------------KQQRDSKQRCLQSMQEYHFLLMPDFLVLAGSFLFLASGCSLPFVYLVPYALDVGVSHHHAAFLMSILGVIDIVGNITFGWLTDRRCLKKYRGICYMVAVGMEGLCCFLIPLLHTFALLVPFSVLYGYFDGAYVALIPVVTSDVVGTTYLSSALGVVYFLHAIPYLVSPPIGGWLVDTTGTYTATFFLSG 426          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Cavefish
Match: slc16a12b (solute carrier family 16 member 12 [Source:NCBI gene;Acc:111192338])

HSP 1 Score: 178.718 bits (452), Expect = 1.527e-49
Identity = 113/442 (25.57%), Postives = 207/442 (46.83%), Query Frame = 3
Query:  204 ASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEP-----PNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFH--LYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCG 1508
            A E +        D GWGW+IV   F+  + +  +     +   E+  H+    +   W+ S++     L +PL S +    S R   I G  ++++G     F + L +L LS  V+ G+GF+L Y P+I +V ++F +++S A GIA+ GSG GTF+ +P++++LI    W+  + ILG  +  L +C +       K +        +E     +T+P     P E K L+ ER+                 + D  +R    +  +  +  P FL+  GS +F A     P+++    A+  G++    +FL+S +G+ + +G + FG+L  ++ + ++    Y + V + GL       +  +  ++ ++ +YG   GA+V L  V+  D+ G   L     +      I  L+ PPI G++ D+T +Y   F + G
Sbjct:    2 AQERKKKAGVLPPDGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFARDYSGTAWIHSLVDCTTMLCAPLGSLIGNHLSCRVAVILGGFLASIGLVLSSFATSLEYLYLSLGVLTGLGFALCYTPAIAMVGIYFCERKSLAYGIAMSGSGIGTFILAPVVQMLIEHYSWRGALLILGGLVSNLCVCGALLRPITLKEEEACPLPVDSE--CGYSTKPLVAISPAEEKQLEAERS---------------KQQRDSKQRCLQSMQEYHFLLMPDFLVLAGSFLFLASGCSLPFVYLVPYALDVGVSHHHAAFLMSILGVIDIVGNITFGWLTDRRCLKKYRGICYMVAVGMEGLCCFLIPLLHTFALLVPFSVLYGYFDGAYVALIPVVTSDVVGTTYLSSALGVVYFLHAIPYLVSPPIGGWLVDTTGTYTATFFLSG 426          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Cavefish
Match: slc16a12b (solute carrier family 16 member 12 [Source:NCBI gene;Acc:111192338])

HSP 1 Score: 169.859 bits (429), Expect = 1.814e-46
Identity = 108/425 (25.41%), Postives = 197/425 (46.35%), Query Frame = 3
Query:  204 ASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEP-----PNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFH--LYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIG 1457
            A E +        D GWGW+IV   F+  + +  +     +   E+  H+    +   W+ S++     L +PL S +    S R   I G  ++++G     F + L +L LS  V+ G+GF+L Y P+I +V ++F +++S A GIA+ GSG GTF+ +P++++LI    W+  + ILG  +  L +C +       K +        +E     +T+P     P E K L+ ER+                 + D  +R    +  +  +  P FL+  GS +F A     P+++    A+  G++    +FL+S +G+ + +G + FG+L  ++ + ++    Y + V + GL       +  +  ++ ++ +YG   GA+V L  V+  D+ G   L     +      I  L+ PPI G
Sbjct:    2 AQERKKKAGVLPPDGGWGWMIVAGCFVVTVCTRAVTRCISIFFVEFQMHFARDYSGTAWIHSLVDCTTMLCAPLGSLIGNHLSCRVAVILGGFLASIGLVLSSFATSLEYLYLSLGVLTGLGFALCYTPAIAMVGIYFCERKSLAYGIAMSGSGIGTFILAPVVQMLIEHYSWRGALLILGGLVSNLCVCGALLRPITLKEEEACPLPVDSE--CGYSTKPLVAISPAEEKQLEAERS---------------KQQRDSKQRCLQSMQEYHFLLMPDFLVLAGSFLFLASGCSLPFVYLVPYALDVGVSHHHAAFLMSILGVIDIVGNITFGWLTDRRCLKKYRGICYMVAVGMEGLCCFLIPLLHTFALLVPFSVLYGYFDGAYVALIPVVTSDVVGTTYLSSALGVVYFLHAIPYLVSPPIGG 409          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Cavefish
Match: slc16a9a (monocarboxylate transporter 9-like [Source:NCBI gene;Acc:103027375])

HSP 1 Score: 170.629 bits (431), Expect = 2.082e-46
Identity = 126/456 (27.63%), Postives = 213/456 (46.71%), Query Frame = 3
Query:  243 DQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYS--NFDNXXXXXXXXXXXNEGQ---------DNLNTE------PPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSF-LISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLS 1556
            D GW WVIV ASF++ L++ G   S GVL  E++  +   + T  W+GS++  V  + SPL S     F  R V I   ++   G     F   + FLI S  +V G+G  L+Y  ++ I   +FDK+R  A+GI   G+  G FL++ +   LI   G    + I+G   L L+ C+      N      + K+     +G          D+  TE      P  EL L+  E      E            R  +  +   L +  +  ++  F  +  S    ++    P LF +D A   G+        L+S + +   +G++  G L   + V+   LY +TV+ +G+ L+   G K+Y+ + + ++  G  +G + +L+S I   I G ++L +   + + F G  +++GPP++G+ YD T SYD+AF   G C+V   +I+++A L 
Sbjct:    6 DGGWSWVIVLASFMAQLLAFGSPQSVGVLYPEWLNAFHEGKGTTAWVGSLVSGVALIASPLCSACVDNFGARPVTIFSGVMVAGGLMLSAFAPNVSFLIFSYGIVVGMGCGLVYAATLTITCQYFDKRRGLALGIVTTGTSAGGFLYATVQNELIELFGLDGCLLIVGALALNLMACAGPMRPLNLPGYYLKQKAALEHKDGPLYEKPIVIIDSSATESSAHKSPVKEL-LISMETGEPGAEPVCTQVVRVIKRR--LRPQVEYLHTMGEYFQDRTFTAFCISLFLFSLGAFPPVLFMEDVAQSEGLIEHVAIIPLVSIVALATGVGKLILGALVDMRWVSGLLLYALTVVGTGVALLLVPGWKSYLGLQVLSAALGFFSGNW-SLTSYITTRIVGIERLSQAHGVLMCFGGFGIMLGPPVVGWFYDWTQSYDLAFYFSGCCVVLGGLILFLAALP 457          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Cavefish
Match: slc16a12a (uncharacterized LOC103025054 [Source:NCBI gene;Acc:103025054])

HSP 1 Score: 151.754 bits (382), Expect = 5.567e-40
Identity = 117/440 (26.59%), Postives = 202/440 (45.91%), Query Frame = 3
Query:  240 KDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKK--RVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYL 1553
             D GWGW+IV   FI+ + +  +     +   E+  H+    +   W+ S++     L +PL SY+  RFS R   + G ++S++G     F S L +L LS  ++ G+GF+L Y P++ +V  +F ++++ A GIA+ GSG GTF+ +P+++LLI    W+  + ILG     L +C +               +  N  + N + E   E    K                          + S LL+  F ++      L  G +V        P+++    ++  G++  + + L+S +G+   +G + FG+++ ++  R  R   Y + V L GL  +    + N+  ++ ++  YG   GA+V L  V+  D  G   L     +      I  LI PPI G++ D T SY  AF +CG    FS I   ++YL
Sbjct:   12 PDGGWGWMIVAGCFITTICTRAVTRCVSIFFLEFQMHFSSDYSRTAWIHSLVDCTTMLCAPLGSYIGNRFSCRVAVMVGGLLSSLGLILSSFASSLEYLYLSLGILTGLGFALCYTPAVAMVGSYFSERKALAYGIAMSGSGIGTFVLAPVVQLLIELYSWRGALLILGGFASHLCVCGA-------------LMRPLNRHRQNQDGEGREEEYCCK--------------------------EYSFLLIPDFLLLSVSFLFLAFGCSV--------PFVYLVPYSLSIGVSHQQAALLMSFLGVMGIVGNITFGWISDRRCLRAYRIVSYLLAVGLEGLSCLFVPLLWNFSLLLPFSLFYGYFDGAYVALLPVVTSDTVGPTYLSSALGVVCFLHAIPYLISPPIAGWLVDQTGSYTAAFLLCG----FSIICTILSYL 400          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001631.1 (pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 gene:ENSPMAG00000001470.1 transcript:ENSPMAT00000001631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.155 bits (409), Expect = 2.044e-44
Identity = 118/438 (26.94%), Postives = 206/438 (47.03%), Query Frame = 3
Query:  231 RNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYM 1544
            +   D GWGW+IV A+F+   +  G+V S GV   E+ ++++ S   + W+ SI + V    SP+ S L  +F  RSV I G I + +GF    F   L  L LS  ++ G G+++++ PSI  ++ +FDK+RS A+GIA  G G  +F FSP+ ++L+ T  W+  + IL    L L +C +                        L      E  L + E  A                RS  + +    L    ++K+  F+++  S  F    F  PY+         G ++  G+F+IS++ + + + R+  G+LA  +R+   HL+    L +G++++     + Y  MI+   +YG  +GA   +   +L  I G  ++       +  + +  L+GPPI G++ D T  Y ++F   G  I+   +++ M
Sbjct:    5 QQAPDGGWGWLIVLAAFVQVSLVFGVVRSVGVFFIEFTEYFQESSTAISWITSIALCVHQFASPIASTLSNQFGSRSVVIVGGISACIGFLCASFAHCLLHLYLSLGLLTGFGWAMVFSPSISTLSKYFDKRRSLALGIAFSGVGMSSFAFSPLFQMLVETYTWRGALMILAGLELNLCVCGA-----------------------LLRPIRLREDDLFQTENAA--------------KHRSLTTLKKLHALLDLDLLKHRGFMVFTLSFTFINTGFFIPYVHLLAHLQMLGFSSLSGAFVISAVAVADIVARLFSGWLADLRRIPMVHLFFFWTLTTGIIIVIIPFGQTYTDMIVIGIVYGFASGAMAPIGVSLLSKIVGIARITSAIGFLMLLESVGSLLGPPISGFLKDYTGDYTMSFIASGLVIILGCLVLPM 405          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 154.451 bits (389), Expect = 9.399e-42
Identity = 110/437 (25.17%), Postives = 191/437 (43.71%), Query Frame = 3
Query:  222 TTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPII-ELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKK--RVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVF 1523
            TT     D GWGWV+V + F     +  I     +   E+ +H+    +T  W+ SI+     L +P+ S L  RF  R+  + G ++S+ GF    F   + FL L   ++ G+GF+L Y PSI IV+ +F + R  A G+A+ G+G GTF+ +P++ +LLI    W+  + +LG  +  L +C +      + +          + Q      P +  KL                       +S M+  S +       +  P  L+   S    A   I P ++    A   G    + +FL+S +G+ + +G V + +L  ++  R  R H Y   V L G   +    ++++  ++ + ++YG   GA   L  V++ D+           L      +  L+GPP  G++ D T  Y+ AF + G  I+ 
Sbjct:    7 TTFPKPPDGGWGWVVVCSCFTVTACTRAITRCIPIFFVEFQQHFSKDTSTTAWINSIMDCTTMLFAPIGSLLSTRFGCRATVMFGGLVSSSGFIIASFSPTIEFLYLFLGLMAGLGFALCYSPSIAIVSRYFQRHRLLATGLAMSGNGVGTFVLAPVVQQLLIEVYAWRGALLLLGAFVAQLCVCGALLRPLASPATPTAKPGLLGK-QPAETAMPLDHYKLFCKV-------------------KSFMTFESQV------PIIRPELLVLCLSVSLLAYGCITPLVYLVPFAHSVGTPERQAAFLLSLLGVMDIVGTVTYSWLIDRECLRSRRAHCYCAAVGLYGACALALPAMRSFPLLVAFAALYGYFNGACTPLIPVLVADLVEPAGASTAIGLIYAMHALPYLLGPPTAGWLVDLTADYNAAFFLSGAIIML 417          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Sea Lamprey
Match: zgc:165507 (solute carrier family 16 member 7 [Source:HGNC Symbol;Acc:HGNC:10928])

HSP 1 Score: 149.058 bits (375), Expect = 1.787e-39
Identity = 113/449 (25.17%), Postives = 195/449 (43.43%), Query Frame = 3
Query:  219 STTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKH----YKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRF--HLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMA 1547
            +T      D GWGW +V  +FIS     G  Y++    T + K     +  + + + W+ SI++AV++   P++S L  ++  R + IAG I++  G  A  F + ++ L     V+ G+G +    P++ I+  +F KKR  A GI++ GS  G    +P+ ++LI   GW+ +  IL   +    +  S          +   KK K E  +NL     N L    N                 +D   D      + L    + K+  FL+Y+   V     F AP +F    A   GI     +FL+S +   + + R   G LA   R+     + ++  V  +G   +      +Y  ++IY + +GM  G    +    L+D+ G  +      L    +   VL+GPPI G++ D T  Y   + VCG  ++ + I +++A
Sbjct:    7 ATEGYTPPDGGWGWAVVVGAFIS----IGFSYAFPKAITVFFKDIQEIFHTTYSEIAWISSIMLAVMYAGGPISSILVNKYGSRPIVIAGGILAGTGMIAASFCNTIFQLYFCIGVIGGLGLAFNLQPALTIIGKYFYKKRPIANGISMAGSPVGLSTIAPLNQVLINNFGWRGSFLILAALLFNCCVAGSLMRPVGPTPAKDARKKGKEEVPNNLE----NPLLATSNSE--------------AKDKNGDSFSSRFMQLLDLTLFKHRGFLIYLSGNVIMFFGFFAPVVFLAPYAKHMGIENYSAAFLLSVMAFVDMVARPTTGLLANHPRIRPKIQYFFSFAVFFNGFCHVMCPFASDYTGLVIYAAFFGMAFGMVSAMLFETLMDLVGAQRFSSAVGLVTIVECCPVLLGPPIGGWLVDVTGDYKYMYYVCGAIVMVAGIYLFIA 433          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Sea Lamprey
Match: si:ch211-234h8.7 (si:ch211-234h8.7 [Source:ZFIN;Acc:ZDB-GENE-061009-16])

HSP 1 Score: 145.591 bits (366), Expect = 4.080e-38
Identity = 118/440 (26.82%), Postives = 197/440 (44.77%), Query Frame = 3
Query:  237 QKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRF--HLYNITVLLSGLV-LIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMA 1547
              D GWGWV++F  F+    S     +  V   E I  + +  +   W+ SIL+A+++   PL S L  RF  R V + G ++++ G     F + +  L L++ V+ G+G +L + PS++++  +F+K+R  A G+A  GS       SP+ ++L+ + GW+    ILG  +L    C +                            PP E     +  + V    +     + E   S   K+   LL  F + KN  F++Y  +     I    P +F    A   GI  +K +FL+S IGI +   R   G LA  +RV  +  +L+   +L +G   L+GS+G   Y  +  +   +G+  G    L   +L+ I G         L L  +  +VLIGPP  G + D+T +Y +   + G  +  S I+M +A
Sbjct:   16 PPDGGWGWVVLFGCFVITGFSYAFPKAISVFFKELINEFDVGYSDTAWLSSILLAMLYGSGPLCSILVNRFGCRPVMLGGGLLASFGMILASFCTNIIMLYLTAGVITGMGLALNFQPSLIMLGRYFNKRRPLANGLAAAGSPVFLTTLSPLGQMLVKSYGWRGGFLILGGLLLNCCACGAVMRPL----------------------VPPKE-----DAGSGVAESPSPGTAPHRETPVSPKKKQKKNLLD-FSVFKNKGFVIYAVAASIMVIGLFVPPVFIVSYAKDMGIEDTKAAFLLSIIGIIDIFARPLCGILAGVERVRPYITYLFCFAMLFNGFADLMGSFG-NTYGGLATFCVFFGISYGMVGALQFEVLMAIVGSHVFSSAIGLVLLCEACAVLIGPPSAGRLVDATKNYKLTLYMAGTLVTISGIVMGVA 426          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 119.783 bits (299), Expect = 4.789e-29
Identity = 57/182 (31.32%), Postives = 99/182 (54.40%), Query Frame = 3
Query:  234 NQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSS 779
               D GWGW++V A FI ++ +  +     +   E+  H++    T  W+ S++  +  L +P+ S L   F  R+  +AG + S+ GF    F + +  L +   V  G GFSL Y PSI++V  +F ++R+ A G+A+ GSG GTFL +P+++ L+    W+  + +LG  +  L +C +
Sbjct:    4 QPPDGGWGWMVVLACFIVNVCTRAVTRCISIFFMEFQSHFQKDYATTAWINSMVDCLTMLCAPIGSLLSSHFGCRATVMAGGLFSSAGFIMASFATSIEMLYVFLGVFAGFGFSLCYSPSIVMVTKYFRRRRALATGLAMSGSGVGTFLLAPLVQYLLDVFSWRGALLLLGAFVSNLCVCGA 185          

HSP 2 Score: 74.3294 bits (181), Expect = 2.340e-14
Identity = 45/174 (25.86%), Postives = 86/174 (49.43%), Query Frame = 3
Query: 1020 FLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKK--RVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRII 1535
            F+++  S +  A     P+++    A  +G+     + L+S +GI +  G + +G+L  +   R +R   Y + V L G+  +    + ++  +++Y  +YG   GA+VTL SV+  D+ G   +     L      +  LI PP+ G++ D T +Y  AF V G  ++ S ++
Sbjct:  324 FVVFWASVMLMAYGCSTPFVYLVPYAQSHGVPPGMAALLLSVLGIVDIAGNISYGWLTDRPSVRKHRGLFYMVAVGLEGVWSLLLPLMASFPLLMVYAVLYGYFDGAYVTLISVVTADLVGPVHVSSAVGLVFFMHAVPYLIAPPVAGWLVDITGTYTAAFLVSGMAMILSALL 497          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Yeast
Match: MCH2 (Protein with similarity to mammalian monocarboxylate permeases; monocarboxylate permeases are involved in transport of monocarboxylic acids across the plasma membrane but mutant is not deficient in monocarboxylate transport [Source:SGD;Acc:S000001704])

HSP 1 Score: 85.8853 bits (211), Expect = 2.738e-18
Identity = 95/453 (20.97%), Postives = 181/453 (39.96%), Query Frame = 3
Query:  138 ESQKMTTNNENVETTADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKI---SRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGI----KNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDST 1475
              ++   ++ +VE   + + +D     ++      D G+GW I+ A  + +  + G    Y +    Y+++      S+     +G +  +     +P+ ++L   FS + +   G +          F   LW + L+  V+ G G + I++PS+ ++ +WF  KRS A GI   GSG G  +F+  ++ ++   G KW +      I   +IC+S                        L+T     L L +     +               R         LL Y  +    ++LL+ G   FA + ++       D  +  G T+ +GS++   + +G+ +GR   G++A     +++    + ++L  ++ I  W +    KN    I +  + G + G      + I+  I G  KL  TF  +  F     L+  PIIG    ST
Sbjct:    2 SEERHEDHHRDVENKLNLNGKDDINGNTSISIEVPDGGYGWFILLAFILYNFSTWGANSGYAIYLAHYLENNTFAGGSKLDYASIGGLAFSCGLFFAPVITWLYHIFSIQFIIGLGILFQGAALLLAAFSVTLWEIYLTQGVLIGFGLAFIFIPSVTLIPLWFRNKRSLASGIGTAGSGLGGIVFNLGMQSILQKRGVKWAL------IAQCIICTS------------------------LSTIA---LMLTRTTHQGL---------------RQHKRSYKFELLDYDVLSNFAVWLLF-GFVSFAMLGYVVLLYSLSDFTVSLGYTSKQGSYVSCMVSVGSLLGRPIVGHIA-----DKYGSLTVGMILHLVMAILCWAMWIPCKNLATAIAFGLLVGSIMGTIWPTIASIVTRIVGLQKLPGTFGSTWIFMAAFALV-APIIGLELRST 399          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Yeast
Match: MCH4 (Protein with similarity to mammalian monocarboxylate permeases; monocarboxylate permeases are involved in transport of monocarboxylic acids across the plasma membrane but mutant is not deficient in monocarboxylate transport [Source:SGD;Acc:S000005479])

HSP 1 Score: 80.8777 bits (198), Expect = 1.327e-16
Identity = 68/262 (25.95%), Postives = 114/262 (43.51%), Query Frame = 3
Query:   24 YEVVNSHETDADINYRSG-----NENQTRTQAFDENVDQNNENESQKMTTNNENVETTADKD--HEDASESRSTTKRNQKDQGW-GWVIVFASFISHLISDGIVYSYGVLTTEYIKHY--KISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSS 779
            +E  ++ + D ++  R G     N N     A  +      + +  K+T     V  T +    ++D         R   D G   W++VF +F+  +   G++ S G + +   KH    IS +T+ W+ S+ +A+ FL   L+     R     +   GT+I   G  A      +W  IL+ SV  G+G  ++  P I  V  WF K+R  A  I+  G   G  +F  ++  L   VG++W + IL    L  +IC+S
Sbjct:   19 HEAQSTRDHDVELETREGPSSGYNPNFNAADAILKKNSDQVDLDVNKLTNVTSRVLNTPEASLIYDD--------DREFPDGGLKAWLVVFGAFMGLVPVFGLINSLGAIESYISKHQLANISSSTISWIFSLYLAISFLSCILSGGYFDRNGSIGLMCTGTVIYAGGLFALANCKSVWQFILAFSVCSGLGTGILMTPLIGTVATWFLKRRGIATSISTMGGSIGGIVFPIMLRKLYKEVGFQWAIRILSFICLTCLICAS 272          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Yeast
Match: ESBP6 (Protein with similarity to monocarboxylate permeases; appears not to be involved in transport of monocarboxylates such as lactate, pyruvate or acetate across the plasma membrane [Source:SGD;Acc:S000005069])

HSP 1 Score: 79.7221 bits (195), Expect = 4.050e-16
Identity = 58/248 (23.39%), Postives = 112/248 (45.16%), Query Frame = 3
Query:   45 ETDADINYRSGNENQTRTQAFDENVDQNNENESQKMTTNNENVETTADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKH---YKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVG-WKWTMFILGTSILILVICS 776
            + D   +  S +    R + +  +   + ++   +  T  E  E T  K   + S  +        D G+GWV+ F  F++   + G   S+GV    Y+ H      S+     +  + V +  L+SPL   L R    R+  + G  +    +    F ++LW L ++   + G   SLI++P+  ++  WF KKR+ A+G+++ G+G G  ++      +++  G  +W + I+G S  I V+ +
Sbjct:  145 QNDTTEHKASMDSKLMRNRLYPASTKHSGKDLEAQGITEFEPDEPTVKKVFTNKSTGQLELP---PDGGYGWVVTFCVFLTMFSTWGCNASFGVDLAYYLNHDTYPGASKYDYALIAGLTVFLGQLLSPLVMALMRIIGLRTTMLFGDAVMLAAYLLASFTTKLWQLYVTQGFMVGCSISLIFVPATTVLPGWFLKKRAVAMGVSLLGTGAGGVVYGLATNKMLSDFGNTRWCLRIIGISCSISVLVA 389          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Yeast
Match: MCH5 (Plasma membrane riboflavin transporter; facilitates the uptake of vitamin B2; required for FAD-dependent processes; sequence similarity to mammalian monocarboxylate permeases, however mutants are not deficient in monocarboxylate transport [Source:SGD;Acc:S000005833])

HSP 1 Score: 70.8626 bits (172), Expect = 1.710e-13
Identity = 53/222 (23.87%), Postives = 103/222 (46.40%), Query Frame = 3
Query:  111 ENVDQNNENESQKMTTNNENVETTADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISR---NTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLIT-------TVGWKWTMFILG 746
            + V++  + ESQ     N +    +DK+ +   E  S  +   K     WV+ F  F+  +   G++ S GV+ + +++  ++S    +T+GW+ S+ + V      ++     R  +R++ I GT+    G  A    ++ W  ILS ++VCG G  ++  P + +   +F K+R  A+ +A  G   G  +F  ++    +       T G+ W +  LG
Sbjct:   62 KEVNKGTDIESQPHWGENTSSTHDSDKEEDSNEEIESFPEGGFK----AWVVTFGCFLGLIACFGLLNSTGVIES-HLQDNQLSSESVSTIGWLFSLFLFVCSASCIISGTYFDRNGFRTIMIVGTVFHVAGLFATANSTKYWHFILSFAIVCGFGNGIVLSPLVSVPAHYFFKRRGTALAMATIGGSVGGVVFPIMLRSFFSMKSDTDPTYGFVWGIRTLG 278          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Nematostella
Match: EDO39975 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8F8])

HSP 1 Score: 178.333 bits (451), Expect = 2.058e-50
Identity = 126/445 (28.31%), Postives = 211/445 (47.42%), Query Frame = 3
Query:  240 KDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYK---------ISRNT-VGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYM 1544
             + GWGW++  A FI+     GI  + G+L T  +  +K         ISR     W+ SI + ++FL  P+TS LC R   R VA+ G ++  +GF    F  +L+ L ++  V+ GIG S+ YLP++  +  WF ++ S   GI   GSGFGT    P+++L +T +GW  T  IL   +L+  I +  Y                      +  + P E+K+ + +R+               + R             F ++KN  FL++  S     + +  P++     A++ GI  SK S L+  + IG+  GR+ FG +    +VNR +++ +  L+ G+    S    +Y+  ++Y  ++G+  G FV L  V+  DI G DK+ +   +   F  I+   GPP+ G IYD + SY +AF   G C   S  ++++
Sbjct:    1 PEGGWGWLVCLAGFIAQFTILGIQNNTGILYTTLLTEFKGNKGDTVNPISRFLHAAWVLSIGLGMMFLFCPITSALCERVGCRVVAVVGGLLGVLGFLLSSFVKDLYILYVTFGVLWGIGSSMCYLPTLRALPYWFRRRISLTNGIVTAGSGFGTIAMGPLMQLTVTYLGWAHTTRILAGVLLLCAISALLY---------------------RVPPKSPIEMKMAEEKRH---------------EKRPFFD---------FAVLKNKAFLVWSVSLGIFMMGYFVPFVHLPAYALECGIPISKSSTLVGMMSIGSTFGRLFFGKVCDHPKVNRLYIFQMAFLIIGIAHTLSTLTTSYVGFVLYMIVFGIFDGCFVVLLGVLCADIVGLDKVAEGMGVQFFFMAITCTAGPPLAGVIYDLSSSYQIAFYAAGACATLSCCLLFL 400          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Nematostella
Match: EDO35238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM28])

HSP 1 Score: 177.948 bits (450), Expect = 3.487e-50
Identity = 117/448 (26.12%), Postives = 208/448 (46.43%), Query Frame = 3
Query:  198 EDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMY 1541
            + + + +     +  D GWGW++  A+FI+  I  G + ++GV+  E ++ +K+ +    W+GSI   ++FL+ PL + LC++   R   + G II+  G         ++ + L+  ++ G+G S+ Y PS++I+  +F+K+ S A G+   GSG G+    PI++ +I  VG + TM I    I  +V+ S+ Y                      +NT   N  K     + A                     K+  L    F + KN  +LL+  S     + +  P++     A   GI     + LI  + +G+ IGR+ FG +A   +VNR +LY  + L+ G+          Y  +  Y + +G   G +V L+ V+  DI G + +     +    + + + +GPPI G+IYD + SY++AF V G   V +  +M+
Sbjct:    5 KKSLDEKPEPLVDYPDGGWGWLVCLAAFITQFIVLGTMNNFGVIYVELLQEFKVGKAEAAWVGSITYGMMFLLGPLGTTLCKKIGCRLTTVVGCIIAAGGCLLGSVAPNIYIMDLTYGLMFGVGASMCYFPSVIILGTYFNKRLSLANGLTSAGSGVGSLAMGPILQKVIEAVGMRNTMRISAAMISSIVLVSAIY--------------------RPINTPFLNAAKYETKHQEA-------------------NKKKGCLKFLDFSLFKNKAYLLWAASLSLWMLGYFVPFVHLISLATIQGIDIYMATLLIGIMSVGSTIGRLIFGKIADHPKVNRLYLYQFSFLMIGISNTICPAFSTYAGLAFYAAFFGFFEGCYVLLAPVLTGDIVGRNNMATGVGVLFAIKSVPLTLGPPIAGFIYDMSKSYELAFYVAGAVPVIAACMMF 413          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Nematostella
Match: EDO46207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQQ5])

HSP 1 Score: 173.326 bits (438), Expect = 8.308e-48
Identity = 129/504 (25.60%), Postives = 223/504 (44.25%), Query Frame = 3
Query:   72 SGNENQTRTQAFDENVDQNNENESQKMTTNNENVETTADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYF--QMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRKTK 1577
            +GNE   RT+     V   N             V  +    + +   SRS      KD+GW W++   SF+   I  GI  S+GVL    + H+  S+    W+GSI +  +FL SP+TS +  R+  R+V I G +  ++G     +   +  + ++  ++ G G SL    +++I   +FDK  S A GI   G   GT + +P ++ L+  +GW++ + IL  S + +      Y                           P+E +                  E   +DR+  S   N    +F   +++N  F+L+I +T  A   +  P+ F    +   GI  S GS+LIS +GI + +GR+ FG L+    +   H+Y   +LLSGL          Y  +I Y    G++ G+++ L S++ ++I G  K+   + +    Q  + L+GPP  G +YD+  S+   F +  G ++F  +I+     ++   +TK
Sbjct:    4 TGNEPSLRTKRSPSTVTIENLTAIP--------VGGSMSLMYIETDNSRS------KDRGWAWMVCAGSFLIMFIVYGIHTSFGVLLNALLNHFHESKAKTAWVGSIGLNFLFLGSPVTSRVAERYGIRTVTILGGVFISLGLFLTSYAPNIVVIYITYGLLFGSGTSLCGTMALIISVDYFDKHLSLATGIVAAGCSIGTLVLAPTLQFLVEKLGWRYAVRILAMSGVFIACAGFVYR--------------------------PHERR-----------------RETFSNDRATRSLNENKKCEFFDCSVLRNKAFILWIFTTSIAGFGYFIPHFFLVRYSEDLGIPPSTGSWLISYLGIASAVGRILFGKLSDICCIRNLHIYKACMLLSGLASALCSVATTYGGLITYVVALGILDGSYIGLMSIVTLEIVGFSKISPAWGILFFCQSFTYLLGPPAAGLLYDTVKSFKPVFYLASGPMIFGGVILLFVSCAQTKTQTK 450          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Nematostella
Match: EDO46709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPB5])

HSP 1 Score: 169.474 bits (428), Expect = 2.218e-47
Identity = 116/422 (27.49%), Postives = 200/422 (47.39%), Query Frame = 3
Query:  243 DQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCG 1508
            + GWGW++   +FI + I  GI  S+GV+    +   K+ +    W+G++ + + FL  PLTS LC R+S ++ A  G ++S +G     F  E   + L+  ++ G+G SL ++ SI+I+  +F K+ +   GIA  GSG G+ +  P++  L+  +GW+  M +L    ++L I +  +                   +  ++T P                               D  K  +L      + +N  ++ ++ +       ++ P++     A + GI+ SKG++LI  + I + IGRV FG L   +RVNR  +Y ++V   G+  I      NY  +I Y   +G   G FV   +VI  DI G +KL +      GF  I +  GPP+ G++YD+  SYD++F + G
Sbjct:    4 EGGWGWIVCAGTFIVNFIVFGIHNSFGVVYVNLLDELKLGKAETAWIGAMAMGLNFLCGPLTSILCTRYSCQATAFIGALLSVLGLFLTSFVQEPPKMYLTYGLLFGVGSSLSFVSSIVILGEYFQKRLALVNGIATSGSGVGSLVTGPVMNYLLANIGWQNCMRVLSGFAMLLWIAAFLF----------------KPNKRRVSTRP-----------------------------SKDAGKLVDL-----SIWRNKAYVTWVITVALFQFGYLFPFVHLIKYAEELGISKSKGAWLIGFLSITSTIGRVLFGRLCDFQRVNRITVYQLSVFAIGVSTILCPLASNYGGLIAYAVTFGFFDGCFVGQVAVITADIVGHEKLSQGVGNMFGFIAIPMSFGPPVAGWLYDAFGSYDLSFYLSG 375          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Nematostella
Match: EDO35637 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKX5])

HSP 1 Score: 162.54 bits (410), Expect = 1.157e-44
Identity = 104/432 (24.07%), Postives = 187/432 (43.29%), Query Frame = 3
Query:  240 KDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVG----------WMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVC 1505
             + GWGWV+   +F    +  G+  S G++ T  +  +   R   G          W+GS+   ++F + PLT+ LC RF  R V +AG  + T+G       + L  L  +  ++ G G SL Y P+I++++ +F  + S   G+   GSG GT    PI++LL   +G+      L   ++ + +CS+ +    N                   T  P+E +                                   + Y+++ KN  ++++I       + +  P++     A   G+  +K S LI  + I + +GR+ FG ++    +NR H+Y    L+  +  +    + +Y  ++ Y+ I+G+  G +V L  VI  DI G  K+              +++GPPI G++YD T  Y +AF +C
Sbjct:    1 PEGGWGWVVCLGAFFIQFLMLGVQNSAGIIYTALVDRFHAHRGVTGETKNYTFFKAWVGSLATGMMFFLGPLTTSLCERFGCRVVGLAGASLCTMGLLLSSIVTSLPVLYFTYGIIWGAGTSLCYFPTIIVLSKYFKTRLSLVNGLVTAGSGVGTLCMGPILQLLFAHLGYAHAFMALAAFMVPVFVCSALFRPVRNVFC---------------ETGRPHETR----------------------------------KMFYWEIFKNKGYVVWIACLSIFMLGYFVPFVHLVRHAEDLGVQPTKSSLLIGYMSIASTLGRLVFGKISDSPCINRLHVYQFGFLVMAMCALFVTMVTDYAGLVAYSVIFGLFEGLYVVLIPVITSDIVGASKMSYALGGMFSVMAFPMMLGPPIAGWVYDITGEYSLAFYLC 383          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Medaka
Match: slc16a12a (monocarboxylate transporter 12-B-like [Source:NCBI gene;Acc:101175502])

HSP 1 Score: 165.622 bits (418), Expect = 6.365e-45
Identity = 114/462 (24.68%), Postives = 211/462 (45.67%), Query Frame = 3
Query:  189 KDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLS---YFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHL--YNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSR 1559
            K+ +     R+    N  + GWGW++V   F++ +    +     +   E+  H++   +T  W+ S++ +   L +PL S+L  R S R   + G ++S+ G     F S + FL +S  V+ G+GF+L + P+I IV  +F ++++ A GIA+ GSG GTFL +P ++LLI    W+  + ILG  +  L +C +                            P  ++++ K + +                     S+  N  L    YF  +  P FL+   S +F A    +P ++    A+  G+     +FL+S+ G+   +G + FG++  +K + ++ +  Y + + + GL  +    + ++  +++ +S+YG   GA+V L  V+  D  G   L     +     GI  L+ PPI G++ D T +Y   F + G   + S  ++  A   R
Sbjct:    2 KEQKPKGGKRAPEGPNAPEGGWGWMVVAGCFLATICIRAVTRCVSMFFVEFQMHFEKDYSTTAWIHSLIDSTTMLCAPLGSFLGNRLSCRVTVMLGGLLSSAGLVLSSFASSVEFLYISLGVITGLGFALSFTPAIAIVGKYFVERKALAYGIALSGSGIGTFLLAPAVQLLIEHYSWRGALLILGGIVSNLCVCGA-------------------------LMRPLEDMEVQKTKPS---------------------SRCQNFCLKTREYFGFILIPSFLILSVSFLFLAYGCSSPVVYLVPYALSVGVDHQHAAFLMSTFGVSGIVGNITFGWITDRKCLKKYRMACYMVAIAMEGLCCMFFPFLHSFSLLVLLSSLYGYFDGAYVALMPVVTSDTVGSSYLTSALGVVYFLHGIPYLLSPPIGGWLVDQTGTYMTTFFLSGASFMLSSSVLAAAVFFR 417          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Medaka
Match: si:dkey-246g23.4 (monocarboxylate transporter 2 [Source:NCBI gene;Acc:101159501])

HSP 1 Score: 163.696 bits (413), Expect = 9.756e-44
Identity = 126/468 (26.92%), Postives = 223/468 (47.65%), Query Frame = 3
Query:  243 DQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQ----------------DNLNTEPPNELKLLKNERNAVXXXX---XXXXXXXXXDDRSDMSKRS--NLLLSY--FQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYL--SRDFRK 1571
            D G+ W I+ + F    ++ G+V S+GV   E  +++  +     W+ SI VA I + +PL S L  R+S+RSV IAG +I +VG     F + L  L L+   + G G++L + P++ ++ M+FDK+R  A  +A  G    TF+ +P+ +LLI +  W+  + I+G   L L +C        +     +     NEG+                D + +    E +L   E N    ++   + +   +  +D + + +R     +  Y  + ++ NP F++Y    VFAA+ F AP LF    A   GI   + + L+S   + + IGRV FG++A  + V        TV+L G VL+       +  ++ +++ +G++ GA V +   +L ++ G  +L       +  +    L+GPPI G+  D   SY   F + G  ++ S + + +  L   +D RK
Sbjct:   21 DGGYAWFILVSCFFVFGLTFGVVKSFGVFYVEIQQYFGTTAAGTSWITSIAVATIHVAAPLASALSSRYSHRSVVIAGGLICSVGAILGSFGNNLVQLYLTVGFLNGFGYALTWTPTVTMLGMYFDKRRPVANALASAGECILTFILTPMFQLLINSFSWRGALLIMGALQLNLCVCGLLLRPLKS----TRDVTCVNEGKAEEDGLSRKMLLKDILDEVKSSIQEEKELYTEESNQETSKKCLDDTEVEPSLAEDSTSLRERDLRTRVQQYVDYTLITNPRFMIYSMFGVFAALGFFAPSLFLVPYARSKGIEEYQAAALMSISAVLDLIGRVVFGWVANLRLVETVQQLTATVVLLGAVLLLCPLASTFYELVAFSAAHGLVYGATVAIHITVLPEVVGVQRLGSALGFFMLIRSSGGLLGPPIAGFFIDKMDSYGTGFLMSGVALLTSALFLLVLNLMMQKDQRK 484          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Medaka
Match: ENSORLT00000025268.2 (solute carrier family 16 member 12 [Source:NCBI gene;Acc:101161384])

HSP 1 Score: 162.925 bits (411), Expect = 1.165e-43
Identity = 114/455 (25.05%), Postives = 216/455 (47.47%), Query Frame = 3
Query:  234 NQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQD-NLNTEPPNELKL------LKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKK--RVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRK 1571
            +  D GWGWVIV   F+  + +  +     +   E+  H+    +   W+ S++  +  L +P+ S +  R+S R   + G ++S+ G     F + L  L L+  V+ G+GF+L Y P+I +V  +F ++++ A GIA+ GSG GTF+ +P+++LLI    W+  + I+   +  L +C +       + +  ++   +   QD  L+ +PP E ++      L  E+                 + S   +R +   + +  +  P FL    S +F A     P+++    A+  GI+    +FL+S +G+ + +G + FG+L  ++  + +R   Y ++V + GL  I +  ++++  ++ +  +YG   GA+V L  V+  D+ G   L     +      I  L+ PPI G + D T SY   F + G  ++ S  I+      R  R+
Sbjct:   12 SPPDGGWGWVIVGCCFMVTVCTRAVTRCISIFFVEFQGHFGAEYSATAWIHSLVDCITMLCAPVGSLVGNRWSCRVAVMLGGVLSSCGLLLSSFSTSLELLYLTMGVLTGLGFALCYTPAIALVGCYFQQRKALAYGIAMSGSGIGTFVLAPVLQLLIELYSWRGALLIMSAVVANLCVCGALMRPITVQEQTEEATCGEVSSQDTELSIKPPKETEVGLLPLTLPGEK----------------PNPSPKKRRFSFSRTEYSFLLQPDFLGLAVSFLFLASGCSLPFVYLVPYALSAGISHQHAAFLMSILGVIDIVGNITFGWLTDQRCLKPHRLSCYILSVAMEGLCCIFAPLLRSFRLLLPFAILYGYFDGAYVALIPVVTSDVVGAKHLSLALGVVYFLHAIPYLLSPPIGGLLVDITESYTGTFLLSGTALLASAFILSALVGIRRCRR 450          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Medaka
Match: slc16a9a (solute carrier family 16 member 9 [Source:NCBI gene;Acc:101165170])

HSP 1 Score: 159.073 bits (401), Expect = 3.590e-42
Identity = 120/461 (26.03%), Postives = 207/461 (44.90%), Query Frame = 3
Query:  222 TTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYS--NFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKR---------SNLLLSYFQMMKNPIFLLYIGST-----------------VFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIG-IGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCI 1517
            T+     D GWGW IV ASF++ L++ G   S GVL  E++  ++  +    W+GS++  V  + SP+ S     F  R V     ++   G     F   + FL+ S  +V G+G  L+Y  ++ I   +FDK+R  A+GI   G+  G F+++     LI   G    + I+G   L L+ C+      N      + K+   ++  +      P ++L +          +           D  D++ +         + + ++ F   K   +  YI ST                 +F+  +F  P LF +D A   G+      F + SIG I   +G++  G L   K +N  +LY  T+   G+ L+     K Y+ + I +++ G  +G + +L+S I   I G DKL +   + + F G  +++GPP++G+ +D T SYD+AF   G C+
Sbjct:    2 TSSAKDLDGGWGWAIVAASFMAQLLAYGSPQSVGVLYPEWLHAFQEGKGVTAWVGSLVAGVGLIASPICSACVDNFGARPVTFFSGVMVAGGLMLSAFAPNVPFLMFSYGIVVGLGCGLVYSATLTITCQYFDKRRGLALGIVTTGTSIGAFIYATAQNELIVFFGLDGCLLIIGAIALNLMACAGFMRPLNMPGYYLKQKAALERHTEEQLFVKLPLHDLNITTGSAVTTVEKTPTVKELLITIDVKDLAIQIEKKKKGPFAGVAIAKFIKAKQKAYSEYIHSTCEILQDQVMVAFCIGIFLFSLGAF-PPVLFIEDVAQSEGLIEEVSLFPLVSIGAIATGVGKLVLGILVDIKWINCVYLYAFTMFAGGIALLLIPITKTYVGLQILSAVMGFFSGNW-SLTSYITTHIVGLDKLSQAHGILMFFGGFGIMLGPPVVGWFFDCTQSYDLAFYFSGSCV 460          
BLAST of Monocarboxylate transporter, putative vs. Ensembl Medaka
Match: slc16a6a (monocarboxylate transporter 7 [Source:NCBI gene;Acc:101155804])

HSP 1 Score: 149.058 bits (375), Expect = 2.055e-38
Identity = 108/464 (23.28%), Postives = 210/464 (45.26%), Query Frame = 3
Query:  243 DQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVIC------------SSSYSNFDNXXXXXXXXXX----------------XNEGQDNLNTEPPNELKLLKNERN----------AVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVN--RFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILV--DIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCG 1508
            D GWGWV+  A F+  + + G +  +G+   +    +K S + + W+ SI V V+    PL S +  RF Y+ V + G ++   G  A  F S +  + ++   V G+G+ L YLP++ I++ +F+++RS  + +A  G     F  +P    +   +GW+ TM ++G    I+++C             S  ++ D  S +                      +NE  D+  T   ++LK LK+E++           V   E      + E+D      +    L  F +++   F+LY    +FA + F AP L+  + ++ +G+   + +F++S I +   +GR   G++ + +  +  +  +  + V++  L L+G   +K +  + +  ++YG   G        +L   D+ G +++     + +  Q  + L GPP+ G + D T +Y  AF  C 
Sbjct:   22 DGGWGWVVAVAFFLVEIFTYGTIKIFGIFLLDLKTEFKESNSRISWVVSIAVFVMTFNGPLASVMTNRFGYQFVVMIGGLLICCGTIATSFASSINQIYITYGFVAGLGYCLTYLPTVTILSKYFNRRRSLVVAVASIGESLSLFALAPAYSAVRDKIGWRHTMTLIGALQSIVIVCGALLRPVLIVPRESDSTDADKSSPKELEALQECGHVEGSDQESCLRKENEMIDSYGTTGVSDLKCLKDEKSPEENALLQKGGVKETERTPTVTSQENDNEKQGIKDCSKLLDFSILRECSFILYSLFGLFATLGFFAPPLYVIELSVSHGVERDRAAFMLSIIAVAEILGRFFIGWILSHRLFSGRKLLVLLVCVIIMTLDLVGFTLVKEFYGLAVCCALYGFFMGTISCTHIPLLAEDDVVGIERMTSAGGVYVFIQSFAGLAGPPLGGVLVDITKNYGAAFYSCA 485          
BLAST of Monocarboxylate transporter, putative vs. Planmine SMEST
Match: SMESG000008033.1 (SMESG000008033.1)

HSP 1 Score: 402.134 bits (1032), Expect = 6.084e-136
Identity = 217/436 (49.77%), Postives = 307/436 (70.41%), Query Frame = 3
Query:  291 LISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSY-SNFDNXXXXXXXXXXXNEGQDNL--NTEPPNELKLLKNE---RNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRKTKF 1580
            ++++G+ YSYGVL  E+I++++ISR+T+GW+GSIL+++     P+ SYLC +FSYR VA+ G+IIS +GF+ PYFY  LWFLIL+ SV+CGIGF L+YLPSI+IVN+WFDK+RS A+GI++CGSG GTF  SP++ELLI + GW  TM I+G  +L+L+  S  + ++++N+           E  D +  N     E+KLL  E   R      E +Q +E +  +  D      +  S  +++K+P+FL+   ST    I F APY+F+KDRAI NGI+A+ GS LISS+GIG+C+GR+GFGYL T  RVNRFHL+NI+++++GL+LI +W +KNYI +II    +G++TGAFVT+  VILV+IFG   L  +F LSL FQG+S+LIG P  G+IYD+T SY++ FA+CG  I  S IIMY+  L +DF K KF
Sbjct:    1 MLTEGLSYSYGVLAPEFIEYFEISRSTMGWLGSILISLTLFTGPIASYLCDKFSYRKVAVVGSIISAIGFSFPYFYRHLWFLILNFSVICGIGFGLVYLPSIIIVNVWFDKRRSLALGISLCGSGLGTFSISPLLELLILSYGWPTTMLIMGGILLLLIPSSLLFITSYNNRV----------ESNDKIFRNDTLIMEMKLLSKELTDRINEKYIEALQNSETSNSETHDSVNVCQMKYSLMELLKHPMFLIISMSTFLTGIGFNAPYIFSKDRAITNGISATYGSLLISSLGIGSCLGRIGFGYLGTLNRVNRFHLHNISLIITGLILISTWNLKNYIILIINHLSFGIVTGAFVTIYPVILVNIFGLVNLNTSFGLSLIFQGLSLLIGSPFAGWIYDTTASYNIVFAICGSFITCSGIIMYLICLFKDFEKLKF 426          
BLAST of Monocarboxylate transporter, putative vs. Planmine SMEST
Match: SMESG000008037.1 (SMESG000008037.1)

HSP 1 Score: 369.392 bits (947), Expect = 4.515e-123
Identity = 208/446 (46.64%), Postives = 293/446 (65.70%), Query Frame = 3
Query:  291 LISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEP---PNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLL----------SYFQMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRKTKFQ*F 1589
            +I+DGIV+SYG+LT EYI ++ ISR T   +GSILV +   ++P+  YL   F +R V++ G+++S +GF  PY Y ELWF++L++SV+CGIGF LIYLPSI IVN+WF+  +  AIGIAV GSG GTF FS I E L   VG K+TM I G  +L+L+ CS  Y                   QDN N+      N ++L+ +ERN           EN+ D  S  + RSN             S ++++KNPI LL + S V + I F +PY+FTK+RAI  G+  ++  FLIS+IG+G C+GRVGFGYLAT K VNRFHLYN+++++SGL+L  +    N+I ++ YT+IYG++TG+FVTL+SVIL+DIFG+D  +K FALSL  QG++ LIGPPII  +Y  T S+D+AF +CG  ++ S +I Y++++S++FR   F  F
Sbjct:    1 MITDGIVFSYGILTKEYISNFGISRLTASLIGSILVGLTLSLAPIAYYLSVIFDHRIVSLIGSLLSIIGFTIPYLYHELWFVVLNTSVLCGIGFGLIYLPSIAIVNVWFENVKPLAIGIAVSGSGLGTFAFSLIFEYLPIIVGLKYTMLITGGILLLLLPCSLIYRPIP--------------CQDNENSTRNTLENCIELMIDERNC-----EENYLENSCDMNSVNTGRSNKFQIPQTVISKESSMYELLKNPIILLLLFSNVLSGIGFNSPYVFTKERAILLGVPVNESKFLISTIGLGTCLGRVGFGYLATLKVVNRFHLYNVSLVISGLILAMTRWTNNFIFIVSYTTIYGIVTGSFVTLTSVILLDIFGKDNAQKAFALSLVSQGLAALIGPPIIALMYAKTQSFDLAFTICGILMIISGVIKYLSFISKEFRHKNFNSF 427          
BLAST of Monocarboxylate transporter, putative vs. Planmine SMEST
Match: SMESG000006948.1 (SMESG000006948.1)

HSP 1 Score: 228.409 bits (581), Expect = 4.326e-67
Identity = 105/214 (49.07%), Postives = 145/214 (67.76%), Query Frame = 3
Query:  144 QKMTTNNENVETTADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSY 785
            +++   NE  E    +++            +  D GWGWV+VFASF+ H+++DG+ YS+GVLTTE+I H+  SR  VGWM SILV +     PL S LC +F +R+V I G+ IS +GF AP+FY E WFL  S+SV+ G+GF L+YLPSI+ V+++F +KR+FAIG+AVCGSG GTF+FSP+IE LI T GW+ TM I+G  I   + C + Y
Sbjct:    4 REINLQNEQQEALVKEENHVVPMIDDEDDDDDLDGGWGWVVVFASFMVHVLADGVTYSFGVLTTEFISHFGASREAVGWMASILVGMTLSAGPLASILCNKFGFRTVTIIGSFISAIGFCAPFFYPEFWFLYFSASVISGLGFGLVYLPSIVTVSIYFKRKRAFAIGLAVCGSGIGTFVFSPLIEYLIETYGWRGTMLIVGGLIFNCLACGAVY 217          

HSP 2 Score: 192.2 bits (487), Expect = 1.159e-53
Identity = 91/191 (47.64%), Postives = 139/191 (72.77%), Query Frame = 3
Query:  999 QMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRK 1571
            +++K P+F+L+  S  F +I F AP+L+ KDRA+Q GI  ++ SFLISSIGIGN  GRV FGYL+TK  +NR +LYN ++L+SG+V++ S     Y  MI+YT  +G++TG +VTL+S++LVD+ G +KL  +F +++  QG +V IGPP+ G+IYD T S+D +F VCG  +  S +++++ Y S+D+RK
Sbjct:  381 ELLKAPVFILFALSNFFTSIGFNAPFLYAKDRALQMGIENNQASFLISSIGIGNTFGRVIFGYLSTKSFINRLNLYNTSLLISGIVVMLSSYAITYFWMIVYTLGFGLLTGTYVTLTSIVLVDLLGIEKLNASFGMTMVAQGAAVFIGPPLAGWIYDITFSFDWSFFVCGAFLAISGLMLFLVYCSKDYRK 571          
BLAST of Monocarboxylate transporter, putative vs. Planmine SMEST
Match: SMESG000071951.1 (SMESG000071951.1)

HSP 1 Score: 221.09 bits (562), Expect = 5.795e-65
Identity = 149/472 (31.57%), Postives = 247/472 (52.33%), Query Frame = 3
Query:  243 DQGWGWVIVFASFISHLISDGIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTSILILVICSSSYSNFDNXXXXXXXXXXXNEGQDNLNTEPPNELKLLKNERNAV----------XXXXXXXXXXXXXDDRSDMSKRSNLLLSYFQMMKN-----------------PIFLLYIGSTVFAAISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIMYMAYLSRDFRKTK 1577
            D GWGWV++ A+ I  +I  G++ S+G+  T  IK YK S++TV W+ S++ A     +PL + L  +FS R + I G+ I+ V FAAP+FYS LWF+ + SS++ G+G ++  + + +++  +FDKK     G+   G+G  + + +PI   LI + GW+ +M I G   ++  ICS ++          K+K   N+  DN   E          ERNAV           I   +       +  +D+ K    L +  Q + N                 P+  L   +     +     +++ K RA+   IT SK +FL+ +IGIGN IGR+ FGYL ++K +  + LY ++++L+G  LI S    +Y  M++YT  +G+  G++ TL+SV+L+DI G     K   L+   Q I +LI  P+ G IYD+T ++  AF   G  I+ S +++ + Y S+ FR+++
Sbjct:   55 DGGWGWVVLIAAVIIRIILGGLLVSFGLFITPLIKEYKTSQSTVSWIASLMSAPALAAAPLATLLAIKFSDRVIVIIGSAIACVAFAAPFFYSPLWFMFM-SSILTGVGMAIAMMNTTIVLTKYFDKKLCILNGMFTSGTGIASLIITPIFNKLINSCGWRLSMLIYGALFILCGICSITFKELPK-----KTKPKINDVNDNTKMEK-------HEERNAVVININCHKEPTIHNFLSATNIATNYNTDIEKIDQRLFTSLQYIHNKEDNFERKRVGNLLSNMPVSTLLGMTNFLTNLGHDTTFMYAKQRAVDMKITESKAAFLLIAIGIGNTIGRLLFGYLGSRKEIKTYILYLVSLVLAGGFLIFSRVAFSYPLMLVYTIGFGLFIGSYTTLTSVVLLDIVGLRDFTKGLGLTYFVQAIGLLICSPMSGAIYDATQTFHWAFFNSGALILSSGLVLLLGYASKSFRESQ 513          
BLAST of Monocarboxylate transporter, putative vs. Planmine SMEST
Match: SMESG000035197.1 (SMESG000035197.1)

HSP 1 Score: 156.377 bits (394), Expect = 2.677e-41
Identity = 125/498 (25.10%), Postives = 226/498 (45.38%), Query Frame = 3
Query:  183 ADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISDGIVYSYGV---LTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFSYRSVAIAGTIIST----VGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILIVNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFIL-GTSILILVIC--------------SSSYSNFD-NXXXXXXXXXXXNEGQD------------NLNTE------PPNELKLLKNERNAVXXXXXXXXXXXXXDDRSDMSKRSNLLLSYF----QMMKNPIFLLYIGSTVFAAISFIAPYLFTKDRAIQN-GITASKGSFLISSIGIGNCIGRVGFGYLATKKRVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSSVILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAVCGGCIVFSRIIM 1538
            + +D E     +S  +    D G+GW  VFA+F++  + DG+ +S+G    L  EY+   + +   + W+G++ V+   L  P+ S L ++F +R VA+ G  IS     + F +P     +W   +   ++ G+G  ++++  ++ ++ +FDKKR  + G AVCG+GFG F+   +++ +++   W  T+FIL G S+  +V C              S    N      +   S     E  D            NL +       PP E + +   R+ +N+      +  + D+      +   +  YF       +N    LY  S +  +  +  P+ +      +          F++S++G+ + + R G G LAT     +  +Y I +L++G + I S  +  Y+  I +  I G   G+ +TL SVIL ++   D++   F L     GI  LIGPP  G I+D   +YD+ F V G   + S +++
Sbjct:    4 STEDLEIVYYKKSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSP---PNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPTEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQLFLYYLSALLFSCCYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVV 498          
The following BLAST results are available for this feature:
BLAST of Monocarboxylate transporter, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC16A121.640e-4825.59solute carrier family 16 member 12 [Source:HGNC Sy... [more]
SLC16A145.279e-4324.39solute carrier family 16 member 14 [Source:HGNC Sy... [more]
SLC16A65.681e-3923.50solute carrier family 16 member 6 [Source:HGNC Sym... [more]
SLC16A65.681e-3923.50solute carrier family 16 member 6 [Source:HGNC Sym... [more]
SLC16A64.112e-3723.34solute carrier family 16 member 6 [Source:HGNC Sym... [more]
back to top
BLAST of Monocarboxylate transporter, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mct-62.618e-3637.63MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-41.000e-3532.20MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-42.183e-3532.07MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-42.738e-3438.60MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-42.738e-3438.60MonoCarboxylate Transporter family [Source:UniPro... [more]
back to top
BLAST of Monocarboxylate transporter, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mct11.434e-3939.18gene:FBgn0023549 transcript:FBtr0342765[more]
Mct11.434e-3939.18gene:FBgn0023549 transcript:FBtr0070393[more]
CG139074.506e-3640.68gene:FBgn0035173 transcript:FBtr0072593[more]
CG139074.506e-3640.68gene:FBgn0035173 transcript:FBtr0345005[more]
chk3.413e-3533.33gene:FBgn0033095 transcript:FBtr0302166[more]
back to top
BLAST of Monocarboxylate transporter, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a9a1.002e-4526.11solute carrier family 16 member 9a [Source:ZFIN;Ac... [more]
slc16a12b3.750e-4424.71solute carrier family 16 member 12b [Source:NCBI g... [more]
slc16a9b7.901e-4425.99solute carrier family 16 member 9b [Source:ZFIN;Ac... [more]
slc16a83.784e-4023.97solute carrier family 16 member 8 [Source:ZFIN;Acc... [more]
slc16a83.784e-4023.97solute carrier family 16 member 8 [Source:ZFIN;Acc... [more]
back to top
BLAST of Monocarboxylate transporter, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atf6b2.669e-4626.72activating transcription factor 6 beta [Source:Xen... [more]
mad2l19.605e-4026.13mitotic arrest deficient 2 like 1 [Source:Xenbase;... [more]
SLC16A64.597e-3824.42solute carrier family 16 member 6 [Source:NCBI gen... [more]
SLC16A67.699e-3824.53solute carrier family 16 member 6 [Source:NCBI gen... [more]
slc16a71.603e-3424.61solute carrier family 16 member 7 [Source:NCBI gen... [more]
back to top
BLAST of Monocarboxylate transporter, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc16a126.994e-4925.55solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a62.041e-4423.24solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a67.018e-4422.26solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a145.030e-4223.57solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a95.316e-3926.40solute carrier family 16 (monocarboxylic acid tran... [more]
back to top
BLAST of Monocarboxylate transporter, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BGC3|MOT12_MOUSE4.892e-4825.55Monocarboxylate transporter 12 OS=Mus musculus OX=... [more]
sp|D4A734|MOT12_RAT5.147e-4825.77Monocarboxylate transporter 12 OS=Rattus norvegicu... [more]
sp|Q6ZSM3|MOT12_HUMAN7.873e-4825.59Monocarboxylate transporter 12 OS=Homo sapiens OX=... [more]
sp|Q6P2X9|MOT12_XENTR3.245e-4623.85Monocarboxylate transporter 12 OS=Xenopus tropical... [more]
sp|Q6GM59|MOT12_XENLA6.593e-4624.07Monocarboxylate transporter 12 OS=Xenopus laevis O... [more]
back to top
BLAST of Monocarboxylate transporter, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YIZ70.000e+075.33Slc16a-6 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A0H3YJ011.011e-17351.01Slc16a-11 (Fragment) OS=Schmidtea mediterranea OX=... [more]
A0A0H3YJ056.174e-12842.46Slc16a-16 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A0H3YJ621.358e-11247.61Slc16a-24 (Fragment) OS=Schmidtea mediterranea OX=... [more]
A0A0R3U4H93.244e-7432.35Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Monocarboxylate transporter, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a12b6.392e-5025.57solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a12b1.527e-4925.57solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a12b1.814e-4625.41solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a9a2.082e-4627.63monocarboxylate transporter 9-like [Source:NCBI ge... [more]
slc16a12a5.567e-4026.59uncharacterized LOC103025054 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Monocarboxylate transporter, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001631.12.044e-4426.94pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 g... [more]
SLC16A129.399e-4225.17solute carrier family 16 member 12 [Source:HGNC Sy... [more]
zgc:1655071.787e-3925.17solute carrier family 16 member 7 [Source:HGNC Sym... [more]
si:ch211-234h8.74.080e-3826.82si:ch211-234h8.7 [Source:ZFIN;Acc:ZDB-GENE-061009-... [more]
SLC16A124.789e-2931.32solute carrier family 16 member 12 [Source:HGNC Sy... [more]
back to top
BLAST of Monocarboxylate transporter, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
MCH22.738e-1820.97Protein with similarity to mammalian monocarboxyla... [more]
MCH41.327e-1625.95Protein with similarity to mammalian monocarboxyla... [more]
ESBP64.050e-1623.39Protein with similarity to monocarboxylate permeas... [more]
MCH51.710e-1323.87Plasma membrane riboflavin transporter; facilitate... [more]
back to top
BLAST of Monocarboxylate transporter, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399752.058e-5028.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352383.487e-5026.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462078.308e-4825.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467092.218e-4727.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356371.157e-4424.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Monocarboxylate transporter, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a12a6.365e-4524.68monocarboxylate transporter 12-B-like [Source:NCBI... [more]
si:dkey-246g23.49.756e-4426.92monocarboxylate transporter 2 [Source:NCBI gene;Ac... [more]
ENSORLT00000025268.21.165e-4325.05solute carrier family 16 member 12 [Source:NCBI ge... [more]
slc16a9a3.590e-4226.03solute carrier family 16 member 9 [Source:NCBI gen... [more]
slc16a6a2.055e-3823.28monocarboxylate transporter 7 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Monocarboxylate transporter, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008033.16.084e-13649.77SMESG000008033.1[more]
SMESG000008037.14.515e-12346.64SMESG000008037.1[more]
SMESG000006948.14.326e-6749.07SMESG000006948.1[more]
SMESG000071951.15.795e-6531.57SMESG000071951.1[more]
SMESG000035197.12.677e-4125.10SMESG000035197.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013090 ID=SMED30013090|Name=Monocarboxylate transporter, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1699bp
CAACTCCAGTAACATCATGTCTTTATGAAGTTGTGAATTCCCATGAAACG
GATGCGGATATTAATTATCGCTCCGGAAATGAAAATCAAACAAGAACTCA
AGCATTTGATGAAAATGTCGATCAGAACAATGAAAACGAGTCTCAAAAAA
TGACAACAAATAATGAAAATGTCGAAACGACTGCAGATAAGGATCATGAG
GACGCATCAGAAAGTAGATCAACTACCAAACGTAACCAAAAGGATCAAGG
ATGGGGATGGGTAATTGTGTTTGCGAGTTTTATTTCTCACTTGATCAGTG
ATGGAATTGTTTATTCTTATGGGGTTTTGACAACTGAGTATATCAAACAT
TATAAAATATCAAGAAATACAGTTGGTTGGATGGGCTCAATACTAGTGGC
TGTGATCTTCCTCATTTCTCCCCTCACCAGTTATTTATGTCGAAGATTTA
GCTACAGGTCAGTTGCAATAGCAGGAACCATTATTTCTACTGTCGGATTT
GCAGCTCCATATTTCTACAGTGAATTATGGTTTCTCATTTTGAGTTCTTC
CGTGGTTTGTGGAATCGGATTTAGTCTGATCTATTTACCTTCGATTCTAA
TAGTGAACATGTGGTTTGATAAGAAACGGTCATTTGCAATTGGAATCGCC
GTTTGTGGATCAGGATTTGGAACCTTTCTTTTCAGTCCGATAATTGAATT
GTTGATTACGACTGTCGGATGGAAATGGACAATGTTTATATTAGGTACTT
CCATTTTAATATTAGTTATTTGTTCATCATCTTACTCAAACTTTGATAAT
AAAAGTAAAAGGCACAAAAGTAAAAAGTCAAAGAATGAGGGTCAAGATAA
TCTTAACACAGAACCTCCAAATGAACTTAAATTATTAAAGAACGAGAGAA
ACGCTGTAAATATTGAAGAGAATATCCAAGGAAATGAAAACAACGAAGAT
GATCGCAGTGACATGTCAAAACGTTCAAATTTATTACTTTCATATTTTCA
GATGATGAAAAATCCGATTTTTTTACTTTACATAGGGTCAACAGTTTTTG
CTGCTATTTCCTTTATTGCTCCGTATTTGTTTACCAAAGATAGAGCCATT
CAAAATGGAATAACTGCAAGTAAAGGAAGCTTTTTAATCTCGTCTATCGG
AATTGGAAATTGCATCGGACGAGTGGGATTCGGATATTTGGCAACGAAAA
AGAGAGTAAATCGGTTCCATTTGTATAATATCACAGTACTTCTCAGTGGA
TTGGTTTTGATCGGTAGTTGGGGCATCAAGAATTACATAGCAATGATAAT
TTACACATCTATTTATGGAATGATGACCGGCGCCTTTGTCACGTTGTCTT
CTGTGATTTTAGTTGACATTTTTGGTGAGGATAAATTAGAGAAAACGTTT
GCATTATCTTTGGGATTCCAAGGAATTTCCGTGTTAATAGGTCCACCAAT
AATAGGATATATCTATGATTCAACACTGTCATACGATGTGGCATTTGCGG
TATGTGGGGGTTGCATAGTATTTAGCCGGATAATCATGTACATGGCATAC
TTGTCTAGGGACTTTAGAAAAACAAAATTTCAATAATTCTCAAATAATTG
AATATTAAAATTATAATTTATAGTTGAATGTATTTCTATCACAAATAAAA
AACAGATCAATGACAACCAAAAAATAAAAGATTTTATCTTAGAACCAAC
back to top

protein sequence of SMED30013090-orf-1

>SMED30013090-orf-1 ID=SMED30013090-orf-1|Name=SMED30013090-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=528bp
TPVTSCLYEVVNSHETDADINYRSGNENQTRTQAFDENVDQNNENESQKM
TTNNENVETTADKDHEDASESRSTTKRNQKDQGWGWVIVFASFISHLISD
GIVYSYGVLTTEYIKHYKISRNTVGWMGSILVAVIFLISPLTSYLCRRFS
YRSVAIAGTIISTVGFAAPYFYSELWFLILSSSVVCGIGFSLIYLPSILI
VNMWFDKKRSFAIGIAVCGSGFGTFLFSPIIELLITTVGWKWTMFILGTS
ILILVICSSSYSNFDNKSKRHKSKKSKNEGQDNLNTEPPNELKLLKNERN
AVNIEENIQGNENNEDDRSDMSKRSNLLLSYFQMMKNPIFLLYIGSTVFA
AISFIAPYLFTKDRAIQNGITASKGSFLISSIGIGNCIGRVGFGYLATKK
RVNRFHLYNITVLLSGLVLIGSWGIKNYIAMIIYTSIYGMMTGAFVTLSS
VILVDIFGEDKLEKTFALSLGFQGISVLIGPPIIGYIYDSTLSYDVAFAV
CGGCIVFSRIIMYMAYLSRDFRKTKFQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0015718monocarboxylic acid transport
GO:0055085transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000136whole organism
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 18..57
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 18..86
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 58..77
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 182..204
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 1..429
NoneNo IPR availablePANTHERPTHR11360:SF225EG:103B4.3 PROTEINcoord: 1..429
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 1..429
e-value: 4.3132E-89
score: 273.274
NoneNo IPR availableTMHMMTMhelixcoord: 7..28
NoneNo IPR availableTMHMMTMhelixcoord: 90..112
NoneNo IPR availableTMHMMTMhelixcoord: 67..86
NoneNo IPR availableTMHMMTMhelixcoord: 346..368
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 412..431
NoneNo IPR availableTMHMMTMhelixcoord: 156..178
NoneNo IPR availableTMHMMTMhelixcoord: 124..146
NoneNo IPR availableTMHMMTMhelixcoord: 253..275
NoneNo IPR availableTMHMMTMhelixcoord: 38..60
NoneNo IPR availableTMHMMTMhelixcoord: 319..336
NoneNo IPR availableTMHMMTMhelixcoord: 380..402
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 321..433
e-value: 3.2E-11
score: 42.8
coord: 3..315
e-value: 1.9E-28
score: 99.4
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 1..434
score: 15.014
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 3..430