G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30013080
Length (bp)1183
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30013080) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30013080) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013080

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013080h1SMcG0003145 dd_Smed_v4_19933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013080h1SMcG0003145 dd_Smed_v4_19933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013080h1SMcG0003145 dd_Smed_v4_19933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013080h1SMcG0003145 dd_Smed_v4_19933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013080h1SMcG0003145 dd_Smed_v4_19933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013080h1SMcG0003145 dd_Smed_v4_19933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013080h1SMcG0003145 dd_Smed_v4_19933_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013080h1SMcG0003145 dd_Smed_v6_19933_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A5J4NZI2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0002524 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.883e-22
Identity = 80/264 (30.30%), Postives = 138/264 (52.27%), Query Frame = 3
Query:  213 SDTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSKVIDSWQKVCFCA-GVSVFVIAMKHAPLLWITHLGNGTVG--CSYNKDWCNLAMCPHTWIEFITHSLLPYVLLIPTNISLYIIIRKHSEEAFXXXXXXXXXXXXXXXXXXXXXXXXXXMVSSKILICLSILHFCLSFPGLLYIEFLGVFEIRYFPSDSEESKLLYNALFLLTSTNNALNFFTVLYFSNEFRNTISQML 995
            +D   LWV VLRY + ++   D+R  +   C FHTFL+ + ++ ++A+LC  SV R +S+R+PL S    S +K+  C  G  VF++ +KHAP L+I  L +  VG  C    D   L    + ++EF TH +L Y +LI +NI LY+ +++  +    +    ++      ++ +  +  +     +++L+  S +    S P L++IE    F     P + +    +Y AL L   TNN +NFF ++  S +FR  +  +L
Sbjct:   85 ADLVCLWVLVLRYSLTLSAYGDVRLQNKFACKFHTFLSMVCSNLSIALLCIFSVHRAISIRWPLASYTWLSKRKLNACLFGAFVFIL-LKHAPALFIFSLVDLDVGVKCDIRPDTDTLGKA-YYYLEFSTHCVLGYPILIVSNILLYVFLKRTLKRGITSMSGTSNRSTDTVTQSATTTGISI----ARVLLFFSWIQLITSVPFLIFIESSDQFGWDIIPDNRKL--FVYFALLLAMLTNNGINFFIMIGISTKFRGDVRSLL 340          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A5J4NZ88 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0002526 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 9.258e-21
Identity = 87/277 (31.41%), Postives = 143/277 (51.62%), Query Frame = 3
Query:  210 GSDTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSKVIDSWQKVCFC-AGVSVFVIAMKHAPLLWITHL--GNGTVGCS--YNKDWCNLAMCPHTWIEFITHSLLPYVLLIPTNISLYIIIRKHS---EEAFXXXXXXXXXXXXXXXXXXXXXXXXXXMVSSKILICLSILHFCLSFPGLLYIEFLGVFEIRYFPSDSEESKLLYNALFLLTSTNNALNFFTVLYFSNEFRNTISQMLKLKWFCH 1016
            G +   LW+ VLR+ I + ++ D+RT     CV HTF++  +T+ AVAVLC  S  R+VSMR+PL S  + + +++ +C  GV   ++  +   LL I  L    G   C    N ++  L    + + EF +HSLL Y  L+  N +LY ++RKH+   + + +   S +S   +  SR  +  +   G  +SKI++ LS +    + P  L +E   + +   F    E+  ++Y    LL  TN+A N++ +L  S +FR    +MLK   FC 
Sbjct:   66 GVEFLCLWILVLRHTIYLGWEYDVRTLDQASCVIHTFVSVFSTNMAVAVLCIFSAHRMVSMRWPLASVRLFTRRRLNWCLVGVCAVILCKQIPLLLLIRLLPAEQGKYKCEAVQNNEYITLRHV-YNYCEFFSHSLLGYTSLVFFNATLYFVLRKHNHSMKNSLKLDSSQSSQTTTNKSRAGQPRMHRDGTTASKIILLLSFVQVLSTLPYFLLVELHRIQKWNLFIG--EQQVMVYYICILLVYTNSAFNYYLILGISKKFRTMTLEMLKFIVFCQ 339          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A5J4NV70 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0015010 PE=4 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.726e-19
Identity = 78/271 (28.78%), Postives = 133/271 (49.08%), Query Frame = 3
Query:  213 SDTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSKVIDSWQKVCFCAGVSVFVIAMKHAPLLWITHLGN--GTVGCSYNKDWCNLAMCPHTWIEFITHSLLPYVLLIPTNISLYIIIRKHSEEAFXXXXXXXXXXXXXXXXXXXXXXXXXXMVSSKILICLSILHFCLSFPGLLYIEFLGVFEIRYFPSDSEESKL-LYNALFLLTSTNNALNFFTVLYFSNEFRNTISQ-MLKLKWFC 1013
            SD   LWV VLRY I +T   DIRT S+  C  HTF + + ++ ++A+LC  SV R + +++PL S    + +++      ++ +I +KH  +L++  L        C  N  W  L    +  IEF TH  L Y +LI +NI L++ +++ + +             +   +       ++G+ +++ L+  +I+    S P L+ IEF     ++  P   E+ KL +Y  L L   TNNA+N+F ++  S  F N      + LK  C
Sbjct:   82 SDLCCLWVLVLRYLIILTSGGDIRTVSDSFCKIHTFSSMVCSNLSIALLCIFSVHRTIGIQWPLVSHTWLTKKRLNTYLVFALMIILLKHTSVLFLFQLSEIGQRKKCDLNDQWPTLGKVYYN-IEFSTHCCLGYSVLIISNICLFVALKRKTRKNL---------VTTSRDKSGPNDATHKGINTARTLLFFTIIQLLTSVPFLVVIEFNDQLNLQMVP---EQHKLTVYFGLLLAMFTNNAINYFLMIGISKTFMNEARDYFIHLKKLC 339          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A183WXX9 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS16982 PE=4 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.317e-18
Identity = 102/352 (28.98%), Postives = 162/352 (46.02%), Query Frame = 3
Query:   54 GQPMLLLLIRYFLAFYAGFLIVIGSLGNIFI-----------------------------IFGMXXXXXXXXXXXXXXXXAGSDTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSKVIDSWQKVCFCAGVSVFVIAMKHAP---LLWITHLGNGTVGC--SYNKDWCNLAMCPHTWIEFITHSLLPYVLLIPTNISLYIIIRKHSEEAFXXXXXXXXXXXXXXXXXXXXXXXXXXMVSSKILICLSILHFCLSFPGLLYIEFLGVFEIRYFPSDSEESKLLYNALFLLTSTNNALNFFTVLYFSNEFRNTISQMLKLKW 1007
            GQPM  +L     A Y+  +I+ GSLGNI I                             I G+      +   L+L++L  +D   LW+ VLRY I ++ D DIR  +   C+ HT+L+ + ++ +V +L   SV+R +++ +P+ SK + + + +  C  +++ +I +KH P   LL I  L      C  +YN D        + +IEF TH +L YV+LI +NISL+  +               S         +++S R R M S+++++ LS      S P  + +E   V   +  PS+     L Y    LL  TNN+ NFF  +Y S  FR +   ML   W
Sbjct:   10 GQPMTGIL-----AIYSISVIIFGSLGNILILLTISHKNYLLQHENGRSVDSSFTSSIYMIKGIICIKSCKRSELLLILLTYADFICLWIIVLRYAIHLSADQDIRAITLTGCLLHTYLSMVGSNLSVGLLGIFSVQRAIAIIWPMISKKLLTRKCLYICMLITLLIILIKHLPVFILLNIRQLTPDLYVCDINYNDDDNKTKFKYYYYIEFSTHIVLGYVILIISNISLFFCLNIQKRNKI-------SNVSIGNDSTTQKSNRIRYMNSARLVLALSFYQVISSIPFFVLVELPSVSGRQIIPSNKRW--LAYYITTLLLFTNNSYNFFITVYVSQHFRKSTKLMLLHAW 347          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A4S2L022 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010324 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 5.752e-18
Identity = 74/266 (27.82%), Postives = 130/266 (48.87%), Query Frame = 3
Query:  228 LWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSKVIDSWQKVCFCAGVSVFVIAMKHAP---LLWITHLGNGTVGCSYNKD-WCNLAMCPHTWIEFITHSLLPYVLLIPTNISLYIIIRKHSEEAFXXXXXXXXXXXXXXXXXXXXXXXXXXMVSSKILICLSILHFCLSFPGLLYIEFLGVFEIRYFPSDSEESKLLYNALFLLTSTNNALNFFTVLYFSNEFRNTISQMLKLKWFC 1013
            +W+ +LRY + +  D D+R  S   C  H FL+    +  VA++C  S  R+VSMR+PL +    + + + +    S+  I +K  P   L ++  +G G   C  ++D    +    ++++EF THS L Y LL+  N  LY  + ++  + ++      S        + +   R  G+ +S ++I LS +    + P  L IE    F++  FP + E   ++Y    L    NNA+N++ VL  S +FR  ++  L L+ FC
Sbjct:   95 IWLVLLRYGLHLIADTDLRNVSTFGCKLHVFLSQSAVNMTVAMMCIFSAHRMVSMRWPLGTMKRITRRCINWIIIGSLLSILLKQLPVFHLFYLDEVGEGVQKCIKSRDPKFAVYTAVYSYVEFGTHSALGYTLLVCFNSVLYYTVNRYRRQNWQKGRVAVSKMDDAEITLKKTETRRVGLSASIVVISLSFVQVLSTIPYFLLIEINTRFKLNLFPVEYEF--VVYYVSILTVFVNNAINYYLVLGISKKFRR-LTWNLMLRVFC 357          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000001813.1 (SMESG000001813.1)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 330/331 (99.70%), Postives = 331/331 (100.00%), Query Frame = 3
Query:   48 MSGQPMLLLLIRYFLAFYAGFLIVIGSLGNIFIIFGMXXXXXXXXXXXXXXXXAGSDTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSKVIDSWQKVCFCAGVSVFVIAMKHAPLLWITHLGNGTVGCSYNKDWCNLAMCPHTWIEFITHSLLPYVLLIPTNISLYIIIRKHSEEAFXXXXXXXXXXXXXXXXXXXXXXXXXXMVSSKILICLSILHFCLSFPGLLYIEFLGVFEIRYFPSDSEESKLLYNALFLLTSTNNALNFFTVLYFSNEFRNTISQMLKLKWFCHGESGEPLW 1040
            MSGQPMLLLLIRYFLAFYAGFLIVIGSLGNIFIIFGMRSNLRIRIPRLILVILAGSDTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSKVIDSW+KVCFCAGVSVFVIAMKHAPLLWITHLGNGTVGCSYNKDWCNLAMCPHTWIEFITHSLLPYVLLIPTNISLYIIIRKHSEEAFRNSGSFNSVRVSRFSRISERSIRNRGMVSSKILICLSILHFCLSFPGLLYIEFLGVFEIRYFPSDSEESKLLYNALFLLTSTNNALNFFTVLYFSNEFRNTISQMLKLKWFCHGESGEPLW
Sbjct:    1 MSGQPMLLLLIRYFLAFYAGFLIVIGSLGNIFIIFGMRSNLRIRIPRLILVILAGSDTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSKVIDSWEKVCFCAGVSVFVIAMKHAPLLWITHLGNGTVGCSYNKDWCNLAMCPHTWIEFITHSLLPYVLLIPTNISLYIIIRKHSEEAFRNSGSFNSVRVSRFSRISERSIRNRGMVSSKILICLSILHFCLSFPGLLYIEFLGVFEIRYFPSDSEESKLLYNALFLLTSTNNALNFFTVLYFSNEFRNTISQMLKLKWFCHGESGEPLW 331          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000063789.1 (SMESG000063789.1)

HSP 1 Score: 112.464 bits (280), Expect = 1.167e-27
Identity = 97/347 (27.95%), Postives = 172/347 (49.57%), Query Frame = 3
Query:   63 MLLLLIRYFLAFYAGFLIVIGSLGNIF--IIFGMXXXXXXXXXXXXXXXXAGSDTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSKVIDSWQKVCFCAGVSVFVIAMKHAPLLWITHLGNGTVGCSYNKDWCNLAMCPH--------------TWIEFITHSLLPYVLLIPTNISLYIIIRKHS---EEAFXXXXXXXXXXXXXXXXXXXXXXXXXXMVSSKILICLSILHFCLSFPGLLYIEFLGVFEI--RYFPSDSE-----ESKLLYNALFLLTSTNNALNFFTVLYFSNEFRNTISQMLKLKWFCHGES 1025
            ML   + + L  Y G LI  G   N+   I+ G          RL++V+LA +D  VL  A+LRYW+   F +DIR+ ++L C+ HTFL  ++TD A+A LC L++ER + + +P +S    + +       +   ++ +K++  +W   + +     +Y  +  N  + P               + I+FIT+S+LPY +L  TN+ ++II+R+ S   +       + N  + +   + + R  +++ ++  KIL  L+++H   S PG        +F I  ++FP + +     + +L+ + L +L  TNNA NF   L  SN FR  I  +L   +  H E+
Sbjct:   11 MLFNKVEFILQVYGGLLIFAGIPANVICGIVMG-TDKTNHFTTRLLMVLLAAADCVVLLTALLRYWVIEAFKVDIRSINSLTCLLHTFLVAVSTDAAIATLCALAIERFIVVGFPYKSIRCVTMKNSIISITMVYLILILKNSFNIWSMEIQSS----NYTLNQQNTIIKPKCIPKRHLLNYVRVFSKIDFITYSVLPYFILFSTNMYIFIILRRQSRILKSHLNPKNTNNKNQRTVSRKKTNRGRQSQNII--KILTALTVVHMITSIPG-------TIFNIITQFFPENLKYISYLKRRLISDGLMMLMFTNNATNFLAYLISSNSFRKRILIVLPCCFQSHSET 343          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000042531.1 (SMESG000042531.1)

HSP 1 Score: 103.219 bits (256), Expect = 1.920e-24
Identity = 93/322 (28.88%), Postives = 156/322 (48.45%), Query Frame = 3
Query:   72 LLIRYFLAFYAGFLIVIGSLGNIFIIFGMXXXXXXXXXXX-XXXXXAGSDTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSKVIDSWQKVCFCAGVSVFVIA--MKHAPLLWI--THLGNGTVGCSYNKDWCNLAMCPHTW-----IEFITHSLLPYVLLIPTNISLYIIIRKHSEEAFXXXXXXXXXXXXXXXXXXXXXXXXXXMVSS------KILICLSILHFCLSFPGLLYIEF---LGVFEIRYFPSDSEESKLLYNALFLLTSTNNALNFFTVLYFSNEFRNT 980
            +L+  F+  YA  LI  G   N F++  +R ++  R     ++++LA +D AVL   VLRYW+  TF  DIR  SN+ C  H FL  +++D A+  LC+++VER + + YP +SK + +   V    G+S FV+   +K++ +LW+   HL N           C   +    W     ++FIT+++LPYV+L   NI +Y  +++  +    N         +     S+     +           K+L  LS++H   + P  +Y      +GV + +Y  +      +++  L LL  TNNA+N F  L+ S  FR  
Sbjct:   19 VLMENFIKIYAAILIFFGIPFNSFVLHILRKDISNRNTTRFLMILLAVADNAVLLTGVLRYWVRATFKYDIRHFSNIACKGHGFLVSVSSDCAIGFLCSIAVERFLVVSYPNQSKTLVTM--VTVICGISGFVLGVILKNSCILWLYQLHLTNNKTDEKLALFECRPQLDSGLWKFFQKLDFITYAILPYVILFFCNIYIYFRLKQQHKALRNNQKLKIKNSDASSGLESQIKPIVKRNKKRRTEHIVKVLTALSLIHAITTLPAAIYQAMKSRIGVNKNQYMHT------IIHENLLLLMFTNNAINIFAYLFSSISFRQQ 332          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000054459.1 (SMESG000054459.1)

HSP 1 Score: 103.219 bits (256), Expect = 2.057e-24
Identity = 77/266 (28.95%), Postives = 135/266 (50.75%), Query Frame = 3
Query:  213 SDTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSKVIDSWQKVCFCAGVSVFVIAMKH-APLLWITHL-GNGTVGCSYNKDWCNLAMCPHTW-----IEFITHSLLPYVLLIPTNISLYIIIRKHSEEAFXXXXXXXXXXXXXXXXXXXXXXXXXXMVSSKILICLSILHFCLSFPGLLYIEFLGV--FEIRYFPSDSEESKLLYNALFLLTSTNNALNFFTVLYFSNEFRNTI 983
            +D+ V+ +AV RYWI + F  DIR  +NL+C+ H+FL  I TD AV  LC L+VER + + +P +S  +    ++ F   + + V + K+ A  +++T + G  +   + N+     +     +     I+F++ +++PYV+L  TNI +Y+++R+            +  + S      ++  + R     KIL  L+I+H   + PG ++        F I     D   +++L ++L LL  TNNALNFF     S  FR  +
Sbjct:   52 TDSLVIVIAVSRYWIFVIFKTDIRIYNNLICMIHSFLVGIVTDLAVGSLCFLAVERFIVVVFPQKSNQLIKVNRILFGIIIFLGVTSFKNSANFVFLTTIHGKNSTNLTVNRKCGPSSQYIQEFAIFKKIDFVSFAVIPYVILFSTNIYIYVVLRRQH-------ILLSKHKSSSTLLNDKKRRKRRPQNVMKILTGLTIIHVITTLPGAIFTMLKNFFPFAINSKNEDPSLNRILTSSLVLLLFTNNALNFFVYYISSTVFRRNV 310          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000042465.1 (SMESG000042465.1)

HSP 1 Score: 103.219 bits (256), Expect = 2.294e-24
Identity = 84/270 (31.11%), Postives = 135/270 (50.00%), Query Frame = 3
Query:  216 DTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFAVAVLCTLSVERLVSMRYPLRSK-VIDSWQKVCFCAGVSVFVIAMKHAPLLWITHLGNGTVGCSYNKDWCNLAMCP--HTWI-------EFITHSLLPYVLLIPTNISLYIIIRKHS---EEAFXXXXXXXXXXXXXXXXXXXXXXXXXXMVSS--KILICLSILHFCLSFPGLLYIEFLGVFEIRYFPSDSEESKLLYNALFLLTSTNNALNFFTVLYFSNEFRNT 980
            D AVL  AVLRYWI  TF+ DIR  +N +C  H FL  I++DFAV  LC ++VER + + YP +SK ++  +  +    G S  VI  K+  ++++ ++ +   G     +   LA  P  ++WI       + +T+++LPY++L   NI +YI +RKH     + ++N      + +          I  +  +    K+L  LS++H   S P  +Y       +I   PS      ++  +L LL  TNNA+N F  L+ S  FR  
Sbjct:   70 DNAVLLTAVLRYWIRATFNYDIRIYNNFVCKTHGFLVSISSDFAVGTLCAIAVERFIVVSYPQKSKSLVTIFTVIVGMIGFSFGVIC-KNICIIYLYNIVSINRG---GNNQTILACKPKLNSWISWGFFKVDLLTYAVLPYLILFFCNIYIYIKLRKHRIILNKTYQNIPKLQQMNLITNEETPIPVIPKKRRIEHIIKVLTALSLIHAITSLPAAIYQSLKAQLKIEDNPS---MHAVIQESLLLLMFTNNAINIFAYLFSSITFRQN 332          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NZI21.883e-2230.30G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A5J4NZ889.258e-2131.41G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A5J4NV705.726e-1928.78G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A183WXX92.317e-1828.98G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A4S2L0225.752e-1827.82G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001813.10.000e+099.70SMESG000001813.1[more]
SMESG000063789.11.167e-2727.95SMESG000063789.1[more]
SMESG000042531.11.920e-2428.88SMESG000042531.1[more]
SMESG000054459.12.057e-2428.95SMESG000054459.1[more]
SMESG000042465.12.294e-2431.11SMESG000042465.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013080 ID=SMED30013080|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1183bp
TTTATTTATTTCCATAATTTTCCTGTCGCAATTTATTGGTGAATGCTATG
TCGGGACAGCCCATGTTGCTGTTGCTTATTCGGTATTTCCTCGCCTTTTA
TGCTGGGTTTCTTATTGTCATCGGATCGCTGGGCAACATCTTCATCATTT
TTGGAATGAGGAGTAACTTGAGGATAAGAATTCCTCGATTGATTCTGGTG
ATCTTGGCGGGATCTGATACAGCAGTTCTGTGGGTGGCAGTGCTGAGGTA
TTGGATTGAGATAACCTTTGACATAGATATCAGAACTTCTAGCAATTTAC
TCTGTGTATTCCACACTTTTCTCACGTACATTACTACAGATTTCGCTGTA
GCGGTGTTGTGCACCTTGTCAGTGGAACGGCTCGTTTCTATGAGATATCC
TCTACGTTCAAAAGTAATCGATTCCTGGCAGAAAGTTTGTTTTTGTGCTG
GTGTCAGTGTGTTTGTGATAGCAATGAAACATGCGCCTCTATTGTGGATC
ACCCATTTGGGAAATGGAACGGTTGGTTGCAGCTATAACAAAGACTGGTG
TAATCTAGCAATGTGTCCTCACACATGGATTGAATTTATAACTCATTCTC
TCCTTCCTTATGTTCTTCTAATACCAACTAATATCAGTTTGTATATTATA
ATTCGAAAGCATTCAGAGGAAGCGTTCCGTAATTCGGGGTCATTTAACAG
TGTCAGAGTGTCAAGATTCAGTCGCATTTCAGAAAGATCTATTCGCAATA
GAGGGATGGTTTCTTCAAAGATTTTAATTTGCCTTAGCATTTTACATTTC
TGTTTGAGTTTTCCAGGACTCCTTTATATAGAATTCCTTGGAGTATTTGA
AATCCGATATTTTCCATCAGATTCTGAAGAGAGCAAGCTGCTTTACAACG
CGTTATTTTTACTGACTTCTACCAACAACGCACTTAATTTCTTTACAGTT
CTCTACTTTAGCAATGAATTCAGAAATACTATTTCCCAAATGCTCAAACT
AAAATGGTTTTGCCATGGCGAGTCTGGAGAACCTCTTTGGTAATAGTAAG
TACAACAGTTTTAATACGGTAGCATCTGTGATACTCCTATAAGAAGGCAT
AATTGGGTGTGTATGGTTATCGTGTAATGAAACATTTTCTTAATAAATTA
TTATTATTACTAGCTTAATACCCGTTGAAAAAT
back to top

protein sequence of SMED30013080-orf-1

>SMED30013080-orf-1 ID=SMED30013080-orf-1|Name=SMED30013080-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=332bp
MSGQPMLLLLIRYFLAFYAGFLIVIGSLGNIFIIFGMRSNLRIRIPRLIL
VILAGSDTAVLWVAVLRYWIEITFDIDIRTSSNLLCVFHTFLTYITTDFA
VAVLCTLSVERLVSMRYPLRSKVIDSWQKVCFCAGVSVFVIAMKHAPLLW
ITHLGNGTVGCSYNKDWCNLAMCPHTWIEFITHSLLPYVLLIPTNISLYI
IIRKHSEEAFRNSGSFNSVRVSRFSRISERSIRNRGMVSSKILICLSILH
FCLSFPGLLYIEFLGVFEIRYFPSDSEESKLLYNALFLLTSTNNALNFFT
VLYFSNEFRNTISQMLKLKWFCHGESGEPLW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 8..323
e-value: 6.7E-27
score: 96.2
NoneNo IPR availablePANTHERPTHR24243:SF208ETHR, ISOFORM Acoord: 11..321
NoneNo IPR availablePANTHERPTHR24243G-PROTEIN COUPLED RECEPTORcoord: 11..321
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 13..312
e-value: 1.06215E-13
score: 68.4284
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 10..323
NoneNo IPR availableTMHMMTMhelixcoord: 85..107
NoneNo IPR availableTMHMMTMhelixcoord: 242..264
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 130..152
NoneNo IPR availableTMHMMTMhelixcoord: 48..70
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 284..306
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 29..301
score: 12.989