SMED30013087

Overview
NameSMED30013087
Smed IDSMED30013087
Length (bp)2420
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30013087 (SMED30013087) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30013087 (SMED30013087) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30013087 (SMED30013087) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30013087 (SMED30013087) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013087

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30013087SMESG000023252.1 SmedASXL_019078SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30013087SMESG000023252.1 SmedASXL_007682SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30013087SMESG000023252.1 dd_Smed_v4_35852_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30013087SMESG000023252.1 dd_Smed_v4_18917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013087SMESG000023252.1 dd_Smed_v6_35852_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30013087 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005506:4098..18386 -11607
Homology
BLAST of SMED30013087 vs. Ensembl Human
Match: MYCBPAP (MYCBP associated protein [Source:HGNC Symbol;Acc:HGNC:19677])

HSP 1 Score: 63.5438 bits (153), Expect = 1.448e-9
Identity = 47/188 (25.00%), Postives = 85/188 (45.21%), Query Frame = 3
Query: 1266 HIHFPATIMGVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFH-------SAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKII-FHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKEL 1805
            H+ F  T+ G      L   N G+  I + W+     R  + D F          F+F   +G++LP         F+S   G F E WE  T P L    I+  + HA+SL  D F  ER ++E  +     + + +E++ +L+   +   +    +D   + L +E++F++ NP + +  ++V+ L
Sbjct:  427 HLTF-ETLEGEKTSSELTVVNNGTVAIWYDWR-----RQHQPDTFQDLKKNRMQRFYFDNREGVILPGEIKTFTFFFKSLTAGVFREFWEFRTHPTLLGGAILQVNLHAVSLTQDVFEDERKVLESKLTAHEAVTVVREVLQELLMGVLTPERTPSPVD---AYLTEEDLFRHRNPPLHYEHQVVQSL 605          
BLAST of SMED30013087 vs. Ensembl Human
Match: MYCBPAP (MYCBP associated protein [Source:HGNC Symbol;Acc:HGNC:19677])

HSP 1 Score: 63.5438 bits (153), Expect = 1.477e-9
Identity = 47/188 (25.00%), Postives = 85/188 (45.21%), Query Frame = 3
Query: 1266 HIHFPATIMGVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFH-------SAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKII-FHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKEL 1805
            H+ F  T+ G      L   N G+  I + W+     R  + D F          F+F   +G++LP         F+S   G F E WE  T P L    I+  + HA+SL  D F  ER ++E  +     + + +E++ +L+   +   +    +D   + L +E++F++ NP + +  ++V+ L
Sbjct:  433 HLTF-ETLEGEKTSSELTVVNNGTVAIWYDWR-----RQHQPDTFQDLKKNRMQRFYFDNREGVILPGEIKTFTFFFKSLTAGVFREFWEFRTHPTLLGGAILQVNLHAVSLTQDVFEDERKVLESKLTAHEAVTVVREVLQELLMGVLTPERTPSPVD---AYLTEEDLFRHRNPPLHYEHQVVQSL 611          
BLAST of SMED30013087 vs. Ensembl Human
Match: MYCBPAP (MYCBP associated protein [Source:HGNC Symbol;Acc:HGNC:19677])

HSP 1 Score: 63.5438 bits (153), Expect = 1.514e-9
Identity = 47/188 (25.00%), Postives = 85/188 (45.21%), Query Frame = 3
Query: 1266 HIHFPATIMGVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFH-------SAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKII-FHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKEL 1805
            H+ F  T+ G      L   N G+  I + W+     R  + D F          F+F   +G++LP         F+S   G F E WE  T P L    I+  + HA+SL  D F  ER ++E  +     + + +E++ +L+   +   +    +D   + L +E++F++ NP + +  ++V+ L
Sbjct:  427 HLTF-ETLEGEKTSSELTVVNNGTVAIWYDWR-----RQHQPDTFQDLKKNRMQRFYFDNREGVILPGEIKTFTFFFKSLTAGVFREFWEFRTHPTLLGGAILQVNLHAVSLTQDVFEDERKVLESKLTAHEAVTVVREVLQELLMGVLTPERTPSPVD---AYLTEEDLFRHRNPPLHYEHQVVQSL 605          
BLAST of SMED30013087 vs. Ensembl Human
Match: MYCBPAP (MYCBP associated protein [Source:HGNC Symbol;Acc:HGNC:19677])

HSP 1 Score: 63.5438 bits (153), Expect = 1.565e-9
Identity = 47/188 (25.00%), Postives = 85/188 (45.21%), Query Frame = 3
Query: 1266 HIHFPATIMGVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFH-------SAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKII-FHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKEL 1805
            H+ F  T+ G      L   N G+  I + W+     R  + D F          F+F   +G++LP         F+S   G F E WE  T P L    I+  + HA+SL  D F  ER ++E  +     + + +E++ +L+   +   +    +D   + L +E++F++ NP + +  ++V+ L
Sbjct:  470 HLTF-ETLEGEKTSSELTVVNNGTVAIWYDWR-----RQHQPDTFQDLKKNRMQRFYFDNREGVILPGEIKTFTFFFKSLTAGVFREFWEFRTHPTLLGGAILQVNLHAVSLTQDVFEDERKVLESKLTAHEAVTVVREVLQELLMGVLTPERTPSPVD---AYLTEEDLFRHRNPPLHYEHQVVQSL 648          
BLAST of SMED30013087 vs. Ensembl Zebrafish
Match: mycbpap (mycbp associated protein [Source:ZFIN;Acc:ZDB-GENE-080923-1])

HSP 1 Score: 60.4622 bits (145), Expect = 7.836e-9
Identity = 56/203 (27.59%), Postives = 92/203 (45.32%), Query Frame = 3
Query: 1284 TIMGVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFHSAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVL-SSKKIIFHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRY--AVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKELK-LFA--LQNFEIDWDLSLDSLKQML 1874
            T+ G +   +L   N GS  I +SW+K+       T      F+F     ++LP S   I VTF+S   G   E+W L T PVL     +      ++L  D    +R  +++ + Q   +     +I DL+    +  R +   E+      + DEE F   NP + +    V+ L+ L+A   ++ E  WDLS+ +L Q+L
Sbjct:  422 TVTGQSVNADLELKNEGSTVIYYSWEKL-------TPTHTQHFYFNNTTAVILPSSTKHICVTFKSASAGILTEVWRLNTHPVLMGGASVHVILRGVALDQDKSAEQRMALQKELEQKACVCFCSRLILDLLTGVESPERPRSPDEL-----YITDEERFHTHNPNLQFQRGPVEALQSLYAEVKRSEEQRWDLSIHTLTQVL 612          
BLAST of SMED30013087 vs. Ensembl Xenopus
Match: kif11 (kinesin family member 11 [Source:Xenbase;Acc:XB-GENE-978999])

HSP 1 Score: 63.1586 bits (152), Expect = 1.688e-9
Identity = 44/183 (24.04%), Postives = 82/183 (44.81%), Query Frame = 3
Query: 1314 LYFANRGSCTINFSWKKI----EIERHLKTDDFHSAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKII-FHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKELKLFALQNFEIDWDL 1847
            L   N GS  I + W+++     ++R  K       F+F  + G++LP    I P  F+S   G F E WE  T PVL +  ++      I+L  D     R  ++  +     + +++ I+++L+    +  +        +  + +EE F  +NP++++  + V+ELK          WDL
Sbjct:  427 LEVVNNGSAAIWYEWRRLPPPARLQRSRKEPRVQR-FYFNTSSGVILPGETRIFPFHFKSPTAGIFGENWEFCTHPVLLAGALLEVSLWGIALHEDKTAPLREALQRELEAREALVVAQHIVEELLEGVRSPER----PQSPVRSVTEEEAFSTVNPKLYYKHQTVQELKHL--------WDL 596          
BLAST of SMED30013087 vs. Ensembl Xenopus
Match: kif11 (kinesin family member 11 [Source:Xenbase;Acc:XB-GENE-978999])

HSP 1 Score: 61.6178 bits (148), Expect = 5.327e-9
Identity = 44/183 (24.04%), Postives = 82/183 (44.81%), Query Frame = 3
Query: 1314 LYFANRGSCTINFSWKKI----EIERHLKTDDFHSAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKII-FHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKELKLFALQNFEIDWDL 1847
            L   N GS  I + W+++     ++R  K       F+F  + G++LP    I P  F+S   G F E WE  T PVL +  ++      I+L  D     R  ++  +     + +++ I+++L+    +  +        +  + +EE F  +NP++++  + V+ELK          WDL
Sbjct:  428 LEVVNNGSAAIWYEWRRLPPPARLQRSRKEPRVQR-FYFNTSSGVILPGETRIFPFHFKSPTAGIFGENWEFCTHPVLLAGALLEVSLWGIALHEDKTAPLREALQVELEAREALVVAQHIVEELLEGVRSPER----PQSPVRSVTEEEAFSTVNPKLYYKHQTVQELKHL--------WDL 597          
BLAST of SMED30013087 vs. Ensembl Mouse
Match: Mycbpap (MYCBP associated protein [Source:MGI Symbol;Acc:MGI:2388726])

HSP 1 Score: 65.0846 bits (157), Expect = 3.258e-10
Identity = 48/178 (26.97%), Postives = 83/178 (46.63%), Query Frame = 3
Query: 1284 TIMGVNEIKNLYFANRGSCTINFSWKKIEIE---RHLKTDDFHSAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKII-FHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKEL 1805
            T+ G      L   N G+  I ++W++   +   + LK +     F+F   +G++LP         F+S   G F E WE  T P L    ++    HAISL  D F+ ER L+E  +     I I++ ++ DL+R      +    +D   + L +E++F   NP + +  ++V+ L
Sbjct:  432 TLEGERTSSELTVVNNGTVAIWYNWRRRPHQDFFQDLKQNKTQR-FYFNNREGVILPGETKHFTFFFKSLNAGIFRESWEFGTHPTLLGGAVLQVTLHAISLTQDIFMDERKLLETKLAAHEAITIAQSVLQDLLRGISTPERTPSPVD---AYLTEEDLFNYRNPRLHYQHQVVQNL 605          
BLAST of SMED30013087 vs. Ensembl Mouse
Match: Mycbpap (MYCBP associated protein [Source:MGI Symbol;Acc:MGI:2388726])

HSP 1 Score: 65.0846 bits (157), Expect = 3.329e-10
Identity = 48/178 (26.97%), Postives = 83/178 (46.63%), Query Frame = 3
Query: 1284 TIMGVNEIKNLYFANRGSCTINFSWKKIEIE---RHLKTDDFHSAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKII-FHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKEL 1805
            T+ G      L   N G+  I ++W++   +   + LK +     F+F   +G++LP         F+S   G F E WE  T P L    ++    HAISL  D F+ ER L+E  +     I I++ ++ DL+R      +    +D   + L +E++F   NP + +  ++V+ L
Sbjct:  422 TLEGERTSSELTVVNNGTVAIWYNWRRRPHQDFFQDLKQNKTQR-FYFNNREGVILPGETKHFTFFFKSLNAGIFRESWEFGTHPTLLGGAVLQVTLHAISLTQDIFMDERKLLETKLAAHEAITIAQSVLQDLLRGISTPERTPSPVD---AYLTEEDLFNYRNPRLHYQHQVVQNL 595          
BLAST of SMED30013087 vs. UniProt/SwissProt
Match: sp|Q69CM7|MYBPP_RAT (MYCBP-associated protein OS=Rattus norvegicus OX=10116 GN=Mycbpap PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 6.796e-10
Identity = 48/182 (26.37%), Postives = 80/182 (43.96%), Query Frame = 3
Query: 1284 TIMGVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFH-------SAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSP-VLSSKKIIFHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKEL 1805
            T+ G      L   N G+  I + W+     R  + D F          F+F   +G++LP         F+S+  G F E WE  T P +L    +    HAISL  D F+ ER L+E  +     + I++ ++ DL+R      +    +D   + L +E++F   NP + +   +V+ L
Sbjct:  420 TLEGEKTSSELTVVNNGTVAIWYDWR-----RRPQQDFFQDLKQNRTQRFYFNNREGVILPGETKHFTFFFKSRNAGIFMESWEFGTHPTLLGGAALQITLHAISLTQDIFMDERKLLESKLAAHEAVTIAQSVLQDLLRGVSTPERAPSPVD---AYLTEEDLFHYRNPRLHYQHRVVQNL 593          
BLAST of SMED30013087 vs. UniProt/SwissProt
Match: sp|Q5SUV2|MYBPP_MOUSE (MYCBP-associated protein OS=Mus musculus OX=10090 GN=Mycbpap PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.328e-9
Identity = 48/178 (26.97%), Postives = 83/178 (46.63%), Query Frame = 3
Query: 1284 TIMGVNEIKNLYFANRGSCTINFSWKKIEIE---RHLKTDDFHSAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKII-FHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKEL 1805
            T+ G      L   N G+  I ++W++   +   + LK +     F+F   +G++LP         F+S   G F E WE  T P L    ++    HAISL  D F+ ER L+E  +     I I++ ++ DL+R      +    +D   + L +E++F   NP + +  ++V+ L
Sbjct:  422 TLEGERTSSELTVVNNGTVAIWYNWRRRPHQDFFQDLKQNKTQR-FYFNNREGVILPGETKHFTFFFKSLNAGIFRESWEFGTHPTLLGGAVLQVTLHAISLTQDIFMDERKLLETKLAAHEAITIAQSVLQDLLRGISTPERTPSPVD---AYLTEEDLFNYRNPRLHYQHQVVQNL 595          
BLAST of SMED30013087 vs. UniProt/SwissProt
Match: sp|Q8TBZ2|MYBPP_HUMAN (MYCBP-associated protein OS=Homo sapiens OX=9606 GN=MYCBPAP PE=1 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 7.414e-9
Identity = 47/188 (25.00%), Postives = 85/188 (45.21%), Query Frame = 3
Query: 1266 HIHFPATIMGVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFH-------SAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKII-FHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKEL 1805
            H+ F  T+ G      L   N G+  I + W+     R  + D F          F+F   +G++LP         F+S   G F E WE  T P L    I+  + HA+SL  D F  ER ++E  +     + + +E++ +L+   +   +    +D   + L +E++F++ NP + +  ++V+ L
Sbjct:  433 HLTF-ETLEGEKTSSELTVVNNGTVAIWYDWR-----RQHQPDTFQDLKKNRMQRFYFDNREGVILPGEIKTFTFFFKSLTAGVFREFWEFRTHPTLLGGAILQVNLHAVSLTQDVFEDERKVLESKLTAHEAVTVVREVLQELLMGVLTPERTPSPVD---AYLTEEDLFRHRNPPLHYEHQVVQSL 611          
BLAST of SMED30013087 vs. TrEMBL
Match: R7V6V4 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226990 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.728e-14
Identity = 99/408 (24.26%), Postives = 164/408 (40.20%), Query Frame = 3
Query: 1293 GVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFH------SAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVL-SSKKIIFHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKELKLFALQNFEID---------------------------------------------WDLSLDSLKQMLREKYDLDSEIAEPMFKEYQEICQGLNVPTINPISVKSDVFNSPFDTGNICFTKLMNSIDEAESFMITIARQLNI-EKFIYNLTEVTPEPAATLPATGTLNKENSSKLPKG--KSDQKT-NAEEPLTAPT---VKEVLHYSFDNVQREAQKCLFREKAYYAVA 2339
            G   +  L  AN G+  I FSWK I      +T+ F         F+F    G++LP   V IP  F+S+  G F E W+L T PV+     +I     ++++ D F  +R  +E+ +      QI   I+ +++    +  + S  ID  I+   + EIF   NPE+++ ++ V++LK    Q  EID                                             WDLS+ SLK+ +    D D E  + M  +  +    L+ P ++P           + TG   +  L N ID+     + +   L + E+   +L+E     +A      T  +++    PKG   +D+K  +A+ P  AP+    KEV           A++   REK  +  A
Sbjct:  502 GCRTLSTLEIANDGTTAIFFSWKSIP-----RTNPFDLLNANVQRFYFNTTNGVILPGDTVKIPFVFKSRNAGVFTEQWQLETRPVVCGGAMLIVTLRGVAVQQDKFHKQRTELEQYLATKQANQIVGSILSEVIEGIRSPERPSSPIDAYIT---EPEIFSRFNPELYYEYQTVQKLKELYRQLEEIDIAAEAAAAAATVEAAAAVKAAEEPKEEEGEEAEEVMAVEERRPDSWDLSVCSLKERIMGIRD-DEEKQQEMLTQLNQFVLQLSFPALSPTQKLM------YSTG---YQLLSNCIDDFSQEALQLRSSLGMPERESDDLSEEPGAISARTQTASTSTRDSRKPAPKGGKGADKKAKDAKPPPKAPSQAQAKEVAKTGKTAAPSGAKRPTTREKDRHTPA 891          
BLAST of SMED30013087 vs. TrEMBL
Match: A0A210QY52 (MYCBP-associated protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT00420 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 9.197e-14
Identity = 93/409 (22.74%), Postives = 172/409 (42.05%), Query Frame = 3
Query: 1314 LYFANRGSCTINFSWKKIEIERHLKTDDFHS---AFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVL-SSKKIIFHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKELKLFALQNFEID------WDLSLDSLKQMLREKYDLDSEIAEPMFKEYQEICQGLNVPTINPISVKSDVFNSPFDTGNICFTKLMNSIDE--AESFMITIA-----RQLNI----------EKFIYNLTEVTPEPAATLPA----TGTLNKENSSKLPKGKSDQ----KTNAEEPLTAPTVKEVLHYSFDNVQR-----------EAQKCLFR---EKAYYAVAHVIRNLLSELDHIFDRMV 2393
            LY  N G+  + + WKK+  +     D  H     F+F  + G++LP   +  P  F+S   G F E W   T P L     +I     I+L+ D F+ ER  +E ++ Q    Q+ + ++ D++       + S  +D   + + +EEIF   NP++ +NF +V++LK   L+    +      WDLS++ LK+ L +  + D      + +    + +    P    I +K +++        + +  L+ ++D+   +S +I        R+L I          +    N  +  PE     PA     G   KE +   PKGK+ Q    KT +  P   P    ++  S +               +A   L+R   EK Y     ++ + L +++ +F+ ++
Sbjct:  473 LYIVNDGTTAVYYDWKKVPKDNPF--DLVHQNVQRFYFNNSSGVILPGETMKFPFVFKSPSAGVFHEQWRFETRPTLCGGAALIVTLRGIALQEDKFLKEREELERDLQQKQAEQMVRHLMFDIISGIKTPDRPSSPVD---NYITEEEIFARNNPKLHYNFALVQQLKQIYLEMVPEEEREGRIWDLSVEDLKEDLLDMDEDDERKENFLHQLNSNVSKMAYTPH---IPIKKNLY-------KVGYQLLLEAVDKMVGQSMLIRQVMGLPERELTILPEDLSDSRSKSKAENKVKAPPEKGGKAPAKKDEKGAKGKEAAKAEPKGKTPQPPQKKTPSRGPSATPGPGSMMAESRERTMTTPTSTPHSPIPDADPVLYRKYKEKLYTQTTLIMADTLQKMEDVFEEVL 866          
BLAST of SMED30013087 vs. TrEMBL
Match: H2ZEA0 (Uncharacterized protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.138e-13
Identity = 70/257 (27.24%), Postives = 120/257 (46.69%), Query Frame = 3
Query: 1266 HIHFPATIMGVNEIKNLYFANRGSCTINFSWKKIEIE---RHLKTDDFHSAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSP-VLSSKKIIFHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKELK-----LFALQNFEI-DWDLSLDSLKQMLREKYDLDSEIAEPMFKEYQEICQGLNVPTINPISVKSDVFNSPF 2006
             +HF +   G     +L   N G+  + F W+K+  E     LK D     F+F   +G++LP      P  F+S   G F E WEL+T+P V+    +      ++++ D     R  IEE +       +  +IIDD++R      +    ID  I+   +EEIFK  N    ++ E + ELK     LFA ++ E  +W+LSLD L+  +    D  ++  E +      +   L++P + PI  + D++++ +
Sbjct:   54 RVHFESR-SGERTSSHLVVENNGTTAVYFEWRKVPKEVAFESLKPDTLQR-FYFNTGEGVILPGDTTNFPFVFKSPNPGIFTETWELMTNPAVMGGAALQVVLKGVAVQDDQMEDHRRRIEEELESREAGVVVAKIIDDIIRGIQTPDRCPSPIDAYIT---EEEIFKRKNNGRHYDHETIMELKNIYLQLFAEEDREGREWNLSLDELQSFVSVLPDEGAK--EELLSGLNTVIGRLSMPPLTPI--QQDMYSAGY 301          
BLAST of SMED30013087 vs. TrEMBL
Match: W4ZAM1 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.066e-13
Identity = 77/307 (25.08%), Postives = 129/307 (42.02%), Query Frame = 3
Query: 1293 GVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFHSA-------FFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKII-FHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKELKLFALQNF------EIDWDLSLDSLKQMLREKYDL-DSEIAEPMFKEYQEICQGLNVPTINPISVKSDVFNSPFDTGNICFTKLMNSIDEAESFMITIARQLNIEKFIYNLTEVTPEPAATLPATGTL 2168
            GV    +L   N G+ TI + WKKI      K + F          F+F  + G++LP  ++  P  F+S   G F E W+L T PV+     +      ++L+ D  + +R  IEE +         + I+++LV       +    ID  I+   DEE F+ LNP + +  E+V +LK   ++ F      + +WDL +  +K   RE   + D E+ E +     +    L  P   PI           +   + +  +M ++D     ++T A  + +   I    E  P+ A  L A   L
Sbjct:  518 GVRTTSHLELVNDGTTTIYYDWKKIP-----KLNPFEGCSTPRIQRFYFNTSSGVLLPGESLRFPFVFKSPNAGIFTESWQLDTRPVVCGGGALQVTLRGVALQEDKNLKQRKDIEEELFAKQAQVAVRRILEELVDGIRTPERAHSPIDAYIT---DEETFERLNPGMHFANEVVSQLKQLHVEQFDEEEREDKEWDLDVSKMK---REFLAIEDEEMREELLNRMNQAVTSLYFPPFTPIQ---------HEMYRVAYNLMMENVDN----IVTQANTIRVNMGIPEKVEELPDTAEILAANDAL 800          
BLAST of SMED30013087 vs. TrEMBL
Match: A0A2R2MRE5 (MYCBP-associated protein-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106180241 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 2.486e-13
Identity = 129/564 (22.87%), Postives = 223/564 (39.54%), Query Frame = 3
Query:  735 FSSHQDEIFKI--ILPCFQNGTGAPITHSIWPVQEETKSKLHVQRYKWKPHIPLQTSMTGYHELILH----EMNETTKGLESSEKIKI------KNEVLNETKYQ--RFLKDYHYHTPDISELIICS-----KTYQKEQPQKENTTLSNFXXXXXXXXXXNTKSVRGAILLINDELIFERLNDKDQILSKP----------------NDQY---LHIHFPATIM-----GVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFH------SAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVL-SSKKIIFHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKEL-----KLFALQNF-EIDWDLSLDSLKQMLREKYDLDSEIAEPMFKEYQEICQGLNVPTINPISVKSDVFNSPFDTGNICFTKLMNSIDE--AESFMI----TIARQLNIEKFIYNLTEVTP------EPAATLPAT-GTLNKENSSKLPKGKSDQKT 2219
            +   Q+E + I   +P    G G  +    W  QE     L         H+ L  +  GY   I H     M +  KG+  S+          ++  L + K Q    + +   H PD+S L I       K   KE  ++E  T+S FE+                  ++ D+   + L D   ++ +P                 D Y       F A +      G  +   L   N G+ +I + WKK+      K++ F         F+F  + G++LP   +  P  F+S   G F E W+  T PV+     ++     ++L+ D F  +R  IE+ +      QI ++I+DD+V       +    +D  I+    E+IF+  N  + ++ E V EL      LF  +   +++WDLSL++L++ + E  D D E  +   ++       L+ P  +PI  + +++        + +  L+ +ID    +S MI     +  +   E    ++T  TP       P A+  A  G  +K++S    KG  D KT
Sbjct:  257 YRKKQEERYLIDRTIPSMDYGKGYRVGSEFWKQQERIGDDLEGM------HMTLTQTERGYPPPIEHVGVPTMIKEEKGVYWSKPSTPVHYPWDRSAFLKQRKQQLQTVMDELDPHKPDMSSLAITGFKQGPKLVDKEDEREEPRTMSEFEDS-----------------VLEDQENLDPLKDHPDVVPEPIFGPSILFAGRPARWTGDSYSFQGQQAFEARVTFEGYSGQRKTSFLEVVNNGTTSIYYDWKKLP-----KSNPFDIVNSRVQRFYFNTSGGVILPGDTMKFPFVFKSPNAGVFTEQWQFETRPVVCGGASLVVTLRGVALQEDKFKHQRSEIEKELAHKQAEQIIRQIVDDVVEGVQTPDRARSPVDAYIT---REDIFERKNQGMHFSNETVTELNELYKNLFPEEERDDVEWDLSLETLREAIME-MDEDDEQKQEFLQQLNSAVISLSFPPFSPI--QQEMY-------KVAYQALLETIDSIVGQSMMIRQVLGLPEKEFEEFPEGDITHSTPHTSHSERPGASQKAGRGQDSKKDSKAGQKGGKDAKT 779          
BLAST of SMED30013087 vs. Ensembl Nematostella
Match: EDO31470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXU7])

HSP 1 Score: 68.5514 bits (166), Expect = 1.012e-11
Identity = 51/188 (27.13%), Postives = 82/188 (43.62%), Query Frame = 3
Query: 1314 LYFANRGSCTINFSWKKIEIERHLKTD--DFHSAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKII-FHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKELKLFALQNFEIDWDLSLDSLKQ 1868
            L+  N G+  I FSWK++     L T        F+F  N G++LP   +  P  F+S   G F E WEL+T PVL     I      I++  D +   R  IE+ +     I+ +  I+ +++       +    +D  I++   +E  ++L  E+F   E   E            WDLS+  L+Q
Sbjct:  489 LHICNDGTTAIYFSWKRVPKANTLGTKLAGRTQRFYFDTNSGVILPGETLKFPFIFKSLNAGIFSENWELLTEPVLCGGGAIRVCLRGIAIEEDVYADARREIEKELAHREAIEAAARILQEILDGVRTPERSRSPVDAYITMHFQDEAVQSLK-EIFVEVEPGAE------------WDLSVGGLQQ 663          
BLAST of SMED30013087 vs. Planmine SMEST
Match: SMESG000023252.1 (SMESG000023252.1)

HSP 1 Score: 1438.71 bits (3723), Expect = 0.000e+0
Identity = 744/752 (98.94%), Postives = 747/752 (99.34%), Query Frame = 3
Query:  141 MINRRKSILNKTRRDSVRSAALKLLQQKEDRENENANSFLRQRRYEDLDNLKIKEDDLNKNSNNTFFSLNFKSRNCAVRRLIPLDQRRXXXXXXXXXXXXXXDITTDIQMLSSLNDETIVKVYENRLKMETFSPNEVQEKSFLTTNMSDRPVEENSFKSLENWKLRMLERRKLKTSLAKRLQTNPESLLISKSAQSSLFSSHQDEIFKIILPCFQNGTGAPITHSIWPVQEETKSKLHVQRYKWKPHIPLQTSMTGYHELILHEMNETTKGLESSEKIKIKNEVLNETKYQRFLKDYHYHTPDISELIICSKTYQKEQPQKENTTLSNFXXXXXXXXXXNTKSVRGAILLINDELIFERLNDKDQILSKPNDQYLHIHFPATIMGVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFHSAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLSSKKIIFHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKELKLFALQNFEIDWDLSLDSLKQMLREKYDLDSEIAEPMFKEYQEICQGLNVPTINPISVKSDVFNSPFDTGNICFTKLMNSIDEAESFMITIARQLNIEKFIYNLTEVTPEPAATLPATGTLNKENSSKLPKGKSDQKTNAEEPLTAPTVKEVLHYSFDNVQREAQKCLFREKAYYAVAHVIRNLLSELDHIFDRMVN 2396
            MINRRKSILNKTRRDSVRSAALKLLQQKEDRENENANSFLRQRRYEDLDNLKIKEDDLNKNSNNTFFSLNFKSRNCAVRRLIPLDQRRLHLKGMMLKKFLKKDITTDIQMLSSLNDET VKVYENRLKMETFSPNEVQEK FLTTNMSDRPVEENSFKSLENWKLRMLERRKLKTSLAKRLQTNPESLLISKSAQSSLFSSHQDEIFKIILPCFQNGTGAPITHSIWPVQEETKSKLHVQ YKWKPHIPLQTSMTGYHELILHEMNETTK LESSEKIKIKNEVLN+TKYQRFLKDYHYHTPDISELIICSKTYQKEQP+KENTTLSNFEEEEILTELENTKSVRG ILLINDELIFERLNDKDQILSKPNDQYLHIHFPATIMGVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFHSAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVL+SKKIIFHFHAISLRPDYFIFERHLIEENVHQSIIIQISKEIIDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKELKLFALQNFEIDWDLSLDSLKQMLREKYDLDSEIAEPMFKEYQEICQGLNVPTINPISVKSDVFNSPFDTGNICFTKLMNSIDEAESFMITIARQLNIEKFIYNLTEVTPEPAATLPATGTLNKENSSKLPKGKSDQKTNAEEPLTAPTVKEVLHYSFDNVQREAQKCLFREKAYYAVAHVIRNLLSELDHIFDRMVN
Sbjct:    1 MINRRKSILNKTRRDSVRSAALKLLQQKEDRENENANSFLRQRRYEDLDNLKIKEDDLNKNSNNTFFSLNFKSRNCAVRRLIPLDQRRLHLKGMMLKKFLKKDITTDIQMLSSLNDETNVKVYENRLKMETFSPNEVQEKKFLTTNMSDRPVEENSFKSLENWKLRMLERRKLKTSLAKRLQTNPESLLISKSAQSSLFSSHQDEIFKIILPCFQNGTGAPITHSIWPVQEETKSKLHVQCYKWKPHIPLQTSMTGYHELILHEMNETTKDLESSEKIKIKNEVLNKTKYQRFLKDYHYHTPDISELIICSKTYQKEQPKKENTTLSNFEEEEILTELENTKSVRGPILLINDELIFERLNDKDQILSKPNDQYLHIHFPATIMGVNEIKNLYFANRGSCTINFSWKKIEIERHLKTDDFHSAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLTSKKIIFHFHAISLRPDYFIFERHLIEENVHQSIIIQISKEIIDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFEIVKELKLFALQNFEIDWDLSLDSLKQMLREKYDLDSEIAEPMFKEYQEICQGLNVPTINPISVKSDVFNSPFDTGNICFTKLMNSIDEAESFMITIARQLNIEKFIYNLTEVTPEPAATLPATGTLNKENSSKLPKGKSDQKTNAEEPLTAPTVKEVLHYSFDNVQREAQKCLFREKAYYAVAHVIRNLLSELDHIFDRMVN 752          
BLAST of SMED30013087 vs. Planmine SMEST
Match: SMESG000045572.1 (SMESG000045572.1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.716e-9
Identity = 55/194 (28.35%), Postives = 94/194 (48.45%), Query Frame = 3
Query: 1305 IKNLYFANRGSCTINFSWKKIEIERHLKTDDFH-SAFFFKINKGIVLPDSNVIIPVTFRSKFLGFFDEMWELVTSPVLS-SKKIIFHFHAISLRPDYFIFERHLIEENVHXXXXXXXXXXXXDDLVRYAVNRTKLSIEIDCDISILN-DEEIFKNLNPEVFWNFEIVKELK----------LFALQNFEIDWDL 1847
            ++ L F NRG+  I + WKKIE       ++ +   F+FK   GI+LP+ ++ +P+ F+S   G F E+W++ T P+L+    I+     I+L+ D     R  I+  +   +   IS+ I+D++V+   N  K  ++   + S  N D + F   N   F+  E +  LK          L A  N+ +D  L
Sbjct:  362 VEQLLFQNRGTSIIRYWWKKIESFDPFNLENKNIRRFYFKTEDGILLPNEDLNLPIIFKSAKSGIFTEVWKIETIPLLANGNDIVIILKGIALQNDVTAAIRQGIDSYMKYQVADNISRTILDEIVQ---NIGKTDLQHHPEDSFENTDRDQFVQKNNGFFYEIENINSLKKLNEEIAGKELNAYDNWRMDCGL 552          
The following BLAST results are available for this feature:
BLAST of SMED30013087 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
MYCBPAP1.448e-925.00MYCBP associated protein [Source:HGNC Symbol;Acc:H... [more]
MYCBPAP1.477e-925.00MYCBP associated protein [Source:HGNC Symbol;Acc:H... [more]
MYCBPAP1.514e-925.00MYCBP associated protein [Source:HGNC Symbol;Acc:H... [more]
MYCBPAP1.565e-925.00MYCBP associated protein [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SMED30013087 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013087 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013087 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mycbpap7.836e-927.59mycbp associated protein [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30013087 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
kif111.688e-924.04kinesin family member 11 [Source:Xenbase;Acc:XB-GE... [more]
kif115.327e-924.04kinesin family member 11 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of SMED30013087 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mycbpap3.258e-1026.97MYCBP associated protein [Source:MGI Symbol;Acc:MG... [more]
Mycbpap3.329e-1026.97MYCBP associated protein [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of SMED30013087 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q69CM7|MYBPP_RAT6.796e-1026.37MYCBP-associated protein OS=Rattus norvegicus OX=1... [more]
sp|Q5SUV2|MYBPP_MOUSE2.328e-926.97MYCBP-associated protein OS=Mus musculus OX=10090 ... [more]
sp|Q8TBZ2|MYBPP_HUMAN7.414e-925.00MYCBP-associated protein OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of SMED30013087 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7V6V43.728e-1424.26Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A210QY529.197e-1422.74MYCBP-associated protein OS=Mizuhopecten yessoensi... [more]
H2ZEA01.138e-1327.24Uncharacterized protein OS=Ciona savignyi OX=51511... [more]
W4ZAM12.066e-1325.08Uncharacterized protein OS=Strongylocentrotus purp... [more]
A0A2R2MRE52.486e-1322.87MYCBP-associated protein-like isoform X2 OS=Lingul... [more]
back to top
BLAST of SMED30013087 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013087 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013087 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013087 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO314701.012e-1127.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30013087 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30013087 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023252.10.000e+098.94SMESG000023252.1[more]
SMESG000045572.12.716e-928.35SMESG000045572.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013087 ID=SMED30013087|Name=SMED30013087|organism=Schmidtea mediterranea sexual|type=transcript|length=2420bp
TCGAGATTATATTTTACAATAACATTAATGCATTATTTCAAATTCAAACA
GAACTTTGAGTAGAATAATGCAAATATTTTGACATTTTCGAAATTTGTAT
TATTTGTTATTTATCACTAAAGTGATTGATCACATAAAAGATGATAAACA
GACGAAAATCAATTCTAAATAAGACTCGACGGGATTCTGTAAGATCTGCA
GCTTTGAAACTTTTACAACAAAAAGAAGACAGAGAAAATGAAAATGCTAA
TAGTTTTTTACGCCAACGAAGATACGAAGACCTTGATAATTTAAAAATAA
AGGAGGATGATTTGAACAAAAATTCAAATAATACTTTTTTTTCACTCAAT
TTTAAAAGTAGAAATTGTGCTGTTCGACGTCTCATTCCTCTAGATCAGAG
ACGACTTCATTTGAAGGGAATGATGTTGAAAAAATTTTTGAAGAAAGATA
TTACCACAGATATCCAAATGCTTTCAAGTCTGAATGACGAAACAATTGTT
AAAGTTTATGAAAACCGTCTAAAAATGGAGACTTTTTCGCCCAATGAAGT
CCAAGAGAAAAGTTTTTTAACAACCAACATGTCGGATAGACCTGTGGAAG
AAAATTCTTTTAAATCTCTAGAGAACTGGAAATTGAGAATGCTTGAAAGA
CGAAAACTAAAAACATCTTTAGCTAAGAGACTTCAAACAAACCCAGAATC
TTTGTTGATTAGTAAGTCGGCACAATCTTCTCTGTTTTCATCTCACCAGG
ATGAAATTTTCAAAATCATTTTACCCTGTTTTCAAAACGGAACCGGAGCA
CCAATTACCCATTCAATTTGGCCAGTTCAAGAAGAAACTAAGAGCAAATT
ACATGTTCAACGTTATAAATGGAAGCCGCACATTCCTCTTCAAACAAGTA
TGACTGGCTATCATGAGCTAATTCTCCATGAAATGAATGAAACTACGAAG
GGTTTAGAATCTTCGGAAAAAATCAAAATTAAAAATGAAGTTCTTAACGA
AACAAAATACCAAAGATTCCTCAAGGATTATCACTATCATACTCCGGATA
TTTCTGAACTGATAATTTGTTCAAAAACTTATCAGAAAGAACAACCTCAA
AAAGAAAATACGACATTATCAAATTTTGAAGAAGAGGAAATTTTGACTGA
ATTGGAGAATACAAAGTCTGTTCGAGGTGCAATTCTTCTAATAAATGATG
AACTGATTTTTGAAAGATTAAATGATAAAGATCAGATTTTATCTAAACCA
AATGACCAATATTTACATATTCATTTTCCAGCAACAATTATGGGAGTTAA
CGAGATAAAAAATCTCTATTTTGCAAACAGAGGATCTTGTACAATAAACT
TTTCATGGAAAAAAATTGAAATTGAAAGACATTTGAAAACTGATGATTTT
CATTCAGCATTCTTTTTCAAAATAAATAAAGGAATAGTATTACCAGACTC
CAATGTGATCATCCCAGTCACATTTAGGTCTAAATTCTTGGGATTTTTCG
ATGAAATGTGGGAGCTAGTGACCTCACCAGTGTTGTCAAGTAAAAAGATA
ATATTCCATTTCCATGCAATTTCTTTGCGTCCAGATTATTTCATTTTCGA
ACGCCATTTAATCGAAGAAAATGTCCATCAATCTATTATTATTCAAATTT
CAAAAGAAATAATAGACGACCTCGTCCGATATGCTGTCAACCGCACCAAA
CTTTCAATAGAAATCGATTGTGATATTTCAATTTTGAATGATGAAGAAAT
TTTCAAAAATCTCAATCCAGAAGTTTTTTGGAATTTTGAAATAGTAAAAG
AATTAAAATTGTTTGCTCTTCAAAATTTTGAAATTGACTGGGATTTATCT
TTGGACTCATTAAAACAAATGTTAAGGGAAAAGTATGATTTAGATTCGGA
AATTGCTGAGCCGATGTTCAAGGAATATCAGGAAATATGTCAGGGATTAA
ATGTCCCCACAATCAATCCTATTTCCGTGAAAAGCGATGTTTTCAATTCG
CCGTTTGACACTGGAAATATATGTTTTACAAAATTGATGAACTCAATTGA
TGAAGCTGAGAGTTTCATGATCACCATTGCAAGACAACTGAATATCGAAA
AGTTCATTTACAATCTAACAGAGGTTACACCTGAACCAGCAGCAACATTG
CCAGCTACGGGTACCCTTAATAAAGAAAACTCATCGAAATTACCAAAAGG
AAAAAGTGATCAGAAAACCAATGCTGAAGAGCCACTAACCGCTCCAACAG
TAAAAGAAGTTCTTCATTATTCGTTTGATAATGTCCAACGAGAAGCTCAA
AAATGTTTATTTAGAGAAAAGGCTTATTATGCAGTGGCACATGTCATAAG
AAATTTATTAAGTGAACTTGACCATATTTTTGATAGAATGGTTAATTAAA
AAAATGAAAGTCTTTTAAAA
back to top

protein sequence of SMED30013087-orf-1

>SMED30013087-orf-1 ID=SMED30013087-orf-1|Name=SMED30013087-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=753bp
MINRRKSILNKTRRDSVRSAALKLLQQKEDRENENANSFLRQRRYEDLDN
LKIKEDDLNKNSNNTFFSLNFKSRNCAVRRLIPLDQRRLHLKGMMLKKFL
KKDITTDIQMLSSLNDETIVKVYENRLKMETFSPNEVQEKSFLTTNMSDR
PVEENSFKSLENWKLRMLERRKLKTSLAKRLQTNPESLLISKSAQSSLFS
SHQDEIFKIILPCFQNGTGAPITHSIWPVQEETKSKLHVQRYKWKPHIPL
QTSMTGYHELILHEMNETTKGLESSEKIKIKNEVLNETKYQRFLKDYHYH
TPDISELIICSKTYQKEQPQKENTTLSNFEEEEILTELENTKSVRGAILL
INDELIFERLNDKDQILSKPNDQYLHIHFPATIMGVNEIKNLYFANRGSC
TINFSWKKIEIERHLKTDDFHSAFFFKINKGIVLPDSNVIIPVTFRSKFL
GFFDEMWELVTSPVLSSKKIIFHFHAISLRPDYFIFERHLIEENVHQSII
IQISKEIIDDLVRYAVNRTKLSIEIDCDISILNDEEIFKNLNPEVFWNFE
IVKELKLFALQNFEIDWDLSLDSLKQMLREKYDLDSEIAEPMFKEYQEIC
QGLNVPTINPISVKSDVFNSPFDTGNICFTKLMNSIDEAESFMITIARQL
NIEKFIYNLTEVTPEPAATLPATGTLNKENSSKLPKGKSDQKTNAEEPLT
APTVKEVLHYSFDNVQREAQKCLFREKAYYAVAHVIRNLLSELDHIFDRM
VN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR032707MYCBPAP
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032707MYCBP-associated proteinPFAMPF14646MYCBPAPcoord: 158..556
e-value: 6.5E-38
score: 130.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 373..476
e-value: 2.0E-6
score: 29.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 670..700
NoneNo IPR availablePANTHERPTHR12276:SF54MYCBP-ASSOCIATED PROTEINcoord: 382..518
NoneNo IPR availablePANTHERPTHR12276EPSIN/ENT-RELATEDcoord: 382..518