SMED30013077

Overview
NameSMED30013077
Smed IDSMED30013077
Length (bp)3259
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30013077 (SMED30013077) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30013077 (SMED30013077) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30013077 (SMED30013077) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30013077 (SMED30013077) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013077

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013077SMESG000076350.1 dd_Smed_v4_7379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013077SMESG000076350.1 dd_Smed_v4_7379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013077SMESG000076350.1 dd_Smed_v4_7379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013077SMESG000076350.1 dd_Smed_v4_7379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013077SMESG000076350.1 dd_Smed_v4_7379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013077SMESG000076350.1 dd_Smed_v4_7379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30013077 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003680:25064..36789 -15600
Homology
BLAST of SMED30013077 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 203.371 bits (516), Expect = 2.098e-52
Identity = 125/481 (25.99%), Postives = 229/481 (47.61%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNI-KAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID---VPD-CNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLI 1659
            + SKSG   LH +   GN++    L++    ++    +G  P+H A + GN ++VK L++ G  ++        P+H A  +GH  V  +L+ R    + +  +   P+H A +  +V+ VK LL  K  ++    +  TALH A   G++ + +LL+  +     N    +    +H AC     +++E+L+     I    +  + P+H A   G+  I  LL+     PD  N+  + A     +  A  +GQ+E+ + L+ N   ++   R ++ P+H AS LG TE+  +L+      +  T     P+ I++    V++  +L+           +   P+HVA + G ++V +LL+      + A      P+HIA++  +++I   LL +GA+TN +     TPL+LA+++GH D+  +L+D G NI   +      +H A Q     +A +L   H +    +  + Y  LI
Sbjct:  199 VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKR--ANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA-----LHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILT-KHGADQDAHTKLGYTPLI 671          

HSP 2 Score: 194.897 bits (494), Expect = 1.032e-49
Identity = 136/503 (27.04%), Postives = 232/503 (46.12%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGH-LAVARILISRQLVNIKAP--------DDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLV--SGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGN----KAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +K G  ALH +   G  + VK L+    +I     +G+ P++ A Q  + D+VKYL+E+G   +   E  F P+  A   GH  AVA +L +     ++ P        DD++                     P+H A   GNV++  LLL    A++       T LH A ++GN ++V+LL+   G++  K  D        +H A  S  +++VE+L+ +   +  +    + PLH A    +    K + Q    V D  ++   A     +  A + G   + KLL+    + N        P+H A      +V  +L+     I+  T     PI +A+   ++ I+ LL+ N  +   TN   E  +H+A + G VEVV+ L+ N   ++    +   P+HIAS  G+ EIV++LL+H A  +   T   TPL+++  +G  DV+ VL++ G      + K + P+H A + G  ++A+LL+    + D+   N
Sbjct:   73 TKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLT----PLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTA-----LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKN 566          

HSP 3 Score: 191.43 bits (485), Expect = 1.166e-48
Identity = 118/489 (24.13%), Postives = 227/489 (46.42%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI---YVYFVNSFK 1692
            ++ GL  LHC+ ++G+   V+ L++    +     +G  P+H A QG + + VK+L++    ++ +       +H A   GH  V ++L+ ++   N +A +   P+H AC+   + +++LL+    +I        T +H A   G+ +IV LL+       + +       A+H A  +   E+V  L+     ++ +  EE  PLH A   G   I QLL+     + +      ++P+  +   GQ+++A +L+      + +T+    P+H A+  G  +VA +L+ R+   +        P+ IA+  N ++I   L+           +   P+H+A Q+G  ++V LL+D   NI+ +    +  +H+A++  +V +  IL +HGAD +       TPL +A   G+  +   L+  G N+  ++   + P+H A Q G   I  +L+      +    N N    I     Y+  V++ K
Sbjct:  267 TRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNI--RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ-HMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 752          

HSP 4 Score: 174.481 bits (441), Expect = 2.505e-43
Identity = 112/464 (24.14%), Postives = 211/464 (45.47%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLI--DHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQ-LVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
             K  L ALH + +  +      L+  DH  D++     G+ P+H A   GN ++   L+  G  ++F       P+H A   G+  + ++L+ R   ++ K  D   P+H A R+G+  +V+LLL     +        + LH A Q  + + V+ L+  K    ++D T     A+H A       + ++L+ K+   N +      PLH AC      + +LL+     ++        +PI  A   G + I  LL+ N    + +    E  +H A+  G  EV   L+     ++     ++ P+ IAS     EI++LL+ +  +  +       P+H++ ++G V+V  +L++     + A  K   P+H+A++ G +++ K+LL+  A  +       TPL++A +K    ++  L++ G      + +   P+H A Q G  ++  LL+D   +I
Sbjct:  168 GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKS--GFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHK--APVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY-GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANI 626          

HSP 5 Score: 146.362 bits (368), Expect = 9.787e-35
Identity = 98/383 (25.59%), Postives = 179/383 (46.74%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            A R GN+D V   L     IN  +     ALH A ++G+  +V+ LL  G     ++ ATK  N A+H A ++   E+V++L+ +   IN ++     PL+ A    +  + + L++    N +    + F+P+  AL  G                               + A LL+ N+ + +  +++   P+H A+  G   VA +L++R   ++        P+ +AS   N  +++LL+     I +   +   P+H A + G  +VV+LL++    +       + P+H+A++   VE VK LL+H A  + +     T L++A   GHY V+K+L+D   N   +++  + P+H AC+    ++ +LLV    SI
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRG---SSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLE-NGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASI 395          

HSP 6 Score: 143.28 bits (360), Expect = 9.708e-34
Identity = 108/424 (25.47%), Postives = 194/424 (45.75%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            A + GN D V   ++ G  +N   +   + +H A   GH+ + + L+ R   V+      +  +H A   G  ++VK+L+     IN      FT L+ A Q+ + D+V+ LL +G  Q     AT+     +  A      + V IL+    E + K    +  LH A    +   A LL+   D N + ++   F+P+  A + G + +A LL+     ++ + R    P+H AS  G T +  +L+DR   I+ +T     P+  A+ + + +++ LL+     + +       P+H+A Q   VE V+ L+ +   ++      +  +H+A+  G   + K+LL+  A+ N       TPL++A +K    V ++L+  G +I+  +     PIH A   G   I  LL+ +  S D  N
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQST---ATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQ-NDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTN 432          

HSP 7 Score: 82.4185 bits (202), Expect = 4.109e-15
Identity = 55/223 (24.66%), Postives = 102/223 (45.74%), Query Frame = 1
Query:  958 ILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
             L A  +G ++     +    DIN   +     +H A+  G   +   L+ R   ++  T      + IAS     E++++L+    NI + +     P+++A Q+  ++VV+ L++N  N + A +    P+ +A + G  + V ILLE     N      R P L++A  K     + +L+ N  N + QS   + P+H A   G   +A LL++   ++D
Sbjct:   14 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVD 231          

HSP 8 Score: 79.7221 bits (195), Expect = 3.003e-14
Identity = 53/213 (24.88%), Postives = 86/213 (40.38%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL------------VNIKAPDDS----------------------RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFA 768
            L +K G   LH + K G+LD  K L+  +   +    +GY P+H A +     I   L+  G   N + ++   P+H A   GH  +  +L+ +              +++ A +D                        P+  AC  GNV +V  LL     +N      +T LH A QQG+  I+ +L+  +   K N  T + N A+  A
Sbjct:  529 LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL--QHGAKPNATTANGNTALAIA 739          

HSP 9 Score: 58.9214 bits (141), Expect = 7.136e-8
Identity = 32/125 (25.60%), Postives = 63/125 (50.40%), Query Frame = 1
Query: 1264 ACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            A + G ++ V   +    +IN  N   +  +H+A++ G V +V+ LL  G+  +       T L++A+  G  +V KVL+  G NI  QS   + P++ A Q    ++ + L+++  +  T  ++
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATED 141          

HSP 10 Score: 54.299 bits (129), Expect = 1.740e-6
Identity = 26/83 (31.33%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+A   GN+N+  LL++ G+ ++   R+   P+H A + GN +++K L+     I  K     TPL      G+D  V  L
Sbjct:  207 PLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL 289          
BLAST of SMED30013077 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 203.371 bits (516), Expect = 2.098e-52
Identity = 125/481 (25.99%), Postives = 229/481 (47.61%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNI-KAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID---VPD-CNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLI 1659
            + SKSG   LH +   GN++    L++    ++    +G  P+H A + GN ++VK L++ G  ++        P+H A  +GH  V  +L+ R    + +  +   P+H A +  +V+ VK LL  K  ++    +  TALH A   G++ + +LL+  +     N    +    +H AC     +++E+L+     I    +  + P+H A   G+  I  LL+     PD  N+  + A     +  A  +GQ+E+ + L+ N   ++   R ++ P+H AS LG TE+  +L+      +  T     P+ I++    V++  +L+           +   P+HVA + G ++V +LL+      + A      P+HIA++  +++I   LL +GA+TN +     TPL+LA+++GH D+  +L+D G NI   +      +H A Q     +A +L   H +    +  + Y  LI
Sbjct:  199 VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKR--ANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA-----LHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILT-KHGADQDAHTKLGYTPLI 671          

HSP 2 Score: 194.897 bits (494), Expect = 1.032e-49
Identity = 136/503 (27.04%), Postives = 232/503 (46.12%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGH-LAVARILISRQLVNIKAP--------DDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLV--SGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGN----KAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +K G  ALH +   G  + VK L+    +I     +G+ P++ A Q  + D+VKYL+E+G   +   E  F P+  A   GH  AVA +L +     ++ P        DD++                     P+H A   GNV++  LLL    A++       T LH A ++GN ++V+LL+   G++  K  D        +H A  S  +++VE+L+ +   +  +    + PLH A    +    K + Q    V D  ++   A     +  A + G   + KLL+    + N        P+H A      +V  +L+     I+  T     PI +A+   ++ I+ LL+ N  +   TN   E  +H+A + G VEVV+ L+ N   ++    +   P+HIAS  G+ EIV++LL+H A  +   T   TPL+++  +G  DV+ VL++ G      + K + P+H A + G  ++A+LL+    + D+   N
Sbjct:   73 TKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLT----PLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTA-----LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKN 566          

HSP 3 Score: 191.43 bits (485), Expect = 1.166e-48
Identity = 118/489 (24.13%), Postives = 227/489 (46.42%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI---YVYFVNSFK 1692
            ++ GL  LHC+ ++G+   V+ L++    +     +G  P+H A QG + + VK+L++    ++ +       +H A   GH  V ++L+ ++   N +A +   P+H AC+   + +++LL+    +I        T +H A   G+ +IV LL+       + +       A+H A  +   E+V  L+     ++ +  EE  PLH A   G   I QLL+     + +      ++P+  +   GQ+++A +L+      + +T+    P+H A+  G  +VA +L+ R+   +        P+ IA+  N ++I   L+           +   P+H+A Q+G  ++V LL+D   NI+ +    +  +H+A++  +V +  IL +HGAD +       TPL +A   G+  +   L+  G N+  ++   + P+H A Q G   I  +L+      +    N N    I     Y+  V++ K
Sbjct:  267 TRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNI--RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ-HMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 752          

HSP 4 Score: 174.481 bits (441), Expect = 2.505e-43
Identity = 112/464 (24.14%), Postives = 211/464 (45.47%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLI--DHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQ-LVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
             K  L ALH + +  +      L+  DH  D++     G+ P+H A   GN ++   L+  G  ++F       P+H A   G+  + ++L+ R   ++ K  D   P+H A R+G+  +V+LLL     +        + LH A Q  + + V+ L+  K    ++D T     A+H A       + ++L+ K+   N +      PLH AC      + +LL+     ++        +PI  A   G + I  LL+ N    + +    E  +H A+  G  EV   L+     ++     ++ P+ IAS     EI++LL+ +  +  +       P+H++ ++G V+V  +L++     + A  K   P+H+A++ G +++ K+LL+  A  +       TPL++A +K    ++  L++ G      + +   P+H A Q G  ++  LL+D   +I
Sbjct:  168 GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKS--GFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHK--APVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY-GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANI 626          

HSP 5 Score: 146.362 bits (368), Expect = 9.787e-35
Identity = 98/383 (25.59%), Postives = 179/383 (46.74%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            A R GN+D V   L     IN  +     ALH A ++G+  +V+ LL  G     ++ ATK  N A+H A ++   E+V++L+ +   IN ++     PL+ A    +  + + L++    N +    + F+P+  AL  G                               + A LL+ N+ + +  +++   P+H A+  G   VA +L++R   ++        P+ +AS   N  +++LL+     I +   +   P+H A + G  +VV+LL++    +       + P+H+A++   VE VK LL+H A  + +     T L++A   GHY V+K+L+D   N   +++  + P+H AC+    ++ +LLV    SI
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRG---SSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLE-NGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASI 395          

HSP 6 Score: 143.28 bits (360), Expect = 9.708e-34
Identity = 108/424 (25.47%), Postives = 194/424 (45.75%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            A + GN D V   ++ G  +N   +   + +H A   GH+ + + L+ R   V+      +  +H A   G  ++VK+L+     IN      FT L+ A Q+ + D+V+ LL +G  Q     AT+     +  A      + V IL+    E + K    +  LH A    +   A LL+   D N + ++   F+P+  A + G + +A LL+     ++ + R    P+H AS  G T +  +L+DR   I+ +T     P+  A+ + + +++ LL+     + +       P+H+A Q   VE V+ L+ +   ++      +  +H+A+  G   + K+LL+  A+ N       TPL++A +K    V ++L+  G +I+  +     PIH A   G   I  LL+ +  S D  N
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQST---ATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQ-NDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTN 432          

HSP 7 Score: 82.4185 bits (202), Expect = 4.109e-15
Identity = 55/223 (24.66%), Postives = 102/223 (45.74%), Query Frame = 1
Query:  958 ILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
             L A  +G ++     +    DIN   +     +H A+  G   +   L+ R   ++  T      + IAS     E++++L+    NI + +     P+++A Q+  ++VV+ L++N  N + A +    P+ +A + G  + V ILLE     N      R P L++A  K     + +L+ N  N + QS   + P+H A   G   +A LL++   ++D
Sbjct:   14 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVD 231          

HSP 8 Score: 79.7221 bits (195), Expect = 3.003e-14
Identity = 53/213 (24.88%), Postives = 86/213 (40.38%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL------------VNIKAPDDS----------------------RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFA 768
            L +K G   LH + K G+LD  K L+  +   +    +GY P+H A +     I   L+  G   N + ++   P+H A   GH  +  +L+ +              +++ A +D                        P+  AC  GNV +V  LL     +N      +T LH A QQG+  I+ +L+  +   K N  T + N A+  A
Sbjct:  529 LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL--QHGAKPNATTANGNTALAIA 739          

HSP 9 Score: 58.9214 bits (141), Expect = 7.136e-8
Identity = 32/125 (25.60%), Postives = 63/125 (50.40%), Query Frame = 1
Query: 1264 ACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            A + G ++ V   +    +IN  N   +  +H+A++ G V +V+ LL  G+  +       T L++A+  G  +V KVL+  G NI  QS   + P++ A Q    ++ + L+++  +  T  ++
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATED 141          

HSP 10 Score: 54.299 bits (129), Expect = 1.740e-6
Identity = 26/83 (31.33%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+A   GN+N+  LL++ G+ ++   R+   P+H A + GN +++K L+     I  K     TPL      G+D  V  L
Sbjct:  207 PLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL 289          
BLAST of SMED30013077 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 203.371 bits (516), Expect = 2.569e-52
Identity = 125/481 (25.99%), Postives = 229/481 (47.61%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNI-KAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID---VPD-CNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLI 1659
            + SKSG   LH +   GN++    L++    ++    +G  P+H A + GN ++VK L++ G  ++        P+H A  +GH  V  +L+ R    + +  +   P+H A +  +V+ VK LL  K  ++    +  TALH A   G++ + +LL+  +     N    +    +H AC     +++E+L+     I    +  + P+H A   G+  I  LL+     PD  N+  + A     +  A  +GQ+E+ + L+ N   ++   R ++ P+H AS LG TE+  +L+      +  T     P+ I++    V++  +L+           +   P+HVA + G ++V +LL+      + A      P+HIA++  +++I   LL +GA+TN +     TPL+LA+++GH D+  +L+D G NI   +      +H A Q     +A +L   H +    +  + Y  LI
Sbjct:  199 VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKR--ANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETA-----LHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILT-KHGADQDAHTKLGYTPLI 671          

HSP 2 Score: 194.897 bits (494), Expect = 1.025e-49
Identity = 136/503 (27.04%), Postives = 232/503 (46.12%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGH-LAVARILISRQLVNIKAP--------DDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLV--SGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGN----KAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +K G  ALH +   G  + VK L+    +I     +G+ P++ A Q  + D+VKYL+E+G   +   E  F P+  A   GH  AVA +L +     ++ P        DD++                     P+H A   GNV++  LLL    A++       T LH A ++GN ++V+LL+   G++  K  D        +H A  S  +++VE+L+ +   +  +    + PLH A    +    K + Q    V D  ++   A     +  A + G   + KLL+    + N        P+H A      +V  +L+     I+  T     PI +A+   ++ I+ LL+ N  +   TN   E  +H+A + G VEVV+ L+ N   ++    +   P+HIAS  G+ EIV++LL+H A  +   T   TPL+++  +G  DV+ VL++ G      + K + P+H A + G  ++A+LL+    + D+   N
Sbjct:   73 TKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLT----PLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTA-----LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKN 566          

HSP 3 Score: 191.43 bits (485), Expect = 1.352e-48
Identity = 118/489 (24.13%), Postives = 227/489 (46.42%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI---YVYFVNSFK 1692
            ++ GL  LHC+ ++G+   V+ L++    +     +G  P+H A QG + + VK+L++    ++ +       +H A   GH  V ++L+ ++   N +A +   P+H AC+   + +++LL+    +I        T +H A   G+ +IV LL+       + +       A+H A  +   E+V  L+     ++ +  EE  PLH A   G   I QLL+     + +      ++P+  +   GQ+++A +L+      + +T+    P+H A+  G  +VA +L+ R+   +        P+ IA+  N ++I   L+           +   P+H+A Q+G  ++V LL+D   NI+ +    +  +H+A++  +V +  IL +HGAD +       TPL +A   G+  +   L+  G N+  ++   + P+H A Q G   I  +L+      +    N N    I     Y+  V++ K
Sbjct:  267 TRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNI--RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ-HMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 752          

HSP 4 Score: 174.096 bits (440), Expect = 2.918e-43
Identity = 112/464 (24.14%), Postives = 211/464 (45.47%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLI--DHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQ-LVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
             K  L ALH + +  +      L+  DH  D++     G+ P+H A   GN ++   L+  G  ++F       P+H A   G+  + ++L+ R   ++ K  D   P+H A R+G+  +V+LLL     +        + LH A Q  + + V+ L+  K    ++D T     A+H A       + ++L+ K+   N +      PLH AC      + +LL+     ++        +PI  A   G + I  LL+ N    + +    E  +H A+  G  EV   L+     ++     ++ P+ IAS     EI++LL+ +  +  +       P+H++ ++G V+V  +L++     + A  K   P+H+A++ G +++ K+LL+  A  +       TPL++A +K    ++  L++ G      + +   P+H A Q G  ++  LL+D   +I
Sbjct:  168 GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKS--GFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHK--APVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKY-GASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANI 626          

HSP 5 Score: 146.362 bits (368), Expect = 1.152e-34
Identity = 98/383 (25.59%), Postives = 179/383 (46.74%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            A R GN+D V   L     IN  +     ALH A ++G+  +V+ LL  G     ++ ATK  N A+H A ++   E+V++L+ +   IN ++     PL+ A    +  + + L++    N +    + F+P+  AL  G                               + A LL+ N+ + +  +++   P+H A+  G   VA +L++R   ++        P+ +AS   N  +++LL+     I +   +   P+H A + G  +VV+LL++    +       + P+H+A++   VE VK LL+H A  + +     T L++A   GHY V+K+L+D   N   +++  + P+H AC+    ++ +LLV    SI
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRG---SSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLE-NGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASI 395          

HSP 6 Score: 143.28 bits (360), Expect = 1.104e-33
Identity = 108/424 (25.47%), Postives = 194/424 (45.75%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            A + GN D V   ++ G  +N   +   + +H A   GH+ + + L+ R   V+      +  +H A   G  ++VK+L+     IN      FT L+ A Q+ + D+V+ LL +G  Q     AT+     +  A      + V IL+    E + K    +  LH A    +   A LL+   D N + ++   F+P+  A + G + +A LL+     ++ + R    P+H AS  G T +  +L+DR   I+ +T     P+  A+ + + +++ LL+     + +       P+H+A Q   VE V+ L+ +   ++      +  +H+A+  G   + K+LL+  A+ N       TPL++A +K    V ++L+  G +I+  +     PIH A   G   I  LL+ +  S D  N
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQST---ATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQ-NDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTN 432          

HSP 7 Score: 82.4185 bits (202), Expect = 4.177e-15
Identity = 55/223 (24.66%), Postives = 102/223 (45.74%), Query Frame = 1
Query:  958 ILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
             L A  +G ++     +    DIN   +     +H A+  G   +   L+ R   ++  T      + IAS     E++++L+    NI + +     P+++A Q+  ++VV+ L++N  N + A +    P+ +A + G  + V ILLE     N      R P L++A  K     + +L+ N  N + QS   + P+H A   G   +A LL++   ++D
Sbjct:   14 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVD 231          

HSP 8 Score: 79.7221 bits (195), Expect = 3.077e-14
Identity = 53/213 (24.88%), Postives = 86/213 (40.38%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL------------VNIKAPDDS----------------------RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFA 768
            L +K G   LH + K G+LD  K L+  +   +    +GY P+H A +     I   L+  G   N + ++   P+H A   GH  +  +L+ +              +++ A +D                        P+  AC  GNV +V  LL     +N      +T LH A QQG+  I+ +L+  +   K N  T + N A+  A
Sbjct:  529 LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL--QHGAKPNATTANGNTALAIA 739          

HSP 9 Score: 58.5362 bits (140), Expect = 7.294e-8
Identity = 32/125 (25.60%), Postives = 63/125 (50.40%), Query Frame = 1
Query: 1264 ACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            A + G ++ V   +    +IN  N   +  +H+A++ G V +V+ LL  G+  +       T L++A+  G  +V KVL+  G NI  QS   + P++ A Q    ++ + L+++  +  T  ++
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATED 141          

HSP 10 Score: 54.299 bits (129), Expect = 1.690e-6
Identity = 26/83 (31.33%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+A   GN+N+  LL++ G+ ++   R+   P+H A + GN +++K L+     I  K     TPL      G+D  V  L
Sbjct:  207 PLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL 289          
BLAST of SMED30013077 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 200.29 bits (508), Expect = 8.690e-52
Identity = 126/468 (26.92%), Postives = 228/468 (48.72%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGH-LAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +K G  ALH +   G  + VK L+    +I     +G+ P++ A Q  + D+VKYL+E+G   +   E  F P+  A   GH  AVA +L +     ++ P     +H A R  +     LLL +    +V     FT LH A   GN ++  LL++      ++   ++    +H A    +  +V++L+ +  +I+ K  + + PLH A  +G+  + +LL++     +  +     SP+  A     +E  K L+ +   ++  T      +H A+  G   V  +L+D++ +     +    PI +A+   ++ I+ LL+ N  +   TN   E  +H+A + G VEVV+ L+ N   ++    +   P+HIAS  G+ EIV++LL+H A  +   T   TPL+++  +G  DV+ VL++ G      + K + P+H A + G  ++A+LL+    + D+   N
Sbjct:   57 TKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLP----ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLN--RGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLER-GAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKN 517          

HSP 2 Score: 192.586 bits (488), Expect = 2.355e-49
Identity = 122/489 (24.95%), Postives = 220/489 (44.99%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLA-VARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI---YVYFVNSFK 1692
            +++G+  LH + K GN + VK L+D    I+     G  P+H A + G+  +V+ L+E G  +    +    P+H A    H+  V  +L  +  V+    D    +H A   G+  + KLLL  +   N       T +H A   G+ +IV LL+       + +       A+H A  +   E+V  L+     ++ +  EE  PLH A   G   I QLL+     + +      ++P+  +   GQ+++A +L+      + +T+    P+H A+  G  +VA +L+ R+   +        P+ IA+  N ++I   L+           +   P+H+A Q+G  ++V LL+D   NI+ +    +  +H+A++  +V +  IL +HGAD +       TPL +A   G+  +   L+  G N+  ++   + P+H A Q G   I  +L+      +    N N    I     Y+  V++ K
Sbjct:  218 ARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNI--RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ-HMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 703          

HSP 3 Score: 149.828 bits (377), Expect = 6.851e-36
Identity = 114/459 (24.84%), Postives = 200/459 (43.57%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVE---------------------------------VVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            A + GN D V   ++ G  +N   +   + +H A   GH+ + + L+ R   V+      +  +H A   G  ++VK+L+     IN      FT L+ A Q+ + D+V+ LL +G  Q     AT+     +  A      + V IL+    E + K    +  LH A    +   A LL+   D N + ++   F+P+  A + G + +A LL+     ++ + R    P+H AS  G T +  +L+DR   I+ +T     P+  A+ + + +++ LL+     + +       P+H+A Q   VE                                 V +LL+D   N N      + PIH+A+  G + IV +LL++GA  +       T L++A   G  +V + L+ NG  ++ ++ ++  P+H A + G  EI QLL+      D    N
Sbjct:    1 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQST---ATEDGFTPLAVALQQGHNQAVAILL----ENDTKGKVRLPALHIAARKDDTKSAALLLQ-NDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN 451          

HSP 4 Score: 78.5666 bits (192), Expect = 5.360e-14
Identity = 53/213 (24.88%), Postives = 86/213 (40.38%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL------------VNIKAPDDS----------------------RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFA 768
            L +K G   LH + K G+LD  K L+  +   +    +GY P+H A +     I   L+  G   N + ++   P+H A   GH  +  +L+ +              +++ A +D                        P+  AC  GNV +V  LL     +N      +T LH A QQG+  I+ +L+  +   K N  T + N A+  A
Sbjct:  480 LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL--QHGAKPNATTANGNTALAIA 690          

HSP 5 Score: 53.9138 bits (128), Expect = 1.990e-6
Identity = 26/83 (31.33%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+A   GN+N+  LL++ G+ ++   R+   P+H A + GN +++K L+     I  K     TPL      G+D  V  L
Sbjct:  191 PLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL 273          
BLAST of SMED30013077 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 200.29 bits (508), Expect = 2.124e-51
Identity = 118/460 (25.65%), Postives = 218/460 (47.39%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHC 1614
            SK+G   LH +    NL+  + L++    +     +G  P+H A + GN  +V+ L++ G  +    +    P+H A  NGH+ ++ IL+     +  K  +   PIH A +  ++D V+LLL     I+    +  T LH A   G+H + ++L+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  N +  +P+  A  +G  E+AK L+ N   +N   +  + P+H A+ +G T +  +L++   +    T     P+ IA+   +VE +  L+    +      +   P+HVA + G V V +LL++   + N A    + P+H+A  +  ++IVK+LL  G   +       TPL++A ++   +V++ L+  G +   +S++   P+H A Q G  E+  LL+    
Sbjct:  203 SKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKG--AKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQA 659          

HSP 2 Score: 199.134 bits (505), Expect = 4.846e-51
Identity = 126/495 (25.45%), Postives = 230/495 (46.46%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQC----------------------DIECETILKR------------RPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            +K  L  LHC+ +NG++   + L+DH   I+    +G  PIH A QG + D V+ L++    ++ +      P+H A   GH  VA++L+ +    N +A +   P+H AC+  +V +++LLL +  +I+       T LH A   G+  IV+ L+       +++        +H A  +   E+ + L+  K ++N K  ++  PLH A   G+  + +LL++  + N N       +P+  A   G +E    L+       C T+    P+H A+  G   VA +L++R                        DI  + +L R             P+ IA+  N VE+ R L+    +  + + +   P+H+A Q+G  E+V LL+    N N  N   + P+H+ ++ G V +  +L++HG   +       TPL++A+  G+  + K L+ +  ++  ++   + P+H A Q G  +I  LL+ +  S
Sbjct:  269 TKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNV--KVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLEN-NANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDI-VKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGAS 759          

HSP 3 Score: 195.282 bits (495), Expect = 7.001e-50
Identity = 119/454 (26.21%), Postives = 213/454 (46.92%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR----QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            L  LH +   G+    K L+D          +G+ P+H AC+  +  +++ L+++G  ++ + E    P+H A   GHL + + L+ R     + N+K      P+H A R G+ ++ K LL +K  +N    +  T LH A + G+ ++V+LL+        N AT + +  +H A      E V  L+ K+    C   +   PLH A   G   +A+LL++  D + N       +P+  A++   ++I KLL+      +        P+H A+     EVA  L+        E++    P+ +A+   + E++ LL++   N    N     P+H+  Q+G V V  +LI +   ++        P+H+AS  G +++VK LL+H AD N       +PL+ A ++GH D+  +L+ NG +    S     P+  A + G+  +  +L
Sbjct:  339 LTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKV---ETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENN--ANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLER-DAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 4 Score: 191.045 bits (484), Expect = 1.845e-48
Identity = 117/466 (25.11%), Postives = 217/466 (46.57%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
             K  L ALH + +N +      L+ +  + + +   G+ P+H A    N ++ + L+  G  +NF  +    P+H A   G++ + R+L+ R   +  K  D+  P+H A R G+V + ++LL     I        + +H A Q  + D VRLL+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++       +P+  A   G + I K L+      N S    E P+H A+  G TEVA  L+  +  +  +    + P+  A+   +  +++LL+ N+ N          P+H+A ++G VE V  L++   +  C   K   P+H+A++ G+V + ++LLE  A  N       TPL++A    + D+ K+L+  G +    +   + P+H A +    E+A+ L+    S + E+
Sbjct:  170 GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLL--QYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKT-GASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAES 632          

HSP 5 Score: 177.948 bits (450), Expect = 1.908e-44
Identity = 129/524 (24.62%), Postives = 229/524 (43.70%), Query Frame = 1
Query:  136 SKRLDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRP-----------------------------IHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            S  LD+ + HLR  ++I                 +++GLN LH + K G++  V  L+  +  +E     G   +H A   G  ++V+ L+  G  +N   +K F P++ A    HL V + L+      N+   D   P                             +H A R  +     +LL +    +V     FT LH A    N ++ +LL++      +N   ++    +H A    +  +V +L+ +  +I  K  +E+ PLH A  NG+  I+++L+D     +  K     SPI  A     ++  +LL+  + +I+  T     P+H A+  G   VA +L+D+        +    P+ IA   N+V ++ LL+    +I +  +    P+HVA   G + +V+ L+    + N +N K+  P+H+A+  G  E+ K LL++ A  N      +TPL+ A   GH ++ K+L++N  N    +     P+H A + G  E    L++   S
Sbjct:   22 SGNLDKALDHLRNGVDINTC--------------NQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRG--ASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDH-GAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS 528          

HSP 6 Score: 145.976 bits (367), Expect = 1.683e-34
Identity = 96/397 (24.18%), Postives = 183/397 (46.10%), Query Frame = 1
Query:  520 VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            V  +  D +     A R+GN+D     L +   IN  +      LH A ++G+  +V  L+  ++   +   TK  N A+H A ++  +E+V  L+     +N ++ +   PL+ A    +  + + L++    N N    + F+P+  AL  G                                 A +L+ N+ + +  ++T   P+H A+      VA +L++R   +         P+ IAS   NV ++RLL+     I++   +   P+H A + G V + ++L+D+   I       + PIH+A++   ++ V++LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     + +LL+ +  SID
Sbjct:    5 VGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEI--ILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASID 398          

HSP 7 Score: 108.997 bits (271), Expect = 3.496e-23
Identity = 72/292 (24.66%), Postives = 129/292 (44.18%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHML 1104
            L + +G   LH + + G+++ V  L++ +    C+   G+ P+H A + G   + + L+E     N   +    P+H A  + +L + ++L+ R    +  A +   P+H A +   V++ + LL    + N    +  T LH A Q+G+ ++V LL+S   Q   N   KS    +H         + ++LI     ++        PLH A   GN  + + L+     +VN K    +SP+  A   G  +I  LL+ N    N  +     P+  A  LG+  V  +L
Sbjct:  498 LATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSK--QANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQH-QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 8 Score: 81.6481 bits (200), Expect = 7.035e-15
Identity = 58/268 (21.64%), Postives = 118/268 (44.03%), Query Frame = 1
Query:  922 NVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKP-----------------------------IHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +V  + A+  +  L A  SG ++ A   + N  DIN   +     +H AS  G  ++   L+ ++  +E  T      + IA+     E++R L+    N+ + + +   P+++A Q+  +EVV+ L++N  N N A +    P                             +HIA+ N       +LL++  + + +     TPL++A    + +V+++L++ G ++         P+H A + G   + +LL+D    I+T+  +
Sbjct:    4 SVGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKD 271          

HSP 9 Score: 66.2402 bits (160), Expect = 3.848e-10
Identity = 38/143 (26.57%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLV-NIKAPDDSRPIHYACRTGNV---DLVKLLLASKCAINVADSEKFT 648
            L +KSGL  LH   + G++     LI H   ++     GY P+H A   GN  +VK+L++    +N   +  + P+H A   GH  +  +L+      N  + D + P+  A R G +   D++K++      + V+D  + +
Sbjct:  663 LGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMS 805          

HSP 10 Score: 54.6842 bits (130), Expect = 1.251e-6
Identity = 34/139 (24.46%), Postives = 63/139 (45.32%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIIN 2773
            P+H+A   GN+ +VK L+ H +++    +    P+H A + G+ D++  L+ N  + +  +   +TPL + K  GY      L  V D    +    +H   + F E  D   +  +  D G  ++      R SR ++
Sbjct:  704 PLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHR--MSFPETVD--EILDVSEDEGEELISFKAERRDSRDVD 838          

HSP 11 Score: 52.373 bits (124), Expect = 5.768e-6
Identity = 24/83 (28.92%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+A   GN+ +V+LL+D G+ +E   +    P+H A  NG++ + + L+ +   I  K     +P+ +     + DCV  L
Sbjct:  242 PLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 324          
BLAST of SMED30013077 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 208.379 bits (529), Expect = 2.421e-54
Identity = 127/474 (26.79%), Postives = 225/474 (47.47%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSL 1656
            +K  L  LHC+ ++G+   V  L+     I     +G  P+H A QG + D  + L+     ++ +      P+H A   GH+ VA++L+ R    N +A +   P+H AC+   + +V+LLL  + AI        T LH A   G  +IV  L+       +   T      +H A  +   ++V +LI    +++ +  E   PLH A   GN  I  LL+     N N    + +SP+  A   GQ E+A +L+ +N D    T+    P+H AS  G  EV  +L++R   ++ E   +  P+ +A+  NN ++  LL+ N  + K+       P+H+A +K  +E+   L+    + N  +     P+H++++ G  EI  +L+E+G+D         T ++L  ++ H  V+++L +NG  I  ++   + P+H AC  G   + + LV++   +  E    +Y  L
Sbjct:  290 TKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE--TVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQA-GANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVG-EKTRASYTPL 759          

HSP 2 Score: 182.57 bits (462), Expect = 2.717e-46
Identity = 125/524 (23.85%), Postives = 237/524 (45.23%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA----------------------PDDSR-----PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVS-GKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            ++ G  ALH +   G    V  L+++  ++     +G+ P++ A Q  + ++VKYL++ G       E  F P+  A   GH  V  +L+   S+  V + A                      PD +      P+H A   G+ ++ +LLL     +N       + LH A + G  ++  LL+S G +   I+  TK     +H A  S  +++V++L+ +   I+ K    + PLH A                                    G+  +A+LL+D    + N +    F+P+  A    +I++ +LL+     I  +T +   P+H A+ +G   +   L+ +  + + ET+    P+ +A+  N  +++R+LI N   + +   E + P+H+A + G  ++V LL+    N N        P+HIA++ G+ E+  ILL+H AD   +     TPL+LA++ G+ +V ++L++ G  ++ +   +  P+H A      ++A LL+++  S
Sbjct:   96 TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI---IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGAS 615          

HSP 3 Score: 176.022 bits (445), Expect = 3.199e-44
Identity = 111/451 (24.61%), Postives = 207/451 (45.90%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            L  LH +   G++   K L+D   D      +G+ P+H AC+     +V+ L++    +    E    P+H A   G + +   L+ +    +++      P+H A R    D+V++L+ +   ++    E  T LH A + GN DIV LL+        N  T+     +H A     EE+  IL+    +      +   PLH A   GN  + +LL++     V+ +   + +P+  A +    ++A LL+ N      + +    P+H A+     E+A  L+  + D   ++     P+ +++   + EI  LLI N  ++ +  +     +H+  Q+  V V Q+L +N   IN   +    P+H+A   G++ +VK L+E+GAD       + TPL+ A ++GH +  + L++NG +   Q+     P+  A + G+  + + L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 161.77 bits (408), Expect = 7.365e-40
Identity = 107/455 (23.52%), Postives = 216/455 (47.47%), Query Frame = 1
Query:  268 SCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            + + G+L+ V  L+    DI   + +G   +H A + G+ ++V+ LI+    ++    K    +H A + G   +  IL+     VN+++ +   P++ A +  + ++VK LL       ++  + FT L  A QQG+  +V +L+    + K+         A+H A   +      +L+  +   +  +     PLH A   G++ + QLL++    NVN +     SP+  A   G+  +A LL++    I+  T+    P+H A+  G  +V  +L+ +   I  +T     P+ +A+  ++V+  R L+ +   +     +   P+HVA   G V V +LL+D   + N        P+HIA +  R+++V++LL++ A          TPL++A   G  ++   L+  G N + ++++   P+H A +    ++ ++L+ +   +D +
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLP------ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEK-GANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ 487          

HSP 5 Score: 143.28 bits (360), Expect = 4.136e-34
Identity = 92/410 (22.44%), Postives = 187/410 (45.61%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEI-----------------------------AKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN-------VNYFSLINIYVYFVN 1683
            A R G+++ V  LL +   IN +++    +LH A ++G+ ++VR L+  K Q +++ AT+  N A+H A ++    IV IL+     +N ++     PL+ A    ++ + + L+     N      + F+P+  AL  G   +                             A LL+ N  + + ++++   P+H A+  G   V  +L+++  ++  +      P+ +A+      +  LL++    I S   +   P+H A + G  +VV LL+     I+      + P+H+A++   V+  + LL H A  + +     TPL++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    +I+   ++         +   INI +Y + 
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELI--KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH-GANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ 446          

HSP 6 Score: 132.88 bits (333), Expect = 5.860e-31
Identity = 91/361 (25.21%), Postives = 157/361 (43.49%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI----SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLL 1302
            +++  G   LH + +    D V+ LI +   ++        P+H A + GN DIV  L+++G   N      + P+H A   G   VA IL+     + L+  K      P+H A + GN+++V+LLL     +++    + T LH A    N  +  LL+      K   A K+    +H A      EI   L+  K + N K+     PLH +   G+K I+ LLI+    +V  K     + +        + +A++L  N  +IN  T     P+H A   G   +   L++   D+  +T     P+  A+   +   +R L+ N  +        + P+ +A + G+V VV+ L
Sbjct:  453 VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG---FTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA--AAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIEN-GSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 90.1225 bits (222), Expect = 6.595e-18
Identity = 66/265 (24.91%), Postives = 111/265 (41.89%), Query Frame = 1
Query:  940 AEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILL-------------------------------EHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNV 1641
            AE  +  L A  +G +E    L+    DIN S       +H AS  G +EV   LI RQ  ++  T      + IAS      I+ +L+ N  N+   +     P+++A Q+   EVV+ L+ +  N   + +    P+ +A + G   +V +LL                               EH  D      +  TPL++A   GH +V ++L++ G N+  Q+     P+H A + G   +A LL+     ID+   ++
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL 293          

HSP 8 Score: 57.3806 bits (137), Expect = 7.656e-8
Identity = 26/83 (31.33%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+AC  G LN+VK LV++G+++    R++  P+H A + G+ + ++ L+ N  + + +     TPL + +  GY   V  L
Sbjct:  725 PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 9 Score: 53.1434 bits (126), Expect = 1.353e-6
Identity = 24/82 (29.27%), Postives = 44/82 (53.66%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +HL     ++ + ++L ++G+ +     +   P+H AC  G L+++K LV N   +  K  AS TPL      G+++CV +L
Sbjct:  693 MHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          
BLAST of SMED30013077 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 208.379 bits (529), Expect = 2.421e-54
Identity = 127/474 (26.79%), Postives = 225/474 (47.47%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSL 1656
            +K  L  LHC+ ++G+   V  L+     I     +G  P+H A QG + D  + L+     ++ +      P+H A   GH+ VA++L+ R    N +A +   P+H AC+   + +V+LLL  + AI        T LH A   G  +IV  L+       +   T      +H A  +   ++V +LI    +++ +  E   PLH A   GN  I  LL+     N N    + +SP+  A   GQ E+A +L+ +N D    T+    P+H AS  G  EV  +L++R   ++ E   +  P+ +A+  NN ++  LL+ N  + K+       P+H+A +K  +E+   L+    + N  +     P+H++++ G  EI  +L+E+G+D         T ++L  ++ H  V+++L +NG  I  ++   + P+H AC  G   + + LV++   +  E    +Y  L
Sbjct:  290 TKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE--TVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQA-GANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVG-EKTRASYTPL 759          

HSP 2 Score: 182.57 bits (462), Expect = 2.717e-46
Identity = 125/524 (23.85%), Postives = 237/524 (45.23%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA----------------------PDDSR-----PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVS-GKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            ++ G  ALH +   G    V  L+++  ++     +G+ P++ A Q  + ++VKYL++ G       E  F P+  A   GH  V  +L+   S+  V + A                      PD +      P+H A   G+ ++ +LLL     +N       + LH A + G  ++  LL+S G +   I+  TK     +H A  S  +++V++L+ +   I+ K    + PLH A                                    G+  +A+LL+D    + N +    F+P+  A    +I++ +LL+     I  +T +   P+H A+ +G   +   L+ +  + + ET+    P+ +A+  N  +++R+LI N   + +   E + P+H+A + G  ++V LL+    N N        P+HIA++ G+ E+  ILL+H AD   +     TPL+LA++ G+ +V ++L++ G  ++ +   +  P+H A      ++A LL+++  S
Sbjct:   96 TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI---IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGAS 615          

HSP 3 Score: 176.022 bits (445), Expect = 3.199e-44
Identity = 111/451 (24.61%), Postives = 207/451 (45.90%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            L  LH +   G++   K L+D   D      +G+ P+H AC+     +V+ L++    +    E    P+H A   G + +   L+ +    +++      P+H A R    D+V++L+ +   ++    E  T LH A + GN DIV LL+        N  T+     +H A     EE+  IL+    +      +   PLH A   GN  + +LL++     V+ +   + +P+  A +    ++A LL+ N      + +    P+H A+     E+A  L+  + D   ++     P+ +++   + EI  LLI N  ++ +  +     +H+  Q+  V V Q+L +N   IN   +    P+H+A   G++ +VK L+E+GAD       + TPL+ A ++GH +  + L++NG +   Q+     P+  A + G+  + + L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 161.77 bits (408), Expect = 7.365e-40
Identity = 107/455 (23.52%), Postives = 216/455 (47.47%), Query Frame = 1
Query:  268 SCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            + + G+L+ V  L+    DI   + +G   +H A + G+ ++V+ LI+    ++    K    +H A + G   +  IL+     VN+++ +   P++ A +  + ++VK LL       ++  + FT L  A QQG+  +V +L+    + K+         A+H A   +      +L+  +   +  +     PLH A   G++ + QLL++    NVN +     SP+  A   G+  +A LL++    I+  T+    P+H A+  G  +V  +L+ +   I  +T     P+ +A+  ++V+  R L+ +   +     +   P+HVA   G V V +LL+D   + N        P+HIA +  R+++V++LL++ A          TPL++A   G  ++   L+  G N + ++++   P+H A +    ++ ++L+ +   +D +
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLP------ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEK-GANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ 487          

HSP 5 Score: 143.28 bits (360), Expect = 4.136e-34
Identity = 92/410 (22.44%), Postives = 187/410 (45.61%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEI-----------------------------AKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN-------VNYFSLINIYVYFVN 1683
            A R G+++ V  LL +   IN +++    +LH A ++G+ ++VR L+  K Q +++ AT+  N A+H A ++    IV IL+     +N ++     PL+ A    ++ + + L+     N      + F+P+  AL  G   +                             A LL+ N  + + ++++   P+H A+  G   V  +L+++  ++  +      P+ +A+      +  LL++    I S   +   P+H A + G  +VV LL+     I+      + P+H+A++   V+  + LL H A  + +     TPL++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    +I+   ++         +   INI +Y + 
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELI--KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH-GANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ 446          

HSP 6 Score: 132.88 bits (333), Expect = 5.860e-31
Identity = 91/361 (25.21%), Postives = 157/361 (43.49%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI----SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLL 1302
            +++  G   LH + +    D V+ LI +   ++        P+H A + GN DIV  L+++G   N      + P+H A   G   VA IL+     + L+  K      P+H A + GN+++V+LLL     +++    + T LH A    N  +  LL+      K   A K+    +H A      EI   L+  K + N K+     PLH +   G+K I+ LLI+    +V  K     + +        + +A++L  N  +IN  T     P+H A   G   +   L++   D+  +T     P+  A+   +   +R L+ N  +        + P+ +A + G+V VV+ L
Sbjct:  453 VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG---FTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA--AAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIEN-GSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 90.1225 bits (222), Expect = 6.595e-18
Identity = 66/265 (24.91%), Postives = 111/265 (41.89%), Query Frame = 1
Query:  940 AEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILL-------------------------------EHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNV 1641
            AE  +  L A  +G +E    L+    DIN S       +H AS  G +EV   LI RQ  ++  T      + IAS      I+ +L+ N  N+   +     P+++A Q+   EVV+ L+ +  N   + +    P+ +A + G   +V +LL                               EH  D      +  TPL++A   GH +V ++L++ G N+  Q+     P+H A + G   +A LL+     ID+   ++
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL 293          

HSP 8 Score: 57.3806 bits (137), Expect = 7.656e-8
Identity = 26/83 (31.33%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+AC  G LN+VK LV++G+++    R++  P+H A + G+ + ++ L+ N  + + +     TPL + +  GY   V  L
Sbjct:  725 PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 9 Score: 53.1434 bits (126), Expect = 1.353e-6
Identity = 24/82 (29.27%), Postives = 44/82 (53.66%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +HL     ++ + ++L ++G+ +     +   P+H AC  G L+++K LV N   +  K  AS TPL      G+++CV +L
Sbjct:  693 MHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          
BLAST of SMED30013077 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 208.379 bits (529), Expect = 2.650e-54
Identity = 127/474 (26.79%), Postives = 225/474 (47.47%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSL 1656
            +K  L  LHC+ ++G+   V  L+     I     +G  P+H A QG + D  + L+     ++ +      P+H A   GH+ VA++L+ R    N +A +   P+H AC+   + +V+LLL  + AI        T LH A   G  +IV  L+       +   T      +H A  +   ++V +LI    +++ +  E   PLH A   GN  I  LL+     N N    + +SP+  A   GQ E+A +L+ +N D    T+    P+H AS  G  EV  +L++R   ++ E   +  P+ +A+  NN ++  LL+ N  + K+       P+H+A +K  +E+   L+    + N  +     P+H++++ G  EI  +L+E+G+D         T ++L  ++ H  V+++L +NG  I  ++   + P+H AC  G   + + LV++   +  E    +Y  L
Sbjct:  290 TKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE--TVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQA-GANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVG-EKTRASYTPL 759          

HSP 2 Score: 182.185 bits (461), Expect = 3.205e-46
Identity = 125/524 (23.85%), Postives = 237/524 (45.23%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA----------------------PDDSR-----PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVS-GKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            ++ G  ALH +   G    V  L+++  ++     +G+ P++ A Q  + ++VKYL++ G       E  F P+  A   GH  V  +L+   S+  V + A                      PD +      P+H A   G+ ++ +LLL     +N       + LH A + G  ++  LL+S G +   I+  TK     +H A  S  +++V++L+ +   I+ K    + PLH A                                    G+  +A+LL+D    + N +    F+P+  A    +I++ +LL+     I  +T +   P+H A+ +G   +   L+ +  + + ET+    P+ +A+  N  +++R+LI N   + +   E + P+H+A + G  ++V LL+    N N        P+HIA++ G+ E+  ILL+H AD   +     TPL+LA++ G+ +V ++L++ G  ++ +   +  P+H A      ++A LL+++  S
Sbjct:   96 TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI---IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGAS 615          

HSP 3 Score: 176.022 bits (445), Expect = 3.285e-44
Identity = 111/451 (24.61%), Postives = 207/451 (45.90%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            L  LH +   G++   K L+D   D      +G+ P+H AC+     +V+ L++    +    E    P+H A   G + +   L+ +    +++      P+H A R    D+V++L+ +   ++    E  T LH A + GN DIV LL+        N  T+     +H A     EE+  IL+    +      +   PLH A   GN  + +LL++     V+ +   + +P+  A +    ++A LL+ N      + +    P+H A+     E+A  L+  + D   ++     P+ +++   + EI  LLI N  ++ +  +     +H+  Q+  V V Q+L +N   IN   +    P+H+A   G++ +VK L+E+GAD       + TPL+ A ++GH +  + L++NG +   Q+     P+  A + G+  + + L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 161.77 bits (408), Expect = 7.621e-40
Identity = 107/455 (23.52%), Postives = 216/455 (47.47%), Query Frame = 1
Query:  268 SCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            + + G+L+ V  L+    DI   + +G   +H A + G+ ++V+ LI+    ++    K    +H A + G   +  IL+     VN+++ +   P++ A +  + ++VK LL       ++  + FT L  A QQG+  +V +L+    + K+         A+H A   +      +L+  +   +  +     PLH A   G++ + QLL++    NVN +     SP+  A   G+  +A LL++    I+  T+    P+H A+  G  +V  +L+ +   I  +T     P+ +A+  ++V+  R L+ +   +     +   P+HVA   G V V +LL+D   + N        P+HIA +  R+++V++LL++ A          TPL++A   G  ++   L+  G N + ++++   P+H A +    ++ ++L+ +   +D +
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLP------ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEK-GANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ 487          

HSP 5 Score: 143.28 bits (360), Expect = 4.060e-34
Identity = 92/410 (22.44%), Postives = 187/410 (45.61%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEI-----------------------------AKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN-------VNYFSLINIYVYFVN 1683
            A R G+++ V  LL +   IN +++    +LH A ++G+ ++VR L+  K Q +++ AT+  N A+H A ++    IV IL+     +N ++     PL+ A    ++ + + L+     N      + F+P+  AL  G   +                             A LL+ N  + + ++++   P+H A+  G   V  +L+++  ++  +      P+ +A+      +  LL++    I S   +   P+H A + G  +VV LL+     I+      + P+H+A++   V+  + LL H A  + +     TPL++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    +I+   ++         +   INI +Y + 
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELI--KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH-GANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ 446          

HSP 6 Score: 132.88 bits (333), Expect = 5.847e-31
Identity = 91/361 (25.21%), Postives = 157/361 (43.49%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI----SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLL 1302
            +++  G   LH + +    D V+ LI +   ++        P+H A + GN DIV  L+++G   N      + P+H A   G   VA IL+     + L+  K      P+H A + GN+++V+LLL     +++    + T LH A    N  +  LL+      K   A K+    +H A      EI   L+  K + N K+     PLH +   G+K I+ LLI+    +V  K     + +        + +A++L  N  +IN  T     P+H A   G   +   L++   D+  +T     P+  A+   +   +R L+ N  +        + P+ +A + G+V VV+ L
Sbjct:  453 VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG---FTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA--AAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIEN-GSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 90.1225 bits (222), Expect = 7.709e-18
Identity = 66/265 (24.91%), Postives = 111/265 (41.89%), Query Frame = 1
Query:  940 AEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILL-------------------------------EHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNV 1641
            AE  +  L A  +G +E    L+    DIN S       +H AS  G +EV   LI RQ  ++  T      + IAS      I+ +L+ N  N+   +     P+++A Q+   EVV+ L+ +  N   + +    P+ +A + G   +V +LL                               EH  D      +  TPL++A   GH +V ++L++ G N+  Q+     P+H A + G   +A LL+     ID+   ++
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL 293          

HSP 8 Score: 57.3806 bits (137), Expect = 7.671e-8
Identity = 26/83 (31.33%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+AC  G LN+VK LV++G+++    R++  P+H A + G+ + ++ L+ N  + + +     TPL + +  GY   V  L
Sbjct:  725 PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 9 Score: 53.1434 bits (126), Expect = 1.356e-6
Identity = 24/82 (29.27%), Postives = 44/82 (53.66%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +HL     ++ + ++L ++G+ +     +   P+H AC  G L+++K LV N   +  K  AS TPL      G+++CV +L
Sbjct:  693 MHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          
BLAST of SMED30013077 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 208.379 bits (529), Expect = 2.650e-54
Identity = 127/474 (26.79%), Postives = 225/474 (47.47%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSL 1656
            +K  L  LHC+ ++G+   V  L+     I     +G  P+H A QG + D  + L+     ++ +      P+H A   GH+ VA++L+ R    N +A +   P+H AC+   + +V+LLL  + AI        T LH A   G  +IV  L+       +   T      +H A  +   ++V +LI    +++ +  E   PLH A   GN  I  LL+     N N    + +SP+  A   GQ E+A +L+ +N D    T+    P+H AS  G  EV  +L++R   ++ E   +  P+ +A+  NN ++  LL+ N  + K+       P+H+A +K  +E+   L+    + N  +     P+H++++ G  EI  +L+E+G+D         T ++L  ++ H  V+++L +NG  I  ++   + P+H AC  G   + + LV++   +  E    +Y  L
Sbjct:  290 TKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE--TVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQA-GANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVG-EKTRASYTPL 759          

HSP 2 Score: 182.185 bits (461), Expect = 3.205e-46
Identity = 125/524 (23.85%), Postives = 237/524 (45.23%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA----------------------PDDSR-----PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVS-GKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            ++ G  ALH +   G    V  L+++  ++     +G+ P++ A Q  + ++VKYL++ G       E  F P+  A   GH  V  +L+   S+  V + A                      PD +      P+H A   G+ ++ +LLL     +N       + LH A + G  ++  LL+S G +   I+  TK     +H A  S  +++V++L+ +   I+ K    + PLH A                                    G+  +A+LL+D    + N +    F+P+  A    +I++ +LL+     I  +T +   P+H A+ +G   +   L+ +  + + ET+    P+ +A+  N  +++R+LI N   + +   E + P+H+A + G  ++V LL+    N N        P+HIA++ G+ E+  ILL+H AD   +     TPL+LA++ G+ +V ++L++ G  ++ +   +  P+H A      ++A LL+++  S
Sbjct:   96 TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI---IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGAS 615          

HSP 3 Score: 176.022 bits (445), Expect = 3.285e-44
Identity = 111/451 (24.61%), Postives = 207/451 (45.90%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            L  LH +   G++   K L+D   D      +G+ P+H AC+     +V+ L++    +    E    P+H A   G + +   L+ +    +++      P+H A R    D+V++L+ +   ++    E  T LH A + GN DIV LL+        N  T+     +H A     EE+  IL+    +      +   PLH A   GN  + +LL++     V+ +   + +P+  A +    ++A LL+ N      + +    P+H A+     E+A  L+  + D   ++     P+ +++   + EI  LLI N  ++ +  +     +H+  Q+  V V Q+L +N   IN   +    P+H+A   G++ +VK L+E+GAD       + TPL+ A ++GH +  + L++NG +   Q+     P+  A + G+  + + L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 161.77 bits (408), Expect = 7.621e-40
Identity = 107/455 (23.52%), Postives = 216/455 (47.47%), Query Frame = 1
Query:  268 SCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            + + G+L+ V  L+    DI   + +G   +H A + G+ ++V+ LI+    ++    K    +H A + G   +  IL+     VN+++ +   P++ A +  + ++VK LL       ++  + FT L  A QQG+  +V +L+    + K+         A+H A   +      +L+  +   +  +     PLH A   G++ + QLL++    NVN +     SP+  A   G+  +A LL++    I+  T+    P+H A+  G  +V  +L+ +   I  +T     P+ +A+  ++V+  R L+ +   +     +   P+HVA   G V V +LL+D   + N        P+HIA +  R+++V++LL++ A          TPL++A   G  ++   L+  G N + ++++   P+H A +    ++ ++L+ +   +D +
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLP------ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEK-GANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ 487          

HSP 5 Score: 143.28 bits (360), Expect = 4.060e-34
Identity = 92/410 (22.44%), Postives = 187/410 (45.61%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEI-----------------------------AKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN-------VNYFSLINIYVYFVN 1683
            A R G+++ V  LL +   IN +++    +LH A ++G+ ++VR L+  K Q +++ AT+  N A+H A ++    IV IL+     +N ++     PL+ A    ++ + + L+     N      + F+P+  AL  G   +                             A LL+ N  + + ++++   P+H A+  G   V  +L+++  ++  +      P+ +A+      +  LL++    I S   +   P+H A + G  +VV LL+     I+      + P+H+A++   V+  + LL H A  + +     TPL++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    +I+   ++         +   INI +Y + 
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELI--KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH-GANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ 446          

HSP 6 Score: 132.88 bits (333), Expect = 5.847e-31
Identity = 91/361 (25.21%), Postives = 157/361 (43.49%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI----SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLL 1302
            +++  G   LH + +    D V+ LI +   ++        P+H A + GN DIV  L+++G   N      + P+H A   G   VA IL+     + L+  K      P+H A + GN+++V+LLL     +++    + T LH A    N  +  LL+      K   A K+    +H A      EI   L+  K + N K+     PLH +   G+K I+ LLI+    +V  K     + +        + +A++L  N  +IN  T     P+H A   G   +   L++   D+  +T     P+  A+   +   +R L+ N  +        + P+ +A + G+V VV+ L
Sbjct:  453 VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG---FTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA--AAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIEN-GSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 90.1225 bits (222), Expect = 7.709e-18
Identity = 66/265 (24.91%), Postives = 111/265 (41.89%), Query Frame = 1
Query:  940 AEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILL-------------------------------EHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNV 1641
            AE  +  L A  +G +E    L+    DIN S       +H AS  G +EV   LI RQ  ++  T      + IAS      I+ +L+ N  N+   +     P+++A Q+   EVV+ L+ +  N   + +    P+ +A + G   +V +LL                               EH  D      +  TPL++A   GH +V ++L++ G N+  Q+     P+H A + G   +A LL+     ID+   ++
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL 293          

HSP 8 Score: 57.3806 bits (137), Expect = 7.671e-8
Identity = 26/83 (31.33%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+AC  G LN+VK LV++G+++    R++  P+H A + G+ + ++ L+ N  + + +     TPL + +  GY   V  L
Sbjct:  725 PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 9 Score: 53.1434 bits (126), Expect = 1.356e-6
Identity = 24/82 (29.27%), Postives = 44/82 (53.66%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +HL     ++ + ++L ++G+ +     +   P+H AC  G L+++K LV N   +  K  AS TPL      G+++CV +L
Sbjct:  693 MHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          
BLAST of SMED30013077 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 207.994 bits (528), Expect = 2.750e-54
Identity = 127/474 (26.79%), Postives = 225/474 (47.47%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSL 1656
            +K  L  LHC+ ++G+   V  L+     I     +G  P+H A QG + D  + L+     ++ +      P+H A   GH+ VA++L+ R    N +A +   P+H AC+   + +V+LLL  + AI        T LH A   G  +IV  L+       +   T      +H A  +   ++V +LI    +++ +  E   PLH A   GN  I  LL+     N N    + +SP+  A   GQ E+A +L+ +N D    T+    P+H AS  G  EV  +L++R   ++ E   +  P+ +A+  NN ++  LL+ N  + K+       P+H+A +K  +E+   L+    + N  +     P+H++++ G  EI  +L+E+G+D         T ++L  ++ H  V+++L +NG  I  ++   + P+H AC  G   + + LV++   +  E    +Y  L
Sbjct:  290 TKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVE--TVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQA-GANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVG-EKTRASYTPL 759          

HSP 2 Score: 182.185 bits (461), Expect = 3.307e-46
Identity = 125/524 (23.85%), Postives = 237/524 (45.23%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA----------------------PDDSR-----PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVS-GKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            ++ G  ALH +   G    V  L+++  ++     +G+ P++ A Q  + ++VKYL++ G       E  F P+  A   GH  V  +L+   S+  V + A                      PD +      P+H A   G+ ++ +LLL     +N       + LH A + G  ++  LL+S G +   I+  TK     +H A  S  +++V++L+ +   I+ K    + PLH A                                    G+  +A+LL+D    + N +    F+P+  A    +I++ +LL+     I  +T +   P+H A+ +G   +   L+ +  + + ET+    P+ +A+  N  +++R+LI N   + +   E + P+H+A + G  ++V LL+    N N        P+HIA++ G+ E+  ILL+H AD   +     TPL+LA++ G+ +V ++L++ G  ++ +   +  P+H A      ++A LL+++  S
Sbjct:   96 TRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAI---IDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR-SADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGAS 615          

HSP 3 Score: 176.022 bits (445), Expect = 3.278e-44
Identity = 111/451 (24.61%), Postives = 207/451 (45.90%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            L  LH +   G++   K L+D   D      +G+ P+H AC+     +V+ L++    +    E    P+H A   G + +   L+ +    +++      P+H A R    D+V++L+ +   ++    E  T LH A + GN DIV LL+        N  T+     +H A     EE+  IL+    +      +   PLH A   GN  + +LL++     V+ +   + +P+  A +    ++A LL+ N      + +    P+H A+     E+A  L+  + D   ++     P+ +++   + EI  LLI N  ++ +  +     +H+  Q+  V V Q+L +N   IN   +    P+H+A   G++ +VK L+E+GAD       + TPL+ A ++GH +  + L++NG +   Q+     P+  A + G+  + + L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS--NATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER-GTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 4 Score: 161.77 bits (408), Expect = 7.238e-40
Identity = 107/455 (23.52%), Postives = 216/455 (47.47%), Query Frame = 1
Query:  268 SCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            + + G+L+ V  L+    DI   + +G   +H A + G+ ++V+ LI+    ++    K    +H A + G   +  IL+     VN+++ +   P++ A +  + ++VK LL       ++  + FT L  A QQG+  +V +L+    + K+         A+H A   +      +L+  +   +  +     PLH A   G++ + QLL++    NVN +     SP+  A   G+  +A LL++    I+  T+    P+H A+  G  +V  +L+ +   I  +T     P+ +A+  ++V+  R L+ +   +     +   P+HVA   G V V +LL+D   + N        P+HIA +  R+++V++LL++ A          TPL++A   G  ++   L+  G N + ++++   P+H A +    ++ ++L+ +   +D +
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLP------ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEK-GANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQ 487          

HSP 5 Score: 143.28 bits (360), Expect = 4.071e-34
Identity = 92/410 (22.44%), Postives = 187/410 (45.61%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEI-----------------------------AKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN-------VNYFSLINIYVYFVN 1683
            A R G+++ V  LL +   IN +++    +LH A ++G+ ++VR L+  K Q +++ AT+  N A+H A ++    IV IL+     +N ++     PL+ A    ++ + + L+     N      + F+P+  AL  G   +                             A LL+ N  + + ++++   P+H A+  G   V  +L+++  ++  +      P+ +A+      +  LL++    I S   +   P+H A + G  +VV LL+     I+      + P+H+A++   V+  + LL H A  + +     TPL++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    +I+   ++         +   INI +Y + 
Sbjct:   40 AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELI--KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH-GANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ 446          

HSP 6 Score: 132.88 bits (333), Expect = 6.447e-31
Identity = 91/361 (25.21%), Postives = 157/361 (43.49%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI----SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLL 1302
            +++  G   LH + +    D V+ LI +   ++        P+H A + GN DIV  L+++G   N      + P+H A   G   VA IL+     + L+  K      P+H A + GN+++V+LLL     +++    + T LH A    N  +  LL+      K   A K+    +H A      EI   L+  K + N K+     PLH +   G+K I+ LLI+    +V  K     + +        + +A++L  N  +IN  T     P+H A   G   +   L++   D+  +T     P+  A+   +   +R L+ N  +        + P+ +A + G+V VV+ L
Sbjct:  453 VETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKG---FTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA--AAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIEN-GSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 7 Score: 90.1225 bits (222), Expect = 7.460e-18
Identity = 66/265 (24.91%), Postives = 111/265 (41.89%), Query Frame = 1
Query:  940 AEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILL-------------------------------EHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNV 1641
            AE  +  L A  +G +E    L+    DIN S       +H AS  G +EV   LI RQ  ++  T      + IAS      I+ +L+ N  N+   +     P+++A Q+   EVV+ L+ +  N   + +    P+ +A + G   +V +LL                               EH  D      +  TPL++A   GH +V ++L++ G N+  Q+     P+H A + G   +A LL+     ID+   ++
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGF--TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDL 293          

HSP 8 Score: 57.3806 bits (137), Expect = 7.641e-8
Identity = 26/83 (31.33%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+AC  G LN+VK LV++G+++    R++  P+H A + G+ + ++ L+ N  + + +     TPL + +  GY   V  L
Sbjct:  725 PLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 9 Score: 53.1434 bits (126), Expect = 1.351e-6
Identity = 24/82 (29.27%), Postives = 44/82 (53.66%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +HL     ++ + ++L ++G+ +     +   P+H AC  G L+++K LV N   +  K  AS TPL      G+++CV +L
Sbjct:  693 MHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYL 774          
BLAST of SMED30013077 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 198.364 bits (503), Expect = 2.232e-51
Identity = 118/474 (24.89%), Postives = 226/474 (47.68%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSL 1656
            ++ GL  LHC+ ++G+   V  L++    I     +G  P+H A QG + D  + L+     ++ +       +H A   GH+ VA++L+ R    N +A +   P+H AC+   + +V+LLL    +I+       T LH A   G  +IV  L+       +   T      +H A  +   +I+ IL+    +++ +  E+  PLH A   GN  I  LL+      V+    + ++ +  A   GQ E+A +LI N   ++ +T+    P+H  +  G  +VA +L+ ++ D++ +      P+ +A   NN ++  LL+    +  +T      P+H+A +K  +++   L++     N  +     P+H++S+ G  EI  +L+EH A  N       TP++L  ++ + +V+++L  NG NI+  +   + P+H A   G   + + L+ +  ++D    ++ Y  L
Sbjct:  268 TRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDV--PTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQ-HGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAAT-SIGYTPL 737          

HSP 2 Score: 194.512 bits (493), Expect = 3.503e-50
Identity = 114/463 (24.62%), Postives = 211/463 (45.57%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            SKSG   LH +   GN +    LI    D+     H   P+H A + G  ++V  L+E G  +         P+H A  +GH  V  +L+ R   ++ K  +   P+H A +  +VD  ++LL  +  ++    +  TALH A   G+  + +LL+        N    +    +H AC     ++VE+L+     I+   +  + PLH A   G   I   L+   D + +       +P+  A  + Q +I ++L+ N   ++   R Q+ P+H AS LG  ++  +L+     ++  T      + IA+     E+  +LI N   + +   +   P+H+  + G ++V QLL+    +++      + P+H+A      ++  +LLE GA  +       TPL++A  K   D++  L++ G     +S   + P+H + Q G  EI+ LL++   +++
Sbjct:  202 SKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADA--NARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQ-HDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVN 661          

HSP 3 Score: 190.66 bits (483), Expect = 5.144e-49
Identity = 121/525 (23.05%), Postives = 234/525 (44.57%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA----------------------PDDSR-----PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLV--SGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            +K G  ALH +   G  + VK L++H   +     +G+ P++ A Q  +  +V+ L+ +G   +   E  F P+  A   GH  V  +L+   +R  V + A                      PD +      P+H A   GN ++  LL+     +N +     + LH A + G  ++V LL+   G ++ K  D        +H A  S  E++V++L+ +   I+ K    + PLH A                                    G+  +A+LL+D  + + N +    F+P+  A    ++++ +LL+ +   I+ +T +   P+H A+ +G   +   L+      +  T+    P+ +A+  N  +I+R+L+ N   + +   E + P+H+A + G V++V LL+ +   ++     +   +HIA++ G+ E+  +L+E+GA  +       TPL+L  + GH  V+++L+    +++ Q      P+H AC     ++A LL++   S
Sbjct:   74 TKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTP----LHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDR-NADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGAS 593          

HSP 4 Score: 189.889 bits (481), Expect = 1.006e-48
Identity = 131/561 (23.35%), Postives = 245/561 (43.67%), Query Frame = 1
Query:  145 LDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR------------------------QLVNIKAPDDSR------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTND---------------------------------ENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            L+ ++ HL+  ++I  S              + +GLNALH + K+G++  V  L+     ++     G   +H A   G  ++VK L+E    +N   +  F P++ A    H AV R+L+S                         ++V +    D+R       +H A +  +V    LLL +    +V     FT LH A   GN +I  LL+  +    +N + K     +H A       +V +L+ K   I  K  + + PLH A  +G++ +  +L++     ++ K     +P+  A     ++ A++L+ +   ++  T      +H A+  G   VA +L+DR  D     +    P+ IA   N ++++ LL+ +  +I +T +                                   E P+H+A +    +++++L+ N   ++    +   P+HIAS  G V+IV +LL+HGA  +       T L++A ++G  +V+ VLI+NG  ++  + K + P+H   + G  ++AQLL+     +D +  N
Sbjct:   24 LERVLEHLKNNIDINTS--------------NANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLI--QKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLER-GAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKN 567          

HSP 5 Score: 186.808 bits (473), Expect = 8.872e-48
Identity = 116/467 (24.84%), Postives = 217/467 (46.47%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPD-----DSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEND 1635
            L ALH +   G++   K L+D   D      +G+ P+H AC+     +V+ L+  G  ++   E    P+H A   G + +   L+        +PD        P+H A R    D++++LL +   ++    E+ T LH A + GN DIV LL+    Q  ++  TK    A+H A     +E+  +LI     ++    +   PLH     G+  +AQLL+   + +V+ +     +P+  A +    ++A LL+      + + +    P+H A+     ++A  L++       E+     P+ ++S   + EI  LLI +   +         P+H+  Q+  V V ++L  N  NI+ A      P+H+AS  G+  +V+ LL++GA+ +   +   TPL+   ++GH  +  +L+++  N   Q++    P+H A + G+  +    +DS  +I  E++
Sbjct:  338 LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHD----ASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQ--VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQ-KEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV----LDSLKTITKEDE 793          

HSP 6 Score: 150.599 bits (379), Expect = 1.985e-36
Identity = 96/410 (23.41%), Postives = 191/410 (46.59%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGN-HDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN-------VNYFSLINIYVYFV 1680
            A R GN++ V   L +   IN +++    ALH A + G+ H +  LL  G +   ++ ATK  N A+H A ++  EE+V++L+     +N ++     PL+ A    + A+ +LL+     N +    + F+P+  A+  G                              ++ A LL+ N+ + + ++++   P+H AS  G   +A++LI +  D+         P+ +A+      ++ LL+    NI++   +   P+H A + G  +VV +L++    I+      + P+H+A++   V+  +ILL H A  + +     T L++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    SI    ++         +   +NI +Y +
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAI---VDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLS-NGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLL 423          

HSP 7 Score: 147.132 bits (370), Expect = 2.181e-35
Identity = 109/421 (25.89%), Postives = 198/421 (47.03%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHD-IVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            A + GN + V   +++   +N       + +H A  +GH+ V   L+ R  +V+      +  +H A   G  ++VKLLL    ++NV     FT L+ A Q+ NHD +VRLL+S      +  AT+     +  A     +++V +L+    E + +    +  LH A    +   A LL+D  D N +  +   F+P+  A + G   IA LLI    D+N S +    P+H A+  G T +  +L+++  +IE +T     P+  A+ + + +++ +L+     I +       P+H+A Q   V+  ++L+ +   ++      +  +H+A+  G V + K+LL+  AD N       TPL++A +K    V ++L+ +G +I   +     P+H A   G   I   L+    S D
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQE-NHDAVVRLLLSNGANQSL--ATEDGFTPLAVAMQQGHDKVVAVLL----ESDTRGKVRLPALHIAAKKDDVKAATLLLD-NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPD 430          

HSP 8 Score: 90.5077 bits (223), Expect = 6.175e-18
Identity = 67/299 (22.41%), Postives = 122/299 (40.80%), Query Frame = 1
Query:  928 NCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCS---------------------------------TRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVV-----------------------------QLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            N    +  +  L A  +G +E     + NN DIN S                                 T+     +H AS  G  EV  +L++    +  ++     P+++A+  N+  ++RLL++N  N     ++   P+ VA Q+G  +VV                              LL+DN  N +  +     P+HIAS  G   I  +L++ GAD N    +  +PL++A + G  ++  +L++ G NIE ++     P+H A ++G  ++  +L++    I  +  N
Sbjct:    5 NGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKN 303          

HSP 9 Score: 65.855 bits (159), Expect = 2.185e-10
Identity = 66/261 (25.29%), Postives = 110/261 (42.15%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKS-----------ANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIA--QLLIDVP-----DCNVNCKNAEEFSPI 960
            +SK+G   LH S + G+ +    LI+HK  +     +G  P+H   Q  N ++ + L ++G  ++   +  + P+H A   G   + R L+     V+        P+H   + G+  +V LLL  K   N       T LH A + G    + +L S K   K ++   +           A  A+H + MS+SEE       +  E N  +D+   P  Y   +  K++    L IDV      D N   ++AE  S +
Sbjct:  630 ESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG---YISVLDSLKTITKEDETAAAPSQAEEKYRVVAPEAMHESFMSDSEE-------EGGEDNMLSDQ---PYRYLTVDEMKSLGDDSLPIDVTRDERMDSNRMTQSAEYASGV 877          

HSP 10 Score: 51.9878 bits (123), Expect = 3.265e-6
Identity = 24/86 (27.91%), Postives = 42/86 (48.84%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +Q P+H+A   GN++IV LL+ HG+ ++   +     +H A + G  ++   L+ N  A+        TPL L   +G+      L
Sbjct:  469 QQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLL 554          
BLAST of SMED30013077 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334061)

HSP 1 Score: 197.593 bits (501), Expect = 4.212e-51
Identity = 118/474 (24.89%), Postives = 226/474 (47.68%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSL 1656
            ++ GL  LHC+ ++G+   V  L++    I     +G  P+H A QG + D  + L+     ++ +       +H A   GH+ VA++L+ R    N +A +   P+H AC+   + +V+LLL    +I+       T LH A   G  +IV  L+       +   T      +H A  +   +I+ IL+    +++ +  E+  PLH A   GN  I  LL+      V+    + ++ +  A   GQ E+A +LI N   ++ +T+    P+H  +  G  +VA +L+ ++ D++ +      P+ +A   NN ++  LL+    +  +T      P+H+A +K  +++   L++     N  +     P+H++S+ G  EI  +L+EH A  N       TP++L  ++ + +V+++L  NG NI+  +   + P+H A   G   + + L+ +  ++D    ++ Y  L
Sbjct:  418 TRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDV--PTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQH-GAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAAT-SIGYTPL 887          

HSP 2 Score: 193.741 bits (491), Expect = 7.504e-50
Identity = 115/470 (24.47%), Postives = 213/470 (45.32%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            + SKSG   LH +   GN +    LI    D+     H   P+H A + G  ++V  L+E G  +         P+H A  +GH  V  +L+ R   ++ K  +   P+H A +  +VD  ++LL  +  ++    +  TALH A   G+  + +LL+        N    +    +H AC     ++VE+L+     I+   +  + PLH A   G   I   L+   D + +       +P+  A  + Q +I ++L+ N   ++   R Q+ P+H AS LG  ++  +L+     ++  T      + IA+     E+  +LI N   + +   +   P+H+  + G ++V QLL+    +++      + P+H+A      ++  +LLE GA  +       TPL++A  K   D++  L++ G     +S   + P+H + Q G  EI+ LL++   +++    N
Sbjct:  350 VTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADA--NARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQH-DASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKN 816          

HSP 3 Score: 189.504 bits (480), Expect = 1.682e-48
Identity = 121/525 (23.05%), Postives = 234/525 (44.57%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA----------------------PDDSR-----PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLV--SGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            +K G  ALH +   G  + VK L++H   +     +G+ P++ A Q  +  +V+ L+ +G   +   E  F P+  A   GH  V  +L+   +R  V + A                      PD +      P+H A   GN ++  LL+     +N +     + LH A + G  ++V LL+   G ++ K  D        +H A  S  E++V++L+ +   I+ K    + PLH A                                    G+  +A+LL+D  + + N +    F+P+  A    ++++ +LL+ +   I+ +T +   P+H A+ +G   +   L+      +  T+    P+ +A+  N  +I+R+L+ N   + +   E + P+H+A + G V++V LL+ +   ++     +   +HIA++ G+ E+  +L+E+GA  +       TPL+L  + GH  V+++L+    +++ Q      P+H AC     ++A LL++   S
Sbjct:  224 TKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTP----LHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDR-NADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGAS 743          

HSP 4 Score: 189.119 bits (479), Expect = 2.442e-48
Identity = 131/561 (23.35%), Postives = 245/561 (43.67%), Query Frame = 1
Query:  145 LDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR------------------------QLVNIKAPDDSR------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTND---------------------------------ENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            L+ ++ HL+  ++I  S              + +GLNALH + K+G++  V  L+     ++     G   +H A   G  ++VK L+E    +N   +  F P++ A    H AV R+L+S                         ++V +    D+R       +H A +  +V    LLL +    +V     FT LH A   GN +I  LL+  +    +N + K     +H A       +V +L+ K   I  K  + + PLH A  +G++ +  +L++     ++ K     +P+  A     ++ A++L+ +   ++  T      +H A+  G   VA +L+DR  D     +    P+ IA   N ++++ LL+ +  +I +T +                                   E P+H+A +    +++++L+ N   ++    +   P+HIAS  G V+IV +LL+HGA  +       T L++A ++G  +V+ VLI+NG  ++  + K + P+H   + G  ++AQLL+     +D +  N
Sbjct:  174 LERVLEHLKNNIDINTS--------------NANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLI--QKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLER-GAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKN 717          

HSP 5 Score: 186.037 bits (471), Expect = 1.858e-47
Identity = 114/465 (24.52%), Postives = 216/465 (46.45%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLV-NIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNV 1641
            L ALH +   G++   K L+D   D      +G+ P+H AC+     +V+ L+  G  ++   E    P+H A   G + +   L+      ++       P+H A R    D++++LL +   ++    E+ T LH A + GN DIV LL+    Q  ++  TK    A+H A     +E+  +LI     ++    +   PLH     G+  +AQLL+   + +V+ +     +P+  A +    ++A LL+      + + +    P+H A+     ++A  L++       E+     P+ ++S   + EI  LLI +   +         P+H+  Q+  V V ++L  N  NI+ A      P+H+AS  G+  +V+ LL++GA+ +   +   TPL+   ++GH  +  +L+++  N   Q++    P+H A + G+  +    +DS  +I  E++  
Sbjct:  488 LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQ--VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQ-KEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV----LDSLKTITKEDETA 945          

HSP 6 Score: 150.984 bits (380), Expect = 1.435e-36
Identity = 96/410 (23.41%), Postives = 191/410 (46.59%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGN-HDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN-------VNYFSLINIYVYFV 1680
            A R GN++ V   L +   IN +++    ALH A + G+ H +  LL  G +   ++ ATK  N A+H A ++  EE+V++L+     +N ++     PL+ A    + A+ +LL+     N +    + F+P+  A+  G                              ++ A LL+ N+ + + ++++   P+H AS  G   +A++LI +  D+         P+ +A+      ++ LL+    NI++   +   P+H A + G  +VV +L++    I+      + P+H+A++   V+  +ILL H A  + +     T L++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    SI    ++         +   +NI +Y +
Sbjct:  168 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAI---VDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSN-GANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLL 573          

HSP 7 Score: 146.747 bits (369), Expect = 2.928e-35
Identity = 109/421 (25.89%), Postives = 198/421 (47.03%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHD-IVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            A + GN + V   +++   +N       + +H A  +GH+ V   L+ R  +V+      +  +H A   G  ++VKLLL    ++NV     FT L+ A Q+ NHD +VRLL+S      +  AT+     +  A     +++V +L+    E + +    +  LH A    +   A LL+D  D N +  +   F+P+  A + G   IA LLI    D+N S +    P+H A+  G T +  +L+++  +IE +T     P+  A+ + + +++ +L+     I +       P+H+A Q   V+  ++L+ +   ++      +  +H+A+  G V + K+LL+  AD N       TPL++A +K    V ++L+ +G +I   +     P+H A   G   I   L+    S D
Sbjct:  168 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQE-NHDAVVRLLLSNGANQSL--ATEDGFTPLAVAMQQGHDKVVAVLL----ESDTRGKVRLPALHIAAKKDDVKAATLLLDN-DHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPD 580          

HSP 8 Score: 93.2041 bits (230), Expect = 9.494e-19
Identity = 74/333 (22.22%), Postives = 136/333 (40.84%), Query Frame = 1
Query:  841 EEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEF-----SPILYALNSGQIEIAKLLITNNCDINCS---------------------------------TRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVV-----------------------------QLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            E++F  H+   NG  +  Q     P+ + +C    +      +  L A  +G +E     + NN DIN S                                 T+     +H AS  G  EV  +L++    +  ++     P+++A+  N+  ++RLL++N  N     ++   P+ VA Q+G  +VV                              LL+DN  N +  +     P+HIAS  G   I  +L++ GAD N    +  +PL++A + G  ++  +L++ G NIE ++     P+H A ++G  ++  +L++    I  +  N
Sbjct:  123 EQIF--HHEGANGGASHKQQTHHHPNKHEHCPTGHQSAGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKN 453          

HSP 9 Score: 65.4698 bits (158), Expect = 2.889e-10
Identity = 67/262 (25.57%), Postives = 112/262 (42.75%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDD--SRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKS-----------ANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIA--QLLIDVP-----DCNVNCKNAEEFSPI 960
            +SK+G   LH S + G+ +    LI+HK  +     +G  P+H   Q  N ++ + L ++G  ++   +  + P+H A   G   + R L+ +   N+ A       P+H   + G+  +V LLL  K   N       T LH A + G    + +L S K   K ++   +           A  A+H + MS+SEE       +  E N  +D+   P  Y   +  K++    L IDV      D N   ++AE  S +
Sbjct:  780 ESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLL-QNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG---YISVLDSLKTITKEDETAAAPSQAEEKYRVVAPEAMHESFMSDSEE-------EGGEDNMLSDQ---PYRYLTVDEMKSLGDDSLPIDVTRDERMDSNRMTQSAEYASGV 1027          

HSP 10 Score: 51.2174 bits (121), Expect = 6.694e-6
Identity = 24/86 (27.91%), Postives = 42/86 (48.84%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +Q P+H+A   GN++IV LL+ HG+ ++   +     +H A + G  ++   L+ N  A+        TPL L   +G+      L
Sbjct:  619 QQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLL 704          
BLAST of SMED30013077 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303117)

HSP 1 Score: 195.667 bits (496), Expect = 4.120e-50
Identity = 116/463 (25.05%), Postives = 222/463 (47.95%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            ++ GL  LHC+ ++G+   V  L++    I     +G  P+H A QG + D  + L+     ++ +       +H A   GH+ VA++L+ R    N +A +   P+H AC+   + +V+LLL    +I+       T LH A   G  +IV  L+       +   T      +H A  +   +I+ IL+    +++ +  E+  PLH A   GN  I  LL+      V+    + ++ +  A   GQ E+A +LI N   ++ +T+    P+H  +  G  +VA +L+ ++ D++ +      P+ +A   NN ++  LL+    +  +T      P+H+A +K  +++   L++     N  +     P+H++S+ G  EI  +L+EH A  N       TP++L  ++ + +V+++L  NG NI+  +   + P+H A   G   + + L+ +  ++D
Sbjct:  268 TRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDV--PTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQ-HGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVD 727          

HSP 2 Score: 191.045 bits (484), Expect = 1.096e-48
Identity = 115/468 (24.57%), Postives = 212/468 (45.30%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            SKSG   LH +   GN +    LI    D+     H   P+H A + G  ++V  L+E G  +         P+H A  +GH  V  +L+ R   ++ K  +   P+H A +  +VD  ++LL  +  ++    +  TALH A   G+  + +LL+        N    +    +H AC     ++VE+L+     I+   +  + PLH A   G   I   L+   D + +       +P+  A  + Q +I ++L+ N   ++   R Q+ P+H AS LG  ++  +L+     ++  T      + IA+     E+  +LI N   + +   +   P+H+  + G ++V QLL+    +++      + P+H+A      ++  +LLE GA  +       TPL++A  K   D++  L++ G     +S   + P+H + Q G  EI+ LL++   +++    N
Sbjct:  202 SKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADA--NARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQ-HDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKN 666          

HSP 3 Score: 187.578 bits (475), Expect = 1.172e-47
Identity = 131/561 (23.35%), Postives = 244/561 (43.49%), Query Frame = 1
Query:  145 LDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR------------------------QLVNIKAPDDSR------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTND---------------------------------ENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            L+ ++ HL+  ++I  S              + +GLNALH + K+G++  V  L+     ++     G   +H A   G  ++VK L+E    +N   +  F P++ A    H AV R+L+S                         ++V +    D+R       +H A +  +V    LLL +    +V     FT LH A   GN +I  LL+       +N + K     +H A       +V +L+ K   I  K  + + PLH A  +G++ +  +L++     ++ K     +P+  A     ++ A++L+ +   ++  T      +H A+  G   VA +L+DR  D     +    P+ IA   N ++++ LL+ +  +I +T +                                   E P+H+A +    +++++L+ N   ++    +   P+HIAS  G V+IV +LL+HGA  +       T L++A ++G  +V+ VLI+NG  ++  + K + P+H   + G  ++AQLL+     +D +  N
Sbjct:   24 LERVLEHLKNNIDINTS--------------NANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGAD--VNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLE-RGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKN 567          

HSP 4 Score: 186.808 bits (473), Expect = 2.070e-47
Identity = 116/467 (24.84%), Postives = 217/467 (46.47%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPD-----DSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEND 1635
            L ALH +   G++   K L+D   D      +G+ P+H AC+     +V+ L+  G  ++   E    P+H A   G + +   L+        +PD        P+H A R    D++++LL +   ++    E+ T LH A + GN DIV LL+    Q  ++  TK    A+H A     +E+  +LI     ++    +   PLH     G+  +AQLL+   + +V+ +     +P+  A +    ++A LL+      + + +    P+H A+     ++A  L++       E+     P+ ++S   + EI  LLI +   +         P+H+  Q+  V V ++L  N  NI+ A      P+H+AS  G+  +V+ LL++GA+ +   +   TPL+   ++GH  +  +L+++  N   Q++    P+H A + G+  +    +DS  +I  E++
Sbjct:  338 LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHD----ASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQ--VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQ-KEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV----LDSLKTITKEDE 793          

HSP 5 Score: 183.726 bits (465), Expect = 2.076e-46
Identity = 121/525 (23.05%), Postives = 234/525 (44.57%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVS--GKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            +K G  ALH +   G  + VK L++H   +     +G+ P++ A Q  +  +V+ L+ +G   +   E  F P+  A   GH  V  +L+   +R  V + A       DD +                     P+H A   GN ++  LL+     +N +     + LH A + G  ++V LL+   G ++ K  D        +H A  S  E++V++L+ +   I+ K    + PLH A                                    G+  +A+LL+D  + + N +    F+P+  A    ++++ +LL+ +   I+ +T +   P+H A+ +G   +   L+      +  T+    P+ +A+  N  +I+R+L+ N   + +   E + P+H+A + G V++V LL+ +   ++     +   +HIA++ G+ E+  +L+E+GA  +       TPL+L  + GH  V+++L+    +++ Q      P+H AC     ++A LL++   S
Sbjct:   74 TKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTP----LHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLD-RNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGAS 593          

HSP 6 Score: 149.058 bits (375), Expect = 1.070e-35
Identity = 96/410 (23.41%), Postives = 191/410 (46.59%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGN-HDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN-------VNYFSLINIYVYFV 1680
            A R GN++ V   L +   IN +++    ALH A + G+ H +  LL  G +   ++ ATK  N A+H A ++  EE+V++L+     +N ++     PL+ A    + A+ +LL+     N +    + F+P+  A+  G                              ++ A LL+ N+ + + ++++   P+H AS  G   +A++LI +  D+         P+ +A+      ++ LL+    NI++   +   P+H A + G  +VV +L++    I+      + P+H+A++   V+  +ILL H A  + +     T L++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    SI    ++         +   +NI +Y +
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAI---VDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLS-NGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLL 423          

HSP 7 Score: 147.902 bits (372), Expect = 2.339e-35
Identity = 106/420 (25.24%), Postives = 196/420 (46.67%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            A + GN + V   +++   +N       + +H A  +GH+ V   L+ R  +V+      +  +H A   G  ++VKLLL    ++NV     FT L+ A Q+ +  +VRLL+S      +  AT+     +  A     +++V +L+    E + +    +  LH A    +   A LL+D  D N +  +   F+P+  A + G   IA LLI    D+N S +    P+H A+  G T +  +L+++  +IE +T     P+  A+ + + +++ +L+     I +       P+H+A Q   V+  ++L+ +   ++      +  +H+A+  G V + K+LL+  AD N       TPL++A +K    V ++L+ +G +I   +     P+H A   G   I   L+    S D
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSL--ATEDGFTPLAVAMQQGHDKVVAVLL----ESDTRGKVRLPALHIAAKKDDVKAATLLLD-NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPD 430          

HSP 8 Score: 88.5817 bits (218), Expect = 3.177e-17
Identity = 66/291 (22.68%), Postives = 120/291 (41.24%), Query Frame = 1
Query:  952 SPILYALNSGQIEIAKLLITNNCDINCS---------------------------------TRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVV-----------------------------QLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +  L A  +G +E     + NN DIN S                                 T+     +H AS  G  EV  +L++    +  ++     P+++A+  N+  ++RLL++N  N     ++   P+ VA Q+G  +VV                              LL+DN  N +  +     P+HIAS  G   I  +L++ GAD N    +  +PL++A + G  ++  +L++ G NIE ++     P+H A ++G  ++  +L++    I  +  N
Sbjct:   13 TSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKN 303          

HSP 9 Score: 66.6254 bits (161), Expect = 1.642e-10
Identity = 52/198 (26.26%), Postives = 87/198 (43.94%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDD--SRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKS-----------ANRAIHFACMSESEE 789
            +SK+G   LH S + G+ +    LI+HK  +     +G  P+H   Q  N ++ + L ++G  ++   +  + P+H A   G   + R L+     N+ A       P+H   + G+  +V LLL  K   N       T LH A + G    + +L S K   K ++   +           A  A+H + MS+SEE
Sbjct:  630 ESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNG-ANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG---YISVLDSLKTITKEDETAAAPSQAEEKYRVVAPEAMHESFMSDSEE 823          

HSP 10 Score: 51.2174 bits (121), Expect = 6.394e-6
Identity = 23/79 (29.11%), Postives = 41/79 (51.90%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGY 2584
            +Q P+H+A   GN++IV LL+ HG+ ++   +     +H A + G  ++   L+ N  A+        TPL L   +G+
Sbjct:  469 QQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 547          
BLAST of SMED30013077 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303124)

HSP 1 Score: 195.667 bits (496), Expect = 4.128e-50
Identity = 116/463 (25.05%), Postives = 222/463 (47.95%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            ++ GL  LHC+ ++G+   V  L++    I     +G  P+H A QG + D  + L+     ++ +       +H A   GH+ VA++L+ R    N +A +   P+H AC+   + +V+LLL    +I+       T LH A   G  +IV  L+       +   T      +H A  +   +I+ IL+    +++ +  E+  PLH A   GN  I  LL+      V+    + ++ +  A   GQ E+A +LI N   ++ +T+    P+H  +  G  +VA +L+ ++ D++ +      P+ +A   NN ++  LL+    +  +T      P+H+A +K  +++   L++     N  +     P+H++S+ G  EI  +L+EH A  N       TP++L  ++ + +V+++L  NG NI+  +   + P+H A   G   + + L+ +  ++D
Sbjct:  418 TRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDV--PTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQ-HGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVD 877          

HSP 2 Score: 191.045 bits (484), Expect = 1.098e-48
Identity = 115/468 (24.57%), Postives = 212/468 (45.30%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            SKSG   LH +   GN +    LI    D+     H   P+H A + G  ++V  L+E G  +         P+H A  +GH  V  +L+ R   ++ K  +   P+H A +  +VD  ++LL  +  ++    +  TALH A   G+  + +LL+        N    +    +H AC     ++VE+L+     I+   +  + PLH A   G   I   L+   D + +       +P+  A  + Q +I ++L+ N   ++   R Q+ P+H AS LG  ++  +L+     ++  T      + IA+     E+  +LI N   + +   +   P+H+  + G ++V QLL+    +++      + P+H+A      ++  +LLE GA  +       TPL++A  K   D++  L++ G     +S   + P+H + Q G  EI+ LL++   +++    N
Sbjct:  352 SKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADA--NARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQ-HDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKN 816          

HSP 3 Score: 187.578 bits (475), Expect = 1.174e-47
Identity = 131/561 (23.35%), Postives = 244/561 (43.49%), Query Frame = 1
Query:  145 LDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR------------------------QLVNIKAPDDSR------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTND---------------------------------ENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            L+ ++ HL+  ++I  S              + +GLNALH + K+G++  V  L+     ++     G   +H A   G  ++VK L+E    +N   +  F P++ A    H AV R+L+S                         ++V +    D+R       +H A +  +V    LLL +    +V     FT LH A   GN +I  LL+       +N + K     +H A       +V +L+ K   I  K  + + PLH A  +G++ +  +L++     ++ K     +P+  A     ++ A++L+ +   ++  T      +H A+  G   VA +L+DR  D     +    P+ IA   N ++++ LL+ +  +I +T +                                   E P+H+A +    +++++L+ N   ++    +   P+HIAS  G V+IV +LL+HGA  +       T L++A ++G  +V+ VLI+NG  ++  + K + P+H   + G  ++AQLL+     +D +  N
Sbjct:  174 LERVLEHLKNNIDINTS--------------NANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGAD--VNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLE-RGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKN 717          

HSP 4 Score: 186.808 bits (473), Expect = 2.091e-47
Identity = 116/467 (24.84%), Postives = 217/467 (46.47%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPD-----DSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEND 1635
            L ALH +   G++   K L+D   D      +G+ P+H AC+     +V+ L+  G  ++   E    P+H A   G + +   L+        +PD        P+H A R    D++++LL +   ++    E+ T LH A + GN DIV LL+    Q  ++  TK    A+H A     +E+  +LI     ++    +   PLH     G+  +AQLL+   + +V+ +     +P+  A +    ++A LL+      + + +    P+H A+     ++A  L++       E+     P+ ++S   + EI  LLI +   +         P+H+  Q+  V V ++L  N  NI+ A      P+H+AS  G+  +V+ LL++GA+ +   +   TPL+   ++GH  +  +L+++  N   Q++    P+H A + G+  +    +DS  +I  E++
Sbjct:  488 LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHD----ASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQ--VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQ-KEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV----LDSLKTITKEDE 943          

HSP 5 Score: 183.726 bits (465), Expect = 2.097e-46
Identity = 121/525 (23.05%), Postives = 234/525 (44.57%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVS--GKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            +K G  ALH +   G  + VK L++H   +     +G+ P++ A Q  +  +V+ L+ +G   +   E  F P+  A   GH  V  +L+   +R  V + A       DD +                     P+H A   GN ++  LL+     +N +     + LH A + G  ++V LL+   G ++ K  D        +H A  S  E++V++L+ +   I+ K    + PLH A                                    G+  +A+LL+D  + + N +    F+P+  A    ++++ +LL+ +   I+ +T +   P+H A+ +G   +   L+      +  T+    P+ +A+  N  +I+R+L+ N   + +   E + P+H+A + G V++V LL+ +   ++     +   +HIA++ G+ E+  +L+E+GA  +       TPL+L  + GH  V+++L+    +++ Q      P+H AC     ++A LL++   S
Sbjct:  224 TKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTP----LHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLD-RNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGAS 743          

HSP 6 Score: 150.599 bits (379), Expect = 3.114e-36
Identity = 105/453 (23.18%), Postives = 203/453 (44.81%), Query Frame = 1
Query:  436 QEKAFHP-IHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGN-HDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN-------VNYFSLINIYVYFV 1680
            Q+   HP  H  C  GH +              A D +     A R GN++ V   L +   IN +++    ALH A + G+ H +  LL  G +   ++ ATK  N A+H A ++  EE+V++L+     +N ++     PL+ A    + A+ +LL+     N +    + F+P+  A+  G                              ++ A LL+ N+ + + ++++   P+H AS  G   +A++LI +  D+         P+ +A+      ++ LL+    NI++   +   P+H A + G  +VV +L++    I+      + P+H+A++   V+  +ILL H A  + +     T L++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    SI    ++         +   +NI +Y +
Sbjct:  139 QQTHHHPNKHEHCPTGHQS--------------AGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAI---VDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLS-NGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLL 573          

HSP 7 Score: 147.902 bits (372), Expect = 2.338e-35
Identity = 106/420 (25.24%), Postives = 196/420 (46.67%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            A + GN + V   +++   +N       + +H A  +GH+ V   L+ R  +V+      +  +H A   G  ++VKLLL    ++NV     FT L+ A Q+ +  +VRLL+S      +  AT+     +  A     +++V +L+    E + +    +  LH A    +   A LL+D  D N +  +   F+P+  A + G   IA LLI    D+N S +    P+H A+  G T +  +L+++  +IE +T     P+  A+ + + +++ +L+     I +       P+H+A Q   V+  ++L+ +   ++      +  +H+A+  G V + K+LL+  AD N       TPL++A +K    V ++L+ +G +I   +     P+H A   G   I   L+    S D
Sbjct:  168 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSL--ATEDGFTPLAVAMQQGHDKVVAVLL----ESDTRGKVRLPALHIAAKKDDVKAATLLLD-NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPD 580          

HSP 8 Score: 91.2781 bits (225), Expect = 5.236e-18
Identity = 74/333 (22.22%), Postives = 136/333 (40.84%), Query Frame = 1
Query:  841 EEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEF-----SPILYALNSGQIEIAKLLITNNCDINCS---------------------------------TRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVV-----------------------------QLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            E++F  H+   NG  +  Q     P+ + +C    +      +  L A  +G +E     + NN DIN S                                 T+     +H AS  G  EV  +L++    +  ++     P+++A+  N+  ++RLL++N  N     ++   P+ VA Q+G  +VV                              LL+DN  N +  +     P+HIAS  G   I  +L++ GAD N    +  +PL++A + G  ++  +L++ G NIE ++     P+H A ++G  ++  +L++    I  +  N
Sbjct:  123 EQIF--HHEGANGGASHKQQTHHHPNKHEHCPTGHQSAGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKN 453          

HSP 9 Score: 66.6254 bits (161), Expect = 1.633e-10
Identity = 52/198 (26.26%), Postives = 87/198 (43.94%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDD--SRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKS-----------ANRAIHFACMSESEE 789
            +SK+G   LH S + G+ +    LI+HK  +     +G  P+H   Q  N ++ + L ++G  ++   +  + P+H A   G   + R L+     N+ A       P+H   + G+  +V LLL  K   N       T LH A + G    + +L S K   K ++   +           A  A+H + MS+SEE
Sbjct:  780 ESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNG-ANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG---YISVLDSLKTITKEDETAAAPSQAEEKYRVVAPEAMHESFMSDSEE 973          

HSP 10 Score: 51.2174 bits (121), Expect = 6.408e-6
Identity = 23/79 (29.11%), Postives = 41/79 (51.90%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGY 2584
            +Q P+H+A   GN++IV LL+ HG+ ++   +     +H A + G  ++   L+ N  A+        TPL L   +G+
Sbjct:  619 QQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 697          
BLAST of SMED30013077 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303121)

HSP 1 Score: 195.667 bits (496), Expect = 4.128e-50
Identity = 116/463 (25.05%), Postives = 222/463 (47.95%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            ++ GL  LHC+ ++G+   V  L++    I     +G  P+H A QG + D  + L+     ++ +       +H A   GH+ VA++L+ R    N +A +   P+H AC+   + +V+LLL    +I+       T LH A   G  +IV  L+       +   T      +H A  +   +I+ IL+    +++ +  E+  PLH A   GN  I  LL+      V+    + ++ +  A   GQ E+A +LI N   ++ +T+    P+H  +  G  +VA +L+ ++ D++ +      P+ +A   NN ++  LL+    +  +T      P+H+A +K  +++   L++     N  +     P+H++S+ G  EI  +L+EH A  N       TP++L  ++ + +V+++L  NG NI+  +   + P+H A   G   + + L+ +  ++D
Sbjct:  268 TRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDV--PTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQ-HGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVD 727          

HSP 2 Score: 191.045 bits (484), Expect = 1.098e-48
Identity = 115/468 (24.57%), Postives = 212/468 (45.30%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            SKSG   LH +   GN +    LI    D+     H   P+H A + G  ++V  L+E G  +         P+H A  +GH  V  +L+ R   ++ K  +   P+H A +  +VD  ++LL  +  ++    +  TALH A   G+  + +LL+        N    +    +H AC     ++VE+L+     I+   +  + PLH A   G   I   L+   D + +       +P+  A  + Q +I ++L+ N   ++   R Q+ P+H AS LG  ++  +L+     ++  T      + IA+     E+  +LI N   + +   +   P+H+  + G ++V QLL+    +++      + P+H+A      ++  +LLE GA  +       TPL++A  K   D++  L++ G     +S   + P+H + Q G  EI+ LL++   +++    N
Sbjct:  202 SKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADA--NARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQ-HDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKN 666          

HSP 3 Score: 187.578 bits (475), Expect = 1.175e-47
Identity = 131/561 (23.35%), Postives = 244/561 (43.49%), Query Frame = 1
Query:  145 LDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR------------------------QLVNIKAPDDSR------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTND---------------------------------ENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            L+ ++ HL+  ++I  S              + +GLNALH + K+G++  V  L+     ++     G   +H A   G  ++VK L+E    +N   +  F P++ A    H AV R+L+S                         ++V +    D+R       +H A +  +V    LLL +    +V     FT LH A   GN +I  LL+       +N + K     +H A       +V +L+ K   I  K  + + PLH A  +G++ +  +L++     ++ K     +P+  A     ++ A++L+ +   ++  T      +H A+  G   VA +L+DR  D     +    P+ IA   N ++++ LL+ +  +I +T +                                   E P+H+A +    +++++L+ N   ++    +   P+HIAS  G V+IV +LL+HGA  +       T L++A ++G  +V+ VLI+NG  ++  + K + P+H   + G  ++AQLL+     +D +  N
Sbjct:   24 LERVLEHLKNNIDINTS--------------NANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGAD--VNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLE-RGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKN 567          

HSP 4 Score: 186.808 bits (473), Expect = 2.073e-47
Identity = 116/467 (24.84%), Postives = 217/467 (46.47%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPD-----DSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEND 1635
            L ALH +   G++   K L+D   D      +G+ P+H AC+     +V+ L+  G  ++   E    P+H A   G + +   L+        +PD        P+H A R    D++++LL +   ++    E+ T LH A + GN DIV LL+    Q  ++  TK    A+H A     +E+  +LI     ++    +   PLH     G+  +AQLL+   + +V+ +     +P+  A +    ++A LL+      + + +    P+H A+     ++A  L++       E+     P+ ++S   + EI  LLI +   +         P+H+  Q+  V V ++L  N  NI+ A      P+H+AS  G+  +V+ LL++GA+ +   +   TPL+   ++GH  +  +L+++  N   Q++    P+H A + G+  +    +DS  +I  E++
Sbjct:  338 LTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHD----ASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQ--VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQ-KEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISV----LDSLKTITKEDE 793          

HSP 5 Score: 183.726 bits (465), Expect = 2.080e-46
Identity = 121/525 (23.05%), Postives = 234/525 (44.57%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVS--GKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            +K G  ALH +   G  + VK L++H   +     +G+ P++ A Q  +  +V+ L+ +G   +   E  F P+  A   GH  V  +L+   +R  V + A       DD +                     P+H A   GN ++  LL+     +N +     + LH A + G  ++V LL+   G ++ K  D        +H A  S  E++V++L+ +   I+ K    + PLH A                                    G+  +A+LL+D  + + N +    F+P+  A    ++++ +LL+ +   I+ +T +   P+H A+ +G   +   L+      +  T+    P+ +A+  N  +I+R+L+ N   + +   E + P+H+A + G V++V LL+ +   ++     +   +HIA++ G+ E+  +L+E+GA  +       TPL+L  + GH  V+++L+    +++ Q      P+H AC     ++A LL++   S
Sbjct:   74 TKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTP----LHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLD-RNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGAS 593          

HSP 6 Score: 149.058 bits (375), Expect = 1.071e-35
Identity = 96/410 (23.41%), Postives = 191/410 (46.59%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGN-HDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN-------VNYFSLINIYVYFV 1680
            A R GN++ V   L +   IN +++    ALH A + G+ H +  LL  G +   ++ ATK  N A+H A ++  EE+V++L+     +N ++     PL+ A    + A+ +LL+     N +    + F+P+  A+  G                              ++ A LL+ N+ + + ++++   P+H AS  G   +A++LI +  D+         P+ +A+      ++ LL+    NI++   +   P+H A + G  +VV +L++    I+      + P+H+A++   V+  +ILL H A  + +     T L++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    SI    ++         +   +NI +Y +
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAI---VDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLS-NGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLL 423          

HSP 7 Score: 147.902 bits (372), Expect = 2.343e-35
Identity = 106/420 (25.24%), Postives = 196/420 (46.67%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            A + GN + V   +++   +N       + +H A  +GH+ V   L+ R  +V+      +  +H A   G  ++VKLLL    ++NV     FT L+ A Q+ +  +VRLL+S      +  AT+     +  A     +++V +L+    E + +    +  LH A    +   A LL+D  D N +  +   F+P+  A + G   IA LLI    D+N S +    P+H A+  G T +  +L+++  +IE +T     P+  A+ + + +++ +L+     I +       P+H+A Q   V+  ++L+ +   ++      +  +H+A+  G V + K+LL+  AD N       TPL++A +K    V ++L+ +G +I   +     P+H A   G   I   L+    S D
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSL--ATEDGFTPLAVAMQQGHDKVVAVLL----ESDTRGKVRLPALHIAAKKDDVKAATLLLD-NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPD 430          

HSP 8 Score: 88.5817 bits (218), Expect = 3.179e-17
Identity = 66/291 (22.68%), Postives = 120/291 (41.24%), Query Frame = 1
Query:  952 SPILYALNSGQIEIAKLLITNNCDINCS---------------------------------TRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVV-----------------------------QLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +  L A  +G +E     + NN DIN S                                 T+     +H AS  G  EV  +L++    +  ++     P+++A+  N+  ++RLL++N  N     ++   P+ VA Q+G  +VV                              LL+DN  N +  +     P+HIAS  G   I  +L++ GAD N    +  +PL++A + G  ++  +L++ G NIE ++     P+H A ++G  ++  +L++    I  +  N
Sbjct:   13 TSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKN 303          

HSP 9 Score: 66.6254 bits (161), Expect = 1.643e-10
Identity = 52/198 (26.26%), Postives = 87/198 (43.94%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDD--SRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKS-----------ANRAIHFACMSESEE 789
            +SK+G   LH S + G+ +    LI+HK  +     +G  P+H   Q  N ++ + L ++G  ++   +  + P+H A   G   + R L+     N+ A       P+H   + G+  +V LLL  K   N       T LH A + G    + +L S K   K ++   +           A  A+H + MS+SEE
Sbjct:  630 ESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNG-ANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLG---YISVLDSLKTITKEDETAAAPSQAEEKYRVVAPEAMHESFMSDSEE 823          

HSP 10 Score: 51.2174 bits (121), Expect = 6.397e-6
Identity = 23/79 (29.11%), Postives = 41/79 (51.90%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGY 2584
            +Q P+H+A   GN++IV LL+ HG+ ++   +     +H A + G  ++   L+ N  A+        TPL L   +G+
Sbjct:  469 QQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 547          
BLAST of SMED30013077 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 203.756 bits (517), Expect = 6.224e-53
Identity = 117/468 (25.00%), Postives = 226/468 (48.29%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            SK+G   LH +    NL   + L++   ++     +G  P+H A + GN  +V+ L++ G  ++   +    P+H A  NGH+ V  IL+ +   +  K  +   PIH A +  ++D V+ LL     I+    +  T LH A   G+H +V++L+      K N    +    +H AC       +++L+     +    +  + PLH A   G+  I + L+     + N  N +  +P+  A  +G  E+A+ L+ NN  ++   +  + P+H A+ +G  E+  +L++ + + +  T     P+ IA+   + +  R+L+  +        +   P+HVAC+ G V+VV+LL++   N N A    + P+H+A  +  +++VK+L+  G   +       T L++A ++   +V+  L+  G N   +S++   P+H A Q G  ++  LL+    +++  N N
Sbjct:  144 SKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKG--AKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQR-GASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKN 608          

HSP 2 Score: 182.185 bits (461), Expect = 3.512e-46
Identity = 125/503 (24.85%), Postives = 224/503 (44.53%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLI----------------------TNHCNI-----------KSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +K G  ALH +   G    V  LI++  ++      G+ P++ A Q  + ++VKYL+E G   +   E  F P+  A   GH  V  +LI   ++  V + A      +H A R  +     +LL +    +V     FT LH A    N  + +LL++      +N   K+    +H A    +  +V +L+ +  +I+ K  +E+ PLH A  NG+  + ++L+D     +  K     SPI  A     ++  + L+  N +I+  T     P+H A+  G   +  +L+D+        +    P+ IA   N++  + LL+                        H NI            ++N + E P+H+A + G  EV Q L+ N+  ++        P+H A+  G  E+VK+L+EH A+ +   T   TPL++A  +GH   +++L+D        + K + P+H AC+ G  ++ +LL++   + +    N
Sbjct:   16 TKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPA------LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRG--ANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQ-GAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKN 509          

HSP 3 Score: 176.022 bits (445), Expect = 2.975e-44
Identity = 112/479 (23.38%), Postives = 216/479 (45.09%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR----QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLV----DSHCSIDTENDNVNYFSLIN 1662
            L  LH +   G+   VK L+D          +G+ P+H AC+  +   +  L++    +  + E    P+H A   GHL + + L+ R       N+K      P+H A R G+ ++ + LL +   ++    +  T LH A + G+ ++V+LL+  K     + AT + +  +H A      +   IL+ +  +      +   PLH AC  G   + +LL++    N N       +P+  A++   +++ KLL++     + + R     +H A+     EVA  L+    +   E++    P+ +AS     +++ LLI+   N+   N     P+H+  Q+G V +  +L+    ++  A+     P+H+A   G +++VK LL+  A  N       TPL+ A ++GH D+  +L+ +G      +     P+  A + G+  +  +L     +S   I TE   +++   ++
Sbjct:  280 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKV---ETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANP--DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLER-GANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEKHRMSFPETVD 752          

HSP 4 Score: 160.229 bits (404), Expect = 2.257e-39
Identity = 112/444 (25.23%), Postives = 194/444 (43.69%), Query Frame = 1
Query:  304 LIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANR--AIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            L+ +  D+E     G   +H A   G   +V  LI  G  +N   +K F P++ A    HL V                                VK LL      ++   + FT L  A QQG+ ++V LL        IN  TK   R  A+H A  ++      +L+      +  +     PLH A    N ++AQLL++    NVN       +P+  A   G + + +LL+     I+  T+ +  P+H A+  G   V  +L+D+   ++ +T     PI +A+  ++++ +R L+  +  I     ++  P+HVA   G   +V++L+D     N        P+HIA +   +  + +LL+H A    +     TPL++A   GH ++ K L+  G +    ++K   P+H A + G CE+AQ L+ ++  +D +
Sbjct:    5 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEV--------------------------------VKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALL--------INYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNR-GANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAK 407          

HSP 5 Score: 97.0561 bits (240), Expect = 7.147e-20
Identity = 50/157 (31.85%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPD--DSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLV 702
            +++G  ALH + K   L+    L+ +  +       G  P+H A Q G PD+V  LI     +N   +    P+H     GH+ +A +L+ +Q  ++ A       P+H AC  GN+ +VK LL  +  +N      +T LH A QQG+ DIV LL+
Sbjct:  540 ARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLV-KQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL 695          

HSP 6 Score: 70.4774 bits (171), Expect = 1.119e-11
Identity = 41/156 (26.28%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLL 699
            +S  G+  LH + + G  D V  LI  + ++   + +G  P+H   Q G+  I   L++ G  +       + P+H AC  G++ + + L+ +Q  VN K      P+H A + G+ D+V LLL      N   +   + L  A + G   ++ +L
Sbjct:  572 ESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 727          

HSP 7 Score: 66.2402 bits (160), Expect = 1.968e-10
Identity = 36/139 (25.90%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLL-LASKCAINVADSEK 642
            L +K+GL  LH   + G++     L+     +      GY P+H AC  GN  +VK+L++    +N      + P+H A   GH  +  +L+    L N    + + P+  A R G + ++ +L L ++ ++++  +EK
Sbjct:  604 LGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEK 742          

HSP 8 Score: 57.3806 bits (137), Expect = 1.205e-7
Identity = 32/105 (30.48%), Postives = 49/105 (46.67%), Query Frame = 2
Query: 2297 LFVEK*KYVNL**SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            L + K   VNL   N     P+HL    G++ I  +LV  G+++    R    P+H AC  GN+ ++K L+     ++ K     TPL      G+ D V+ L K
Sbjct:  594 LLISKQANVNL--GNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLK 696          

HSP 9 Score: 55.8398 bits (133), Expect = 3.477e-7
Identity = 63/276 (22.83%), Postives = 108/276 (39.13%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL---SKVLDA----NREIFH---RVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLA-GTTFLELATIHGNDDFAQKIRERICFPNE---NPYFNLMMAIKDNDPFSVQYLLAKFTFGAN 3142
            P+H+AC   ++  + LL+ H ++LE    S   P+H A   G+L+++K+L+    + +  N    TPL +    G+ +   FL   +  +DA    ++   H   R+ H ++VK    + A+         G + L +A     ++    +LD+  N Q+ +  K       +                C           L    N N     G T L +A  H N D  + +  +   P+    N Y  L +A K N       LL    +GAN
Sbjct:  315 PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSA--TTAGHTPLHIAAREGHAQTTRILLDE--NAQQTKMTKKGFTPLHVA---------------CKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLL---QYGAN 568          

HSP 10 Score: 52.373 bits (124), Expect = 3.856e-6
Identity = 54/231 (23.38%), Postives = 94/231 (40.69%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPN 3049
            P+H+A   GN+ +V+LL+D G+ ++   +    P+H A  NG++ +++ L+     +  K     +P+ +     + DCV    ++L  N EI      DDI              L++   L+ L VA      R++  +LD     +  +    ALN F             LH +   N   S       S     V  +G T L +A   G+ +  + + +R   PN
Sbjct:  183 PLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCV---RQLLQYNAEI------DDI-------------TLDH---LTPLHVAAHCGHHRMVKVLLD-----KGAKANARALNGF-----------TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPN 372          
BLAST of SMED30013077 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 203.371 bits (516), Expect = 9.251e-53
Identity = 117/468 (25.00%), Postives = 226/468 (48.29%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            SK+G   LH +    NL   + L++   ++     +G  P+H A + GN  +V+ L++ G  ++   +    P+H A  NGH+ V  IL+ +   +  K  +   PIH A +  ++D V+ LL     I+    +  T LH A   G+H +V++L+      K N    +    +H AC       +++L+     +    +  + PLH A   G+  I + L+     + N  N +  +P+  A  +G  E+A+ L+ NN  ++   +  + P+H A+ +G  E+  +L++ + + +  T     P+ IA+   + +  R+L+  +        +   P+HVAC+ G V+VV+LL++   N N A    + P+H+A  +  +++VK+L+  G   +       T L++A ++   +V+  L+  G N   +S++   P+H A Q G  ++  LL+    +++  N N
Sbjct:  236 SKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKG--AKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQR-GASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKN 700          

HSP 2 Score: 188.734 bits (478), Expect = 3.991e-48
Identity = 114/491 (23.22%), Postives = 235/491 (47.86%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEND------NVNYFSLINIYVYFVNSF 1689
            +K  L  LHC+ +NG++  V+ L+D    ++    +G  PIH A QG + D V+ L++    ++ +      P+H A   GH  + ++L+ +    N +A +   P+H AC+  ++  + LLL    ++        T LH A   G+ +IV+ L+  +     N +       +H A  +   E+ + L+    +++ K  ++  PLH A   G+K + +LL++    N +       +P+  A   G  +  ++L+  N      T+    P+H A   G  +V  +L++R  +          P+ +A  +NN+++++LL++   +  ST       +H+A ++  +EV   L+    N N  + + + P+H+AS+ G+ ++V +L+   A+ N       TPL+L  ++GH  ++ +L+  G ++   S   + P+H AC  G  ++ + L+     ++++        + +Y  L ++ V  + +F
Sbjct:  302 TKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLL--QRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEH-KANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTF 789          

HSP 3 Score: 175.637 bits (444), Expect = 4.311e-44
Identity = 120/465 (25.81%), Postives = 207/465 (44.52%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANR--AIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            ++GLN LH + K G++  V  L+ +  D+E     G   +H A   G   +V  LI  G  +N   +K F P++ A    HL V                                VK LL      ++   + FT L  A QQG+ ++V LL        IN  TK   R  A+H A  ++      +L+      +  +     PLH A    N ++AQLL++    NVN       +P+  A   G + + +LL+     I+  T+ +  P+H A+  G   V  +L+D+   ++ +T     PI +A+  ++++ +R L+  +  I     ++  P+HVA   G   +V++L+D     N        P+HIA +   +  + +LL+H A    +     TPL++A   GH ++ K L+  G +    ++K   P+H A + G CE+AQ L+ ++  +D +
Sbjct:   76 QNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEV--------------------------------VKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALL--------INYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNR-GANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAK 499          

HSP 4 Score: 160.999 bits (406), Expect = 1.515e-39
Identity = 114/509 (22.40%), Postives = 217/509 (42.63%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR----QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNC--------------------ICTY---------------ARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLV----DSHCSIDTENDNVNY 1647
            L  LH +   G+   VK L+D          +G+ P+H AC+  +   +  L++    +  + E    P+H A   GHL + + L+ R       N+K      P+H A R G+ ++ + LL +   ++    +  T LH A + G+ ++V+LL+  K     + AT + +  +H A      +   IL+ +  +      +   PLH AC  G   + +LL++    N N       +P+  A++   +++ KLL++     + + R     +H A+     EVA  L+    +   E++    P+ +AS     +++ LLI+   N+   N     P+H+  Q+G V +  +L+    ++  A+     P+H+A   G +++VK LL+  A  N                     +CT                  TPL+ A ++GH D+  +L+ +G      +     P+  A + G+  +  +L     +S   I TE   +++
Sbjct:  372 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKV---ETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANP--DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLER-GANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEKHRMSF 874          

HSP 5 Score: 84.7297 bits (208), Expect = 4.430e-16
Identity = 63/295 (21.36%), Postives = 122/295 (41.36%), Query Frame = 1
Query:  940 AEEFSPILYALNSGQIEIAKLLITNNCDIN---------------------------------CSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLID-----------------------------NHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            A+  +  L A  SG +E A   I N  DIN                                  +T+     +H A+  G  +V   LI+   ++  ++     P+++A+  N++E+++ L+ +  N     ++   P+ VA Q+G   VV LLI+                             N  N +  +     P+HIA+    + + ++LL  GA+ N       TPL++A+ +G+  + ++L+D G  I+ ++  +  P+H A +NG   + ++L+D    +  +  N
Sbjct:   43 ADATTSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKN 337          

HSP 6 Score: 62.003 bits (149), Expect = 3.864e-9
Identity = 46/160 (28.75%), Postives = 76/160 (47.50%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTG--NVDLVKL-LLASKCAINVADSEKFTALHYACQQGNHDIVRLLV 702
            +S  G+  LH + + G  D V  LI  + ++   + +G  P+H   Q G+  I   L++ G  +       + P+H AC  G++ + + L+ +Q  VN K    S  +  A  TG  +V +  L   A   ++       +T LH A QQG+ DIV LL+
Sbjct:  664 ESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKT-RVSVLLLDASYTGLFSVSVCTLRTFAFSFSLIFLFQLGYTPLHQAAQQGHTDIVTLLL 822          

HSP 7 Score: 55.8398 bits (133), Expect = 3.185e-7
Identity = 65/277 (23.47%), Postives = 113/277 (40.79%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL---SKVLDA----NREIFH---RVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEI--KERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNE---NPYFNLMMAIKDNDPFSVQYLLAKFTFGAN 3142
            P+H+AC   ++  + LL+ H ++LE    S   P+H A   G+L+++K+L+    + +  N    TPL +    G+ +   FL   +  +DA    ++   H   R+ H ++VK    + A+         G + L +A     ++    +LD+  N Q+ +  K       +  K   + + E  L R    N               +N    G T L +A  H N D  + +  +   P+    N Y  L +A K N       LL    +GAN
Sbjct:  407 PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSA--TTAGHTPLHIAAREGHAQTTRILLDE--NAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPN------------AAGKN----GLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLL---QYGAN 660          

HSP 8 Score: 52.373 bits (124), Expect = 4.248e-6
Identity = 54/231 (23.38%), Postives = 93/231 (40.26%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPN 3049
            P+H+A   GN+ +V+LL+D G+ ++   +    P+H A  NG++ +++ L+     +  K     +P+ +     + DCV    ++L  N EI      DDI              L++   L+ L VA      R++  +LD+            ALN F             LH +   N   S       S     V  +G T L +A   G+ +  + + +R   PN
Sbjct:  275 PLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCV---RQLLQYNAEI------DDI-------------TLDH---LTPLHVAAHCGHHRMVKVLLDKGAKAN-----ARALNGF-----------TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPN 464          
BLAST of SMED30013077 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 202.986 bits (515), Expect = 1.833e-52
Identity = 117/468 (25.00%), Postives = 226/468 (48.29%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            SK+G   LH +    NL   + L++   ++     +G  P+H A + GN  +V+ L++ G  ++   +    P+H A  NGH+ V  IL+ +   +  K  +   PIH A +  ++D V+ LL     I+    +  T LH A   G+H +V++L+      K N    +    +H AC       +++L+     +    +  + PLH A   G+  I + L+     + N  N +  +P+  A  +G  E+A+ L+ NN  ++   +  + P+H A+ +G  E+  +L++ + + +  T     P+ IA+   + +  R+L+  +        +   P+HVAC+ G V+VV+LL++   N N A    + P+H+A  +  +++VK+L+  G   +       T L++A ++   +V+  L+  G N   +S++   P+H A Q G  ++  LL+    +++  N N
Sbjct:  206 SKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKG--AKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQR-GASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKN 670          

HSP 2 Score: 175.252 bits (443), Expect = 7.690e-44
Identity = 120/465 (25.81%), Postives = 207/465 (44.52%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANR--AIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            ++GLN LH + K G++  V  L+ +  D+E     G   +H A   G   +V  LI  G  +N   +K F P++ A    HL V                                VK LL      ++   + FT L  A QQG+ ++V LL        IN  TK   R  A+H A  ++      +L+      +  +     PLH A    N ++AQLL++    NVN       +P+  A   G + + +LL+     I+  T+ +  P+H A+  G   V  +L+D+   ++ +T     PI +A+  ++++ +R L+  +  I     ++  P+HVA   G   +V++L+D     N        P+HIA +   +  + +LL+H A    +     TPL++A   GH ++ K L+  G +    ++K   P+H A + G CE+AQ L+ ++  +D +
Sbjct:   46 QNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEV--------------------------------VKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALL--------INYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNR-GANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAK 469          

HSP 3 Score: 175.252 bits (443), Expect = 8.600e-44
Identity = 112/479 (23.38%), Postives = 216/479 (45.09%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR----QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLV----DSHCSIDTENDNVNYFSLIN 1662
            L  LH +   G+   VK L+D          +G+ P+H AC+  +   +  L++    +  + E    P+H A   GHL + + L+ R       N+K      P+H A R G+ ++ + LL +   ++    +  T LH A + G+ ++V+LL+  K     + AT + +  +H A      +   IL+ +  +      +   PLH AC  G   + +LL++    N N       +P+  A++   +++ KLL++     + + R     +H A+     EVA  L+    +   E++    P+ +AS     +++ LLI+   N+   N     P+H+  Q+G V +  +L+    ++  A+     P+H+A   G +++VK LL+  A  N       TPL+ A ++GH D+  +L+ +G      +     P+  A + G+  +  +L     +S   I TE   +++   ++
Sbjct:  342 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKV---ETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANP--DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLER-GANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEKHRMSFPETVD 814          

HSP 4 Score: 97.0561 bits (240), Expect = 8.533e-20
Identity = 50/157 (31.85%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPD--DSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLV 702
            +++G  ALH + K   L+    L+ +  +       G  P+H A Q G PD+V  LI     +N   +    P+H     GH+ +A +L+ +Q  ++ A       P+H AC  GN+ +VK LL  +  +N      +T LH A QQG+ DIV LL+
Sbjct:  602 ARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLV-KQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLL 757          

HSP 5 Score: 85.5001 bits (210), Expect = 3.114e-16
Identity = 63/302 (20.86%), Postives = 125/302 (41.39%), Query Frame = 1
Query:  919 CNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDIN---------------------------------CSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLID-----------------------------NHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
             +++   A+  +  L A  SG +E A   I N  DIN                                  +T+     +H A+  G  +V   LI+   ++  ++     P+++A+  N++E+++ L+ +  N     ++   P+ VA Q+G   VV LLI+                             N  N +  +     P+HIA+    + + ++LL  GA+ N       TPL++A+ +G+  + ++L+D G  I+ ++  +  P+H A +NG   + ++L+D    +  +  N
Sbjct:    6 SSLSSPQADATTSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKN 307          

HSP 6 Score: 70.4774 bits (171), Expect = 1.322e-11
Identity = 41/156 (26.28%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLL 699
            +S  G+  LH + + G  D V  LI  + ++   + +G  P+H   Q G+  I   L++ G  +       + P+H AC  G++ + + L+ +Q  VN K      P+H A + G+ D+V LLL      N   +   + L  A + G   ++ +L
Sbjct:  634 ESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 789          

HSP 7 Score: 66.2402 bits (160), Expect = 2.365e-10
Identity = 36/139 (25.90%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLL-LASKCAINVADSEK 642
            L +K+GL  LH   + G++     L+     +      GY P+H AC  GN  +VK+L++    +N      + P+H A   GH  +  +L+    L N    + + P+  A R G + ++ +L L ++ ++++  +EK
Sbjct:  666 LGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMITTEK 804          

HSP 8 Score: 56.9954 bits (136), Expect = 1.388e-7
Identity = 32/105 (30.48%), Postives = 49/105 (46.67%), Query Frame = 2
Query: 2297 LFVEK*KYVNL**SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            L + K   VNL   N     P+HL    G++ I  +LV  G+++    R    P+H AC  GN+ ++K L+     ++ K     TPL      G+ D V+ L K
Sbjct:  656 LLISKQANVNL--GNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLK 758          

HSP 9 Score: 53.1434 bits (126), Expect = 2.355e-6
Identity = 62/260 (23.85%), Postives = 103/260 (39.62%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPN------ENPYFNLMMAIKDNDPFSVQYLL 3118
            P+H+A   GN+ +V+LL+D G+ ++   +    P+H A  NG++ +++ L+     +  K     +P+ +     + DCV    ++L  N EI      DDI              L++   L+ L VA      R++  +LD+            ALN F             LH +   N   S       S     V  +G T L +A   G+ +  + + +R   PN      E P   L MA +       Q+LL
Sbjct:  245 PLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCV---RQLLQYNAEI------DDI-------------TLDH---LTPLHVAAHCGHHRMVKVLLDKGAKAN-----ARALNGFTP-----------LHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETP---LHMAARAGHCEVAQFLL 460          

HSP 10 Score: 52.373 bits (124), Expect = 3.747e-6
Identity = 27/100 (27.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHD 2656
            P+H+AC   ++  + LL+ H ++LE    S   P+H A   G+L+++K+L+    + +  N    TPL +    G+ +   FL   L  N ++  + + D
Sbjct:  377 PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFL---LQNNAQVDAKAKDD 473          
BLAST of SMED30013077 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 201.83 bits (512), Expect = 4.688e-52
Identity = 118/471 (25.05%), Postives = 228/471 (48.41%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID---VPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            SK+G   LH +    NL   + L++   ++     +G  P+H A + GN  +V+ L++ G  ++   +    P+H A  NGH+ V  IL+ +   +  K  +   PIH A +  ++D V+ LL     I+    +  T LH A   G+H +V++L+      K N    +    +H AC       +++L+     +    +  + PLH A   G+  I + L+     P+ N+   +  E +P+  A  +G  E+A+ L+ NN  ++   +  + P+H A+ +G  E+  +L++ + + +  T     P+ IA+   + +  R+L+  +        +   P+HVAC+ G V+VV+LL++   N N A    + P+H+A  +  +++VK+L+  G   +       T L++A ++   +V+  L+  G N   +S++   P+H A Q G  ++  LL+    +++  N N
Sbjct:  214 SKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKG--AKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVE-TPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKN 681          

HSP 2 Score: 188.734 bits (478), Expect = 5.223e-48
Identity = 119/423 (28.13%), Postives = 201/423 (47.52%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMN---FLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDC-NVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK  ++  +  L+ H   +E V   G  P+H A   G+ +IVK L++ G   N   F  +    P+H A   GH  VA+ L+     V+ KA DD  P+H A R G+ +LVKLL+  K   + A +   T LH A ++G+    R+L+    Q      TK     +H AC     ++VE+L+ +    N      + PLH A  + N  + +LL+      +   +N   ++ +  A    Q+E+A  L+    + N  +     P+H AS  G  ++  +LI +Q ++         P+ + +   +V I  +L+    ++ + +     P+HVAC  G +++V+ L+    ++N        P+H A++ G  +IV +LL+HGA  N I T   +PL +A   G+  V  VL
Sbjct:  382 GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQ--TKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNG--YTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 800          

HSP 3 Score: 185.267 bits (469), Expect = 6.177e-47
Identity = 110/467 (23.55%), Postives = 225/467 (48.18%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKIN-DATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            +K  L  LHC+ +NG++  V+ L+D    ++    +G  PIH A QG + D V+ L++    ++ +      P+H A   GH  + ++L+ +    N +A +   P+H AC+  ++  + LLL    ++        T LH A   G+ +IV+ L+        N  ++      +H A  +   E+ + L+    +++ K  ++  PLH A   G+K + +LL++    N +       +P+  A   G  +  ++L+  N      T+    P+H A   G  +V  +L++R  +          P+ +A  +NN+++++LL++   +  ST       +H+A ++  +EV   L+    N N  + + + P+H+AS+ G+ ++V +L+   A+ N       TPL+L  ++GH  ++ +L+  G ++   S   + P+H AC  G  ++ + L+     ++++ 
Sbjct:  280 TKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEH-KANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKT 745          

HSP 4 Score: 174.481 bits (441), Expect = 1.426e-43
Identity = 109/454 (24.01%), Postives = 207/454 (45.59%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLV---NIKAPDD-SRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            L  LH +   G+   VK L+D          +G+ P+H AC+  +   +  L++    +  + E    P+H A   GHL + + L+ R      NI + D    P+H A R G+ ++ + LL +   ++    +  T LH A + G+ ++V+LL+  K     + AT + +  +H A      +   IL+ +  +      +   PLH AC  G   + +LL++    N N       +P+  A++   +++ KLL++     + + R     +H A+     EVA  L+    +   E++    P+ +AS     +++ LLI+   N+   N     P+H+  Q+G V +  +L+    ++  A+     P+H+A   G +++VK LL+  A  N       TPL+ A ++GH D+  +L+ +G      +     P+  A + G+  +  +L
Sbjct:  350 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANP--DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLER-GANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 800          

HSP 5 Score: 174.481 bits (441), Expect = 1.451e-43
Identity = 112/469 (23.88%), Postives = 219/469 (46.70%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNC---ICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            L S++GLN LH + K G++  V  L+ +  D+E     G   +H A   G   +V  LI  G  +N   +K F P++ A    HL V + L+      ++   D   P+  A + G+ ++V LL+       V    +  ALH A +  +     +L+       +   +K+    +H A   E+  + ++L+ +   +N      + PLH A   GN  + +LL+D     ++ K  +E +P+  A  +G + + ++L+     +   T+    PIH A+     +    L+    +I+  T+    P+ +A+   +  ++++L+       +       P+H+AC+K  +  + LL+ +  ++    +  + P+H+A+  G + IVK LL+ GA  N       Y  TPL++A   GH +V++ L+ N   ++ ++     P+H A + G  E+ +LL++   + D+
Sbjct:   51 LYSQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKV----RLPALHIAARNDDTRTAAVLLQNDPNPDV--LSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDR-GAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDS 512          

HSP 6 Score: 70.4774 bits (171), Expect = 1.118e-11
Identity = 44/167 (26.35%), Postives = 77/167 (46.11%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGN---HDIVRLLVSGKVQCK 723
            +S  G+  LH + + G  D V  LI  + ++   + +G  P+H   Q G+  I   L++ G  +       + P+H AC  G++ + + L+ +Q  VN K      P+H A + G+ D+V LLL      N   +   + L  A + G     D+++L+    V  K
Sbjct:  645 ESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMK 811          

HSP 7 Score: 64.3142 bits (155), Expect = 9.890e-10
Identity = 33/124 (26.61%), Postives = 58/124 (46.77%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLL 600
            L +K+GL  LH   + G++     L+     +      GY P+H AC  GN  +VK+L++    +N      + P+H A   GH  +  +L+    L N    + + P+  A R G + ++ +L
Sbjct:  677 LGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 800          

HSP 8 Score: 56.9954 bits (136), Expect = 1.390e-7
Identity = 32/105 (30.48%), Postives = 49/105 (46.67%), Query Frame = 2
Query: 2297 LFVEK*KYVNL**SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            L + K   VNL   N     P+HL    G++ I  +LV  G+++    R    P+H AC  GN+ ++K L+     ++ K     TPL      G+ D V+ L K
Sbjct:  667 LLISKQANVNL--GNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLK 769          

HSP 9 Score: 55.0694 bits (131), Expect = 5.896e-7
Identity = 55/235 (23.40%), Postives = 95/235 (40.43%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPY 3061
            P+H+A   GN+ +V+LL+D G+ ++   +    P+H A  NG++ +++ L+     +  K     +P+ +     + DCV    ++L  N EI      DDI              L++   L+ L VA      R++  +LD+            ALN F             LH +   N   S       S     V  +G T L +A   G+ +  + + +R   PN N +
Sbjct:  253 PLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCV---RQLLQYNAEI------DDI-------------TLDH---LTPLHVAAHCGHHRMVKVLLDKGAKAN-----ARALNGFTP-----------LHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIF 446          

HSP 10 Score: 53.5286 bits (127), Expect = 1.892e-6
Identity = 28/110 (25.45%), Postives = 55/110 (50.00%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYD 2686
            P+H+AC  GN+ +VK L+   +++    R    P+H A + G+ D++  L+ +    +      ++PL + K  GY   +  L  V + +  + HR+   + V  +E+ D
Sbjct:  718 PLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMKHRMSFPETV--DEILD 825          
BLAST of SMED30013077 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 201.445 bits (511), Expect = 5.933e-52
Identity = 118/471 (25.05%), Postives = 228/471 (48.41%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID---VPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            SK+G   LH +    NL   + L++   ++     +G  P+H A + GN  +V+ L++ G  ++   +    P+H A  NGH+ V  IL+ +   +  K  +   PIH A +  ++D V+ LL     I+    +  T LH A   G+H +V++L+      K N    +    +H AC       +++L+     +    +  + PLH A   G+  I + L+     P+ N+   +  E +P+  A  +G  E+A+ L+ NN  ++   +  + P+H A+ +G  E+  +L++ + + +  T     P+ IA+   + +  R+L+  +        +   P+HVAC+ G V+VV+LL++   N N A    + P+H+A  +  +++VK+L+  G   +       T L++A ++   +V+  L+  G N   +S++   P+H A Q G  ++  LL+    +++  N N
Sbjct:  233 SKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKG--AKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVE-TPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKN 700          

HSP 2 Score: 188.348 bits (477), Expect = 6.654e-48
Identity = 119/423 (28.13%), Postives = 201/423 (47.52%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMN---FLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDC-NVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK  ++  +  L+ H   +E V   G  P+H A   G+ +IVK L++ G   N   F  +    P+H A   GH  VA+ L+     V+ KA DD  P+H A R G+ +LVKLL+  K   + A +   T LH A ++G+    R+L+    Q      TK     +H AC     ++VE+L+ +    N      + PLH A  + N  + +LL+      +   +N   ++ +  A    Q+E+A  L+    + N  +     P+H AS  G  ++  +LI +Q ++         P+ + +   +V I  +L+    ++ + +     P+HVAC  G +++V+ L+    ++N        P+H A++ G  +IV +LL+HGA  N I T   +PL +A   G+  V  VL
Sbjct:  401 GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQ--TKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNG--YTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 819          

HSP 3 Score: 184.882 bits (468), Expect = 7.534e-47
Identity = 110/467 (23.55%), Postives = 225/467 (48.18%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKIN-DATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            +K  L  LHC+ +NG++  V+ L+D    ++    +G  PIH A QG + D V+ L++    ++ +      P+H A   GH  + ++L+ +    N +A +   P+H AC+  ++  + LLL    ++        T LH A   G+ +IV+ L+        N  ++      +H A  +   E+ + L+    +++ K  ++  PLH A   G+K + +LL++    N +       +P+  A   G  +  ++L+  N      T+    P+H A   G  +V  +L++R  +          P+ +A  +NN+++++LL++   +  ST       +H+A ++  +EV   L+    N N  + + + P+H+AS+ G+ ++V +L+   A+ N       TPL+L  ++GH  ++ +L+  G ++   S   + P+H AC  G  ++ + L+     ++++ 
Sbjct:  299 TKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEH-KANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKT 764          

HSP 4 Score: 174.481 bits (441), Expect = 1.566e-43
Identity = 112/469 (23.88%), Postives = 219/469 (46.70%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNC---ICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            L S++GLN LH + K G++  V  L+ +  D+E     G   +H A   G   +V  LI  G  +N   +K F P++ A    HL V + L+      ++   D   P+  A + G+ ++V LL+       V    +  ALH A +  +     +L+       +   +K+    +H A   E+  + ++L+ +   +N      + PLH A   GN  + +LL+D     ++ K  +E +P+  A  +G + + ++L+     +   T+    PIH A+     +    L+    +I+  T+    P+ +A+   +  ++++L+       +       P+H+AC+K  +  + LL+ +  ++    +  + P+H+A+  G + IVK LL+ GA  N       Y  TPL++A   GH +V++ L+ N   ++ ++     P+H A + G  E+ +LL++   + D+
Sbjct:   70 LYSQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKV----RLPALHIAARNDDTRTAAVLLQNDPNPDV--LSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDR-GAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDS 531          

HSP 5 Score: 174.096 bits (440), Expect = 1.707e-43
Identity = 109/454 (24.01%), Postives = 207/454 (45.59%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLV---NIKAPDD-SRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            L  LH +   G+   VK L+D          +G+ P+H AC+  +   +  L++    +  + E    P+H A   GHL + + L+ R      NI + D    P+H A R G+ ++ + LL +   ++    +  T LH A + G+ ++V+LL+  K     + AT + +  +H A      +   IL+ +  +      +   PLH AC  G   + +LL++    N N       +P+  A++   +++ KLL++     + + R     +H A+     EVA  L+    +   E++    P+ +AS     +++ LLI+   N+   N     P+H+  Q+G V +  +L+    ++  A+     P+H+A   G +++VK LL+  A  N       TPL+ A ++GH D+  +L+ +G      +     P+  A + G+  +  +L
Sbjct:  369 LTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANP--DSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLER-GANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 819          

HSP 6 Score: 70.4774 bits (171), Expect = 1.047e-11
Identity = 44/167 (26.35%), Postives = 77/167 (46.11%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGN---HDIVRLLVSGKVQCK 723
            +S  G+  LH + + G  D V  LI  + ++   + +G  P+H   Q G+  I   L++ G  +       + P+H AC  G++ + + L+ +Q  VN K      P+H A + G+ D+V LLL      N   +   + L  A + G     D+++L+    V  K
Sbjct:  664 ESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMK 830          

HSP 7 Score: 64.3142 bits (155), Expect = 9.182e-10
Identity = 33/124 (26.61%), Postives = 58/124 (46.77%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLL 600
            L +K+GL  LH   + G++     L+     +      GY P+H AC  GN  +VK+L++    +N      + P+H A   GH  +  +L+    L N    + + P+  A R G + ++ +L
Sbjct:  696 LGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 819          

HSP 8 Score: 56.9954 bits (136), Expect = 1.392e-7
Identity = 32/105 (30.48%), Postives = 49/105 (46.67%), Query Frame = 2
Query: 2297 LFVEK*KYVNL**SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            L + K   VNL   N     P+HL    G++ I  +LV  G+++    R    P+H AC  GN+ ++K L+     ++ K     TPL      G+ D V+ L K
Sbjct:  686 LLISKQANVNL--GNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLK 788          

HSP 9 Score: 55.0694 bits (131), Expect = 5.905e-7
Identity = 55/235 (23.40%), Postives = 95/235 (40.43%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPY 3061
            P+H+A   GN+ +V+LL+D G+ ++   +    P+H A  NG++ +++ L+     +  K     +P+ +     + DCV    ++L  N EI      DDI              L++   L+ L VA      R++  +LD+            ALN F             LH +   N   S       S     V  +G T L +A   G+ +  + + +R   PN N +
Sbjct:  272 PLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCV---RQLLQYNAEI------DDI-------------TLDH---LTPLHVAAHCGHHRMVKVLLDKGAKAN-----ARALNGFTP-----------LHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIF 465          

HSP 10 Score: 53.9138 bits (128), Expect = 1.446e-6
Identity = 32/123 (26.02%), Postives = 61/123 (49.59%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRH----DDIVKFNELYDAH--TLFVL 2707
            P+H+AC  GN+ +VK L+   +++    R    P+H A + G+ D++  L+ +    +      ++PL + K  GY   +  L  V + +  + HR+      D+I+  +E   A   T+FV+
Sbjct:  737 PLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMKHRMSFPETVDEILDVSEDEGAQIITIFVV 859          
BLAST of SMED30013077 vs. Ensembl Xenopus
Match: pan3 (poly(A) specific ribonuclease subunit PAN3 [Source:Xenbase;Acc:XB-GENE-5731378])

HSP 1 Score: 198.364 bits (503), Expect = 4.561e-53
Identity = 129/471 (27.39%), Postives = 220/471 (46.71%), Query Frame = 1
Query:  244 SGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLV--SGKVQCKINDATKSAN--------------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNC--ICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLV 1602
            SG   LH +  +G++  +++LI+    I+C D     P+H A + G+ + VK L+ +G  +  L + +  P+H A  N H  V +IL+  +    K  +    IH A   GN  L++LLL +K  ++  D +  TAL YA   G+   V++L+     +   I DA  + N                +  A      E  + LI K  +++ +       LH A   G+ +I +LLI     N+N     + +P+  A    + E+A +LI    ++N  T+    P+H AS  G   VA  L+  + ++  +    R P+ +A+     E+++LL+ N  +  ST  + + P+H+A   G +E+V +++         +     P+H A+  G  EI K LL+ G + N      + +TPL+LA E GH D+  +L+ NG  I      +  P+H AC+ G     Q LV
Sbjct:   50 SGETLLHIAAASGHVAVIEYLINKGAKIDCKDIKHRTPLHRAAENGHGEAVKVLLRAGAFIYSLDDDSLTPLHLAAENNHQNVVKILLQEEGRQYK--NRHNFIHMAATQGNNKLMQLLLKNKAPVDAVDEKSQTALLYAVSGGHLKTVKMLLEAGASIDSSIIDAAFATNNERTNINATNDIQYTPLLLAAELGKTESAQALIEKGAQLDVRTPNMSTALHLAVQGGDASITKLLIR-KGININIAGPGDQTPLHVAAFHNKQELADILIAAGANVNVVTKELFTPLHIASQRGNLHVAQSLLHHKANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKDKKTPLHIAAAAGHIEIVNVMLKGRARCAVKDMDGCTPMHYAAATGSSEIAKALLKAGKNKNVDEKNVWRKTPLHLAAEHGHSDLINLLLQNGAAINALDNNRDTPLHCACKAGHLSSVQTLV 517          

HSP 2 Score: 163.31 bits (412), Expect = 2.750e-41
Identity = 113/459 (24.62%), Postives = 211/459 (45.97%), Query Frame = 1
Query:  268 SCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDS-RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNV 1641
            +   G+L  ++ ++    DI  V+  G   +H A   G+  +++YLI  G  ++    K   P+H A  NGH    ++L+          DDS  P+H A    + ++VK+LL  +      +   F  +H A  QGN+ +++LL+  K    ++   + +  A+ +A      + V++L+     I+    +  F      TN  +            N+N  N  +++P+L A   G+ E A+ LI     ++  T      +H A   G   +  +LI +  +I       + P+ +A+ +N  E+  +LI    N+     E   P+H+A Q+G + V Q L+ +  N+N  + +   P+H+A+E G  E+V++LL + AD N      +TPL++A   GH ++  V++        + +    P+H A   G  EIA+ L+ +  + + +  NV
Sbjct:   26 AVTKGDLSILRNIL-RDTDINAVNPSGETLLHIAAASGHVAVIEYLINKGAKIDCKDIKHRTPLHRAAENGHGEAVKVLLRAGAFIYSLDDDSLTPLHLAAENNHQNVVKILLQEEGR-QYKNRHNF--IHMAATQGNNKLMQLLLKNK--APVDAVDEKSQTALLYAVSGGHLKTVKMLLEAGASIDSSIIDAAF-----ATNNER-----------TNINATNDIQYTPLLLAAELGKTESAQALIEKGAQLDVRTPNMSTALHLAVQGGDASITKLLIRKGININIAGPGDQTPLHVAAFHNKQELADILIAAGANVNVVTKELFTPLHIASQRGNLHVAQSLLHHKANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKDKKTPLHIAAAAGHIEIVNVMLKGRARCAVKDMDGCTPMHYAAATGSSEIAKALLKAGKNKNVDEKNV 462          

HSP 3 Score: 147.902 bits (372), Expect = 3.184e-36
Identity = 105/412 (25.49%), Postives = 187/412 (45.39%), Query Frame = 1
Query:  253 NALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSR--PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLIT--NHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLE--HGADTNCICT--YARTPLYLA 1464
            N +H +   GN   ++ L+ +K  ++ VD      + YA  GG+   VK L+E+G                A ++  +  A    + +  NI A +D +  P+  A   G  +  + L+     ++V      TALH A Q G+  I +LL+   +   IN A       +H A     +E+ +ILI     +N    E   PLH A   GN  +AQ L+     NVN K+ +  +P+  A   G  E+ +LL+ N  D N + + ++ P+H A+  G  E+ ++++  +     + +    P+  A++  + EI + L+    + N+   N   + P+H+A + G  +++ LL+ N   IN  ++    P+H A + G +  V+ L+    G   N   T    +TPL +A
Sbjct:  149 NFIHMAATQGNNKLMQLLLKNKAPVDAVDEKSQTALLYAVSGGHLKTVKMLLEAG----------------ASIDSSIIDAAFATNNERTNINATNDIQYTPLLLAAELGKTESAQALIEKGAQLDVRTPNMSTALHLAVQGGDASITKLLIRKGIN--INIAGPGDQTPLHVAAFHNKQELADILIAAGANVNVVTKELFTPLHIASQRGNLHVAQSLLH-HKANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKDKKTPLHIAAAAGHIEIVNVMLKGRARCAVKDMDGCTPMHYAAATGSSEIAKALLKAGKNKNVDEKNVWRKTPLHLAAEHGHSDLINLLLQNGAAINALDNNRDTPLHCACKAGHLSSVQTLVSWVQGEKANLQATNGLKKTPLQVA 541          

HSP 4 Score: 105.916 bits (263), Expect = 9.873e-23
Identity = 86/385 (22.34%), Postives = 158/385 (41.04%), Query Frame = 1
Query:  631 DSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID-------------------------------VPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETI------------------LKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID-TEND 1635
            DS   T    A  +G+  I+R ++       IN    S    +H A  S    ++E LI K  +I+CK+ +   PLH A  NG+    ++L+                                + +     KN   F  I  A   G  ++ +LL+ N   ++      +  + +A + G  +   ML++    I+   I                  ++  P+ +A+     E  + LI     +          +H+A Q G   + +LLI    NIN A      P+H+A+ + + E+  IL+  GA+ N +     TPL++A+++G+  V++ L+ +  N+  +  +   P+H A + G  E+ QLL+++    + TE D
Sbjct:   17 DSSSMTVFD-AVTKGDLSILRNILR---DTDINAVNPSGETLLHIAAASGHVAVIEYLINKGAKIDCKDIKHRTPLHRAAENGHGEAVKVLLRAGAFIYSLDDDSLTPLHLAAENNHQNVVKILLQEEGRQYKNRHNF--IHMAATQGNNKLMQLLLKNKAPVDAVDEKSQTALLYAVSGGHLKTVKMLLEAGASIDSSIIDAAFATNNERTNINATNDIQYTPLLLAAELGKTESAQALIEKGAQLDVRTPNMSTALHLAVQGGDASITKLLIRKGININIAGPGDQTPLHVAAFHNKQELADILIAAGANVNVVTKELFTPLHIASQRGNLHVAQSLLHHKANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKD 395          

HSP 5 Score: 93.2041 bits (230), Expect = 7.970e-19
Identity = 77/296 (26.01%), Postives = 127/296 (42.91%), Query Frame = 1
Query:  256 ALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKIND-----------ATKSANRA----------------------IHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV---PDCNVNCKNAEEFSPILYALNS---GQIEIAKL--LITNN 1017
            ALH + + G+    K LI    +I         P+H A      ++   LI +G  +N + ++ F P+H A   G+L VA+ L+  +  VN K      P+H A   G  +LV+LLL +K   N  + +K T LH A   G+ +IV +++ G+ +C + D           AT S+  A                      +H A      +++ +L+     IN  ++    PLH AC  G+ +  Q L+        N+   N  + +P+  A +S       I KL  L+T+N
Sbjct:  267 ALHLAVQGGDASITKLLIRKGININIAGPGDQTPLHVAAFHNKQELADILIAAGANVNVVTKELFTPLHIASQRGNLHVAQSLLHHKANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKDKKTPLHIAAAAGHIEIVNVMLKGRARCAVKDMDGCTPMHYAAATGSSEIAKALLKAGKNKNVDEKNVWRKTPLHLAAEHGHSDLINLLLQNGAAINALDNNRDTPLHCACKAGHLSSVQTLVSWVQGEKANLQATNGLKKTPLQVAESSSSDAHQHIVKLVALVTDN 562          

HSP 6 Score: 90.8929 bits (224), Expect = 5.245e-18
Identity = 63/237 (26.58%), Postives = 113/237 (47.68%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKF--TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFAC----MSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKA---IAQLLIDVPD 918
            +K     LH + + GNL   + L+ HK ++   D     P+H A +GG  ++V+ L+ +    N  ++    P+H A   GH+ +  +++  R    +K  D   P+HYA  TG+ ++ K LL +    NV +   +  T LH A + G+ D++ LL+       IN    + +  +H AC    +S  + +V  + G+K  +   N  +  PL  A ++ + A   I +L+  V D
Sbjct:  327 TKELFTPLHIASQRGNLHVAQSLLHHKANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKDKKTPLHIAAAAGHIEIVNVMLKGRARCAVKDMDGCTPMHYAAATGSSEIAKALLKAGKNKNVDEKNVWRKTPLHLAAEHGHSDLINLLLQNG--AAINALDNNRDTPLHCACKAGHLSSVQTLVSWVQGEKANLQATNGLKKTPLQVAESSSSDAHQHIVKLVALVTD 561          

HSP 7 Score: 82.4185 bits (202), Expect = 2.150e-15
Identity = 67/281 (23.84%), Postives = 125/281 (44.48%), Query Frame = 1
Query:  928 NCKNAEEFSPILY-ALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQ------------------------------KGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGA--DTNCI-CTYAR---------------TPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            N K  +  S  ++ A+  G + I + ++  + DIN    + E  +H A+  G   V   LI++   I+C+ I  R P+  A+ N + E +++L+     I S +D++  P+H+A +                              +G  +++QLL+ N   ++  ++K    +  A   G ++ VK+LLE GA  D++ I   +A                TPL LA E G  + ++ LI+ G  ++ ++      +H A Q G   I +LL+    +I+
Sbjct:   12 NVKRTDSSSMTVFDAVTKGDLSILRNIL-RDTDINAVNPSGETLLHIAAASGHVAVIEYLINKGAKIDCKDIKHRTPLHRAAENGHGEAVKVLLRAGAFIYSLDDDSLTPLHLAAENNHQNVVKILLQEEGRQYKNRHNFIHMAATQGNNKLMQLLLKNKAPVDAVDEKSQTALLYAVSGGHLKTVKMLLEAGASIDSSIIDAAFATNNERTNINATNDIQYTPLLLAAELGKTESAQALIEKGAQLDVRTPNMSTALHLAVQGGDASITKLLIRKGININ 291          

HSP 8 Score: 55.0694 bits (131), Expect = 6.156e-7
Identity = 24/85 (28.24%), Postives = 47/85 (55.29%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            P+H+A   GNL++ + L+ H +N+   D+ ++ P+H A E G  +L++ L++N    +       TPL +    G+ + V+ + K
Sbjct:  333 PLHIASQRGNLHVAQSLLHHKANVNAKDKQSRTPLHLAAEGGAYELVQLLLNNKADPNSTEKDKKTPLHIAAAAGHIEIVNVMLK 417          

HSP 9 Score: 52.373 bits (124), Expect = 4.219e-6
Identity = 24/82 (29.27%), Postives = 48/82 (58.54%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +H+A +SG++ +++ L++ G+ ++C D  ++ P+H A ENG+ + +K L+     I+  +  S TPL L     + + V  L
Sbjct:   55 LHIAAASGHVAVIEYLINKGAKIDCKDIKHRTPLHRAAENGHGEAVKVLLRAGAFIYSLDDDSLTPLHLAAENNHQNVVKIL 136          
BLAST of SMED30013077 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 194.126 bits (492), Expect = 1.487e-49
Identity = 115/466 (24.68%), Postives = 234/466 (50.21%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV---PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +K  L  LHC+ +NG++   + L+DH   I+    +G  PIH A QG + D V+ L++    ++ +      P+H A   GH  VA++L+ +    N +A +   P+H AC+  ++ +++LLL S  +I+       T LH A   G+  IV+ L+  +     N  +      +H A  +   ++ + LI  K ++N +  ++  PLH A  +G+  + +LL++    PD      +    +P+      G  + A+LL+ N       T+    P+H A+  G  ++A +L++R+            P+ +A  +N++ I+RLL+    +   T      P+H+A ++  V+  + L+      N  + + + P+H+A++ G  ++V +LL   A+ +     + TPL+LA+++GH ++++VL+ +  ++  ++   + P+H AC  G  ++ + L+    +++
Sbjct:  260 TKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLL--QKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGH----TPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVN 719          

HSP 2 Score: 194.126 bits (492), Expect = 1.513e-49
Identity = 114/468 (24.36%), Postives = 220/468 (47.01%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            SK+G   LH +    NL+  + L++   ++     +G   +H A + GN  +V+ L++ G  ++   +    P+H A  NGH+ ++ IL+     +  K  +   PIH A +  ++D V+LLL  +  I+    +  T LH A   G+H + +LL+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  + +  +P+  A  +   ++A  LI N   +N   +  + P+H A+  G  E+  +L++     +  T     P+ + +   + +   LL+ N     S   +   P+HVA + G +++ +LL++   + N A    + P+H+A  +  + IV++LL  GA  +C      TPL++A ++   D ++ L+  G     QS++   P+H A Q G  ++  LL+    ++   N +
Sbjct:  194 SKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKG--AKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK-GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKS 658          

HSP 3 Score: 191.815 bits (486), Expect = 6.380e-49
Identity = 126/465 (27.10%), Postives = 213/465 (45.81%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            ++G++ALH + + GN+  V+ L+D    I+        P+H A + G+  I + L++ G  +    +    PIH A    HL   R+L+  Q  ++    D   P+H A   G+  + KLLL      N      FT LH AC++ +  ++ LL+  K    I+  T+S    +H A       IV+ L+ K    N  + +   PLH A    +  +A  LI      VN +  ++ +P+  A  SG  E+ +LL+ N    +  T     P+H  +  G T+ A +L+D Q      T     P+ +A+    ++I  LL+    +  S       P+HVA     + +V+LL++   + +C       P+H+A +   V+  + LL+ GA  N       TPL+LA ++GH D+  +L+    N+   +     P+H A Q G   IA++LV    S+  E 
Sbjct:  228 QNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLL--KSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQN-KAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAET 689          

HSP 4 Score: 186.808 bits (473), Expect = 2.708e-47
Identity = 123/494 (24.90%), Postives = 229/494 (46.36%), Query Frame = 1
Query:  145 LDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            LD+ + HLR  ++I                 +++GLNALH S K G++  V  L+     +E     G   +H A   G  D+V+ L+  G  +N   +K F P++ A    HL V + L+      N+   D   P+  A + G+ ++V  L++      V    +  ALH A +  +     +L+       +   +K+    +H A   E+  + ++L+ +   +N      +  LH A   GN  + +LL+D     ++    +E +P+  A+ +G + I+++L+ +   I   T+    PIH AS     +   +L+  Q  I+  T+    P+ +A+   +  + +LL+       +       P+H+AC+K  + V++LL+ +  +I+   +  + P+H+AS  G + IVK LL+ GA  N       TPL++A    H DV+  LI N   +  ++     P+H A ++G  E+ +LL+++    D
Sbjct:   16 LDKALDHLRNGVDINTC--------------NQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKV----RLPALHIAARNDDTRTAAVLLQNDPNADV--LSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDR-GAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPD 488          

HSP 5 Score: 186.037 bits (471), Expect = 4.750e-47
Identity = 100/423 (23.64%), Postives = 200/423 (47.28%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGC 1515
            L  LH +   G+    K L+D          +G+ P+H AC+  +  +++ L++SG  ++ + E    P+H A   GHL + + L+ +    N+ +     P+H A R  + D+   L+ +K  +N    +  T LH A + G++++VRLL+        +  T + +  +H        +  E+L+  +        +   PLH A   G   IA+LL++  + + N       +P+  A+    + I +LL+      +C+ R    P+H A      + A  L+        +++    P+ +A+   + +++ LL++   N+   N  +  P+H+A Q+G + + ++L+ +  ++         P+H+A   G +++VK LL+H A+ N +     TPL+ A ++GH D+  +L+ NG 
Sbjct:  330 LTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHP--DPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLER-EAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 749          

HSP 6 Score: 174.096 bits (440), Expect = 2.207e-43
Identity = 106/413 (25.67%), Postives = 193/413 (46.73%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILIS-RQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGA---DTNCICTYARTPLYLATEK 1473
            G   LH +CK  ++  ++ L+     I+ V   G  P+H A   G+  IVK L++ G   N    K   P+H A    H  VA  LI  +  VN +A DD  P+H A R+G+ ++V+LLL +    +   +   T LH   + G+     LL+    Q      TK     +H A      +I E+L+ ++   N      + PLH A  + +  I +LL++    + +C     ++P+  A+    ++ A+ L+      N  +     P+H A+  G  ++  +L+ +Q ++         P+ +AS   ++ I  +L+++  ++ +       P+HVAC  G ++VV+ L+ +  N+N        P+H A++ G  +IV +LL++GA     + +     +P  LA E+
Sbjct:  362 GFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDN--QAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNK-GASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMVSALTLSPPQLANER 771          

HSP 7 Score: 140.969 bits (354), Expect = 4.106e-33
Identity = 94/383 (24.54%), Postives = 176/383 (45.95%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            A R GN+D     L +   IN  +     ALH + ++G+  +V  L+   +   +   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L++    N N    + F+P+  AL  G                                 A +L+ N+ + +  ++T   P+H A+      VA +L++R  ++          + IAS   NV ++RLL+     I +   +   P+H A + G V + ++L+D+   I       + PIH+AS+   ++ V++LL++ A  + I     TPL++A   GH+ V+K+L+D G     +++  + P+H AC+     + +LL+ S  SID
Sbjct:   10 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDI--VLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLEN-GANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASID 389          

HSP 8 Score: 64.6994 bits (156), Expect = 8.584e-10
Identity = 28/92 (30.43%), Postives = 49/92 (53.26%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI 507
            L +KS L  LH + + G+L+  + L+ H   +      G+ P+H AC  GN  +VK+L++    +N + +  F P+H A   GH  +  +L+
Sbjct:  654 LGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLL 745          

HSP 9 Score: 57.3806 bits (137), Expect = 1.495e-7
Identity = 23/62 (37.10%), Postives = 38/62 (61.29%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGC 420
            +++ G   LH +C  GN+  VKFL+ H+ ++  V   G+ P+H A Q G+ DIV  L+++G 
Sbjct:  688 ETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA 749          

HSP 10 Score: 56.225 bits (134), Expect = 3.368e-7
Identity = 28/85 (32.94%), Postives = 45/85 (52.94%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            P+HLA   G+LNI ++LV H +++    R    P+H AC  GN+ ++K L+ +   ++       TPL      G+ D V+ L K
Sbjct:  662 PLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLK 746          

HSP 11 Score: 52.7582 bits (125), Expect = 4.366e-6
Identity = 40/162 (24.69%), Postives = 74/162 (45.68%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANRE---IFHRVRHDDIVKFNELYDAHTLFV-LEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFL 2818
            P+H+A    +LNIV+LL++ G++  C  R+   P+H A +  ++D  +AL+      + ++    TPL L    G+ D V+ L    + V   N+      H    +  +   E+  +H   V  E   G + L VA    + +++ ++L    N   +  L
Sbjct:  563 PLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKL 724          
BLAST of SMED30013077 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 192.971 bits (489), Expect = 3.595e-49
Identity = 115/466 (24.68%), Postives = 234/466 (50.21%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV---PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +K  L  LHC+ +NG++   + L+DH   I+    +G  PIH A QG + D V+ L++    ++ +      P+H A   GH  VA++L+ +    N +A +   P+H AC+  ++ +++LLL S  +I+       T LH A   G+  IV+ L+  +     N  +      +H A  +   ++ + LI  K ++N +  ++  PLH A  +G+  + +LL++    PD      +    +P+      G  + A+LL+ N       T+    P+H A+  G  ++A +L++R+            P+ +A  +N++ I+RLL+    +   T      P+H+A ++  V+  + L+      N  + + + P+H+A++ G  ++V +LL   A+ +     + TPL+LA+++GH ++++VL+ +  ++  ++   + P+H AC  G  ++ + L+    +++
Sbjct:  302 TKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLL--QKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGH----TPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVN 761          

HSP 2 Score: 192.586 bits (488), Expect = 4.661e-49
Identity = 113/462 (24.46%), Postives = 218/462 (47.19%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            SK+G   LH +    NL+  + L++   ++     +G   +H A + GN  +V+ L++ G  ++   +    P+H A  NGH+ ++ IL+     +  K  +   PIH A +  ++D V+LLL  +  I+    +  T LH A   G+H + +LL+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  + +  +P+  A  +   ++A  LI N   +N   +  + P+H A+  G  E+  +L++     +  T     P+ + +   + +   LL+ N     S   +   P+HVA + G +++ +LL++   + N A    + P+H+A  +  + IV++LL  GA  +C      TPL++A ++   D ++ L+  G     QS++   P+H A Q G  ++  LL+    ++
Sbjct:  236 SKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKG--AKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK-GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANV 694          

HSP 3 Score: 190.66 bits (483), Expect = 1.845e-48
Identity = 126/465 (27.10%), Postives = 213/465 (45.81%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            ++G++ALH + + GN+  V+ L+D    I+        P+H A + G+  I + L++ G  +    +    PIH A    HL   R+L+  Q  ++    D   P+H A   G+  + KLLL      N      FT LH AC++ +  ++ LL+  K    I+  T+S    +H A       IV+ L+ K    N  + +   PLH A    +  +A  LI      VN +  ++ +P+  A  SG  E+ +LL+ N    +  T     P+H  +  G T+ A +L+D Q      T     P+ +A+    ++I  LL+    +  S       P+HVA     + +V+LL++   + +C       P+H+A +   V+  + LL+ GA  N       TPL+LA ++GH D+  +L+    N+   +     P+H A Q G   IA++LV    S+  E 
Sbjct:  270 QNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLL--KSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQN-KAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAET 731          

HSP 4 Score: 187.578 bits (475), Expect = 1.600e-47
Identity = 105/451 (23.28%), Postives = 211/451 (46.78%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            L  LH +   G+    K L+D          +G+ P+H AC+  +  +++ L++SG  ++ + E    P+H A   GHL + + L+ +    N+ +     P+H A R  + D+   L+ +K  +N    +  T LH A + G++++VRLL+        +  T + +  +H        +  E+L+  +        +   PLH A   G   IA+LL++  + + N       +P+  A+    + I +LL+      +C+ R    P+H A      + A  L+        +++    P+ +A+   + +++ LL++   N+   N  +  P+H+A Q+G + + ++L+ +  ++         P+H+A   G +++VK LL+H A+ N +     TPL+ A ++GH D+  +L+ NG      S+    P+  A + G+  +  +L
Sbjct:  372 LTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHP--DPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLER-EAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 819          

HSP 5 Score: 186.037 bits (471), Expect = 4.960e-47
Identity = 123/494 (24.90%), Postives = 229/494 (46.36%), Query Frame = 1
Query:  145 LDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            LD+ + HLR  ++I                 +++GLNALH S K G++  V  L+     +E     G   +H A   G  D+V+ L+  G  +N   +K F P++ A    HL V + L+      N+   D   P+  A + G+ ++V  L++      V    +  ALH A +  +     +L+       +   +K+    +H A   E+  + ++L+ +   +N      +  LH A   GN  + +LL+D     ++    +E +P+  A+ +G + I+++L+ +   I   T+    PIH AS     +   +L+  Q  I+  T+    P+ +A+   +  + +LL+       +       P+H+AC+K  + V++LL+ +  +I+   +  + P+H+AS  G + IVK LL+ GA  N       TPL++A    H DV+  LI N   +  ++     P+H A ++G  E+ +LL+++    D
Sbjct:   58 LDKALDHLRNGVDINTC--------------NQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKV----RLPALHIAARNDDTRTAAVLLQNDPNADV--LSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDR-GAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPD 530          

HSP 6 Score: 139.813 bits (351), Expect = 9.813e-33
Identity = 94/383 (24.54%), Postives = 176/383 (45.95%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            A R GN+D     L +   IN  +     ALH + ++G+  +V  L+   +   +   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L++    N N    + F+P+  AL  G                                 A +L+ N+ + +  ++T   P+H A+      VA +L++R  ++          + IAS   NV ++RLL+     I +   +   P+H A + G V + ++L+D+   I       + PIH+AS+   ++ V++LL++ A  + I     TPL++A   GH+ V+K+L+D G     +++  + P+H AC+     + +LL+ S  SID
Sbjct:   52 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDI--VLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLEN-GANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASID 431          

HSP 7 Score: 65.0846 bits (157), Expect = 6.641e-10
Identity = 28/92 (30.43%), Postives = 49/92 (53.26%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI 507
            L +KS L  LH + + G+L+  + L+ H   +      G+ P+H AC  GN  +VK+L++    +N + +  F P+H A   GH  +  +L+
Sbjct:  696 LGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLL 787          

HSP 8 Score: 60.8474 bits (146), Expect = 1.404e-8
Identity = 34/102 (33.33%), Postives = 49/102 (48.04%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS---TPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRH 2653
            P+H+AC  GN+ +VK L+ H +N+    +    P+H A + G+ D++  L+ N     C N AS    TPL + K  GY      LS V D         RH
Sbjct:  737 PLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA---CPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANERH 835          

HSP 9 Score: 57.7658 bits (138), Expect = 1.318e-7
Identity = 28/85 (32.94%), Postives = 45/85 (52.94%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            P+HLA   G+LNI ++LV H +++    R    P+H AC  GN+ ++K L+ +   ++       TPL      G+ D V+ L K
Sbjct:  704 PLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLK 788          

HSP 10 Score: 53.5286 bits (127), Expect = 2.254e-6
Identity = 39/159 (24.53%), Postives = 73/159 (45.91%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANREI---FHRVRHDDIVKFNELYDAHTLFV-LEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEI 2809
            P+H+A    +LNIV+LL++ G++  C  R+   P+H A +  ++D  +AL+      + ++    TPL L    G+ D V+ L    + V   N+      H    +  +   E+  +H   V  E   G + L VA    + +++ ++L    N   +
Sbjct:  605 PLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAV 763          
BLAST of SMED30013077 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 192.971 bits (489), Expect = 3.652e-49
Identity = 115/466 (24.68%), Postives = 234/466 (50.21%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV---PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +K  L  LHC+ +NG++   + L+DH   I+    +G  PIH A QG + D V+ L++    ++ +      P+H A   GH  VA++L+ +    N +A +   P+H AC+  ++ +++LLL S  +I+       T LH A   G+  IV+ L+  +     N  +      +H A  +   ++ + LI  K ++N +  ++  PLH A  +G+  + +LL++    PD      +    +P+      G  + A+LL+ N       T+    P+H A+  G  ++A +L++R+            P+ +A  +N++ I+RLL+    +   T      P+H+A ++  V+  + L+      N  + + + P+H+A++ G  ++V +LL   A+ +     + TPL+LA+++GH ++++VL+ +  ++  ++   + P+H AC  G  ++ + L+    +++
Sbjct:  227 TKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLL--QKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGH----TPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVN 686          

HSP 2 Score: 192.586 bits (488), Expect = 4.231e-49
Identity = 113/462 (24.46%), Postives = 218/462 (47.19%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            SK+G   LH +    NL+  + L++   ++     +G   +H A + GN  +V+ L++ G  ++   +    P+H A  NGH+ ++ IL+     +  K  +   PIH A +  ++D V+LLL  +  I+    +  T LH A   G+H + +LL+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  + +  +P+  A  +   ++A  LI N   +N   +  + P+H A+  G  E+  +L++     +  T     P+ + +   + +   LL+ N     S   +   P+HVA + G +++ +LL++   + N A    + P+H+A  +  + IV++LL  GA  +C      TPL++A ++   D ++ L+  G     QS++   P+H A Q G  ++  LL+    ++
Sbjct:  161 SKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKG--AKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK-GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANV 619          

HSP 3 Score: 191.045 bits (484), Expect = 1.550e-48
Identity = 126/465 (27.10%), Postives = 213/465 (45.81%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            ++G++ALH + + GN+  V+ L+D    I+        P+H A + G+  I + L++ G  +    +    PIH A    HL   R+L+  Q  ++    D   P+H A   G+  + KLLL      N      FT LH AC++ +  ++ LL+  K    I+  T+S    +H A       IV+ L+ K    N  + +   PLH A    +  +A  LI      VN +  ++ +P+  A  SG  E+ +LL+ N    +  T     P+H  +  G T+ A +L+D Q      T     P+ +A+    ++I  LL+    +  S       P+HVA     + +V+LL++   + +C       P+H+A +   V+  + LL+ GA  N       TPL+LA ++GH D+  +L+    N+   +     P+H A Q G   IA++LV    S+  E 
Sbjct:  195 QNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLL--KSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQN-KAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAET 656          

HSP 4 Score: 189.504 bits (480), Expect = 4.225e-48
Identity = 117/461 (25.38%), Postives = 221/461 (47.94%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVN-IKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            +K G  ALH +   G  D V+ L++H  ++      G+ P++ A Q  +  +VK+L+E+G   N   E  F P+  A   GH  V   LIS  +   ++ P     +H A R  +     +LL +    +V     FT LH A    N ++ +LL++      +N   ++   A+H A    +  +V +L+ +  +I+    +E+ PLH A  NG+  I+++L+D     +  K     SPI  A     ++  +LL+     I+  T     P+H A+  G   VA +L+D+        +    P+ IA   +++ ++ LL+ +  +I +  +    P+HVA   G + +V+ L+    + N  + K+  P+H+A+     ++   L+++ A  N      +TPL+ A   GHY++ ++L++NG + +  +     P+H   + G  + A+LL+D+  +
Sbjct:   33 TKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPA----LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRG--ANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDH-GAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAA 486          

HSP 5 Score: 187.963 bits (476), Expect = 1.334e-47
Identity = 105/451 (23.28%), Postives = 211/451 (46.78%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            L  LH +   G+    K L+D          +G+ P+H AC+  +  +++ L++SG  ++ + E    P+H A   GHL + + L+ +    N+ +     P+H A R  + D+   L+ +K  +N    +  T LH A + G++++VRLL+        +  T + +  +H        +  E+L+  +        +   PLH A   G   IA+LL++  + + N       +P+  A+    + I +LL+      +C+ R    P+H A      + A  L+        +++    P+ +A+   + +++ LL++   N+   N  +  P+H+A Q+G + + ++L+ +  ++         P+H+A   G +++VK LL+H A+ N +     TPL+ A ++GH D+  +L+ NG      S+    P+  A + G+  +  +L
Sbjct:  297 LTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHP--DPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLER-EAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 744          

HSP 6 Score: 185.652 bits (470), Expect = 7.000e-47
Identity = 117/460 (25.43%), Postives = 216/460 (46.96%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            GLNALH S K G++  V  L+     +E     G   +H A   G  D+V+ L+  G  +N   +K F P++ A    HL V + L+      N+   D   P+  A + G+ ++V  L++      V    +  ALH A +  +     +L+       +   +K+    +H A   E+  + ++L+ +   +N      +  LH A   GN  + +LL+D     ++    +E +P+  A+ +G + I+++L+ +   I   T+    PIH AS     +   +L+  Q  I+  T+    P+ +A+   +  + +LL+       +       P+H+AC+K  + V++LL+ +  +I+   +  + P+H+AS  G + IVK LL+ GA  N       TPL++A    H DV+  LI N   +  ++     P+H A ++G  E+ +LL+++    D
Sbjct:    3 GLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKV----RLPALHIAARNDDTRTAAVLLQNDPNADV--LSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDR-GAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPD 455          

HSP 7 Score: 182.185 bits (461), Expect = 9.307e-46
Identity = 110/458 (24.02%), Postives = 211/458 (46.07%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLV 1602
            +  K  L ALH + +N +      L+ +  + + +   G+ P+H A    N ++ + L+  G  +NF  +     +H A   G++ + R+L+ R   ++    D+  P+H A R G+V + ++LL     I        + +H A Q  + D VRLL+  + Q  I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++       +P+  A   G + I K L+      N  +   E P+H A+    T+VA  LI  +  +       + P+  A+ + + E++RLL+ N  +          P+H+  + G  +  +LL+DN         K   P+H+A++ G+++I ++LLE  A  N       TPL++A    H ++ ++L++ G +  C +   + P+H A +    + A+ L+
Sbjct:  126 MKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLL--QYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS-GASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALL 580          

HSP 8 Score: 65.4698 bits (158), Expect = 6.395e-10
Identity = 28/92 (30.43%), Postives = 49/92 (53.26%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI 507
            L +KS L  LH + + G+L+  + L+ H   +      G+ P+H AC  GN  +VK+L++    +N + +  F P+H A   GH  +  +L+
Sbjct:  621 LGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLL 712          

HSP 9 Score: 61.2326 bits (147), Expect = 1.264e-8
Identity = 34/102 (33.33%), Postives = 49/102 (48.04%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS---TPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRH 2653
            P+H+AC  GN+ +VK L+ H +N+    +    P+H A + G+ D++  L+ N     C N AS    TPL + K  GY      LS V D         RH
Sbjct:  662 PLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA---CPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANERH 760          

HSP 10 Score: 57.7658 bits (138), Expect = 1.238e-7
Identity = 28/85 (32.94%), Postives = 45/85 (52.94%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            P+HLA   G+LNI ++LV H +++    R    P+H AC  GN+ ++K L+ +   ++       TPL      G+ D V+ L K
Sbjct:  629 PLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLK 713          

HSP 11 Score: 53.9138 bits (128), Expect = 2.100e-6
Identity = 39/159 (24.53%), Postives = 73/159 (45.91%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANREI---FHRVRHDDIVKFNELYDAHTLFV-LEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEI 2809
            P+H+A    +LNIV+LL++ G++  C  R+   P+H A +  ++D  +AL+      + ++    TPL L    G+ D V+ L    + V   N+      H    +  +   E+  +H   V  E   G + L VA    + +++ ++L    N   +
Sbjct:  530 PLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAV 688          
BLAST of SMED30013077 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 192.971 bits (489), Expect = 3.723e-49
Identity = 121/463 (26.13%), Postives = 219/463 (47.30%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-------SRQLVNIKAPDDS-RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLV 1602
            +K  L  LHC+ +NG++   + L+DH   I+    +G  PIH A QG + D V+ L++    ++ +      P+H A   GH  VA++L+       +R L+ I    +   P+H AC+  ++ +++LLL S  +I+    +  T LH A +  + D+   L+  K   K+N   K     +H A  S   E+V +L+      +        PLH     G+   A+LL+D    + +    + F+P+  A   G+I+IA+LL+      N + +T   P+H A       +  +L+++     C       P+ +A    +V+  R L+       + + +   P+H+A Q+G  ++V LL+    N++  N   + P+H+AS+ G + I ++L+ H A           PL++A   G+  V K L+ +  N+   +   + P+H A Q G  +I  LL+
Sbjct:  302 TKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALIIILFTTNGFTPLHIACKKSHIRVMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNK--AKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTK-KGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLL 761          

HSP 2 Score: 192.586 bits (488), Expect = 4.025e-49
Identity = 121/471 (25.69%), Postives = 216/471 (45.86%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDA-----TKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            SK+G   LH +    NL+  + L++   ++     +G   +H A + GN  +V+ L++ G  ++   +    P+H A  NGH+ ++ IL+     +  K  +   PIH A +  ++D V+LLL  +  I+    +  T LH A   G+H + +LL+    +           T +    +H AC      ++E+L+     I+   ++   PLH A    +  +A  LI      VN +  ++ +P+  A  SG  E+ +LL+ N    +  T     P+H  +  G T+ A +L+D Q      T     P+ +A+    ++I  LL+    +  S       P+HVA     + +V+LL++   + +C       P+H+A +   V+  + LL+ GA  N       TPL+LA ++GH D+  +L+    N+   +     P+H A Q G   IA++LV    S+  E 
Sbjct:  236 SKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALIIILFTTNGFTPLHIACKKSHIRVMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQN-KAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAET 705          

HSP 3 Score: 190.274 bits (482), Expect = 2.394e-48
Identity = 134/528 (25.38%), Postives = 239/528 (45.27%), Query Frame = 1
Query:  145 LDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNL---------------------------------DYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVN-IKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETIL-------KRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD 1605
            LD+ + HLR  ++I                 +++GLNALH S K G++                                 D V+ L++H  ++      G+ P++ A Q  +  +VK+L+E+G   N   E  F P+  A   GH  V   LIS  +   ++ P     +H A R  +     +LL +    +V     FT LH A    N ++ +LL++      +N   ++   A+H A    +  +V +L+ +  +I+    +E+ PLH A  NG+  I+++L+D     +  K     SPI  A     ++  +LL+     I+  T     P+H A+  G   VA +L+D+        ++          P+ IA   +++ ++ LL+ +  +I +  ++ E P+H+A +    +V   LI N   +N        P+H A+ +G  E+V++LLE+GA  +   T   TPL+L T  GH   +++L+DN       + K + P+H A + G  +IA+LL++
Sbjct:   58 LDKALDHLRNGVDINTC--------------NQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPA----LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRG--ANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDH-GAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALIIILFTTNGFTPLHIACKKSHIRVMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLE 564          

HSP 4 Score: 184.882 bits (468), Expect = 1.220e-46
Identity = 107/462 (23.16%), Postives = 214/462 (46.32%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMN-------FLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            +K+GL+ +H + +  +LD V+ L+ ++  I+ +      P+H A   G+  + K L++ G   N             F P+H AC   H+ V  +L+ S   ++        P+H A R  + D+   L+ +K  +N    +  T LH A + G++++VRLL+        +  T + +  +H        +  E+L+  +        +   PLH A   G   IA+LL++  + + N       +P+  A+    + I +LL+      +C+ R    P+H A      + A  L+        +++    P+ +A+   + +++ LL++   N+   N  +  P+H+A Q+G + + ++L+ +  ++         P+H+A   G +++VK LL+H A+ N +     TPL+ A ++GH D+  +L+ NG      S+    P+  A + G+  +  +L
Sbjct:  335 TKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALIIILFTTNGFTPLHIACKKSHIRVMELLLKSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHP--DPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLER-EAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 793          

HSP 5 Score: 182.57 bits (462), Expect = 6.912e-46
Identity = 111/477 (23.27%), Postives = 218/477 (45.70%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCK-------NDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +  K  L ALH + +N +      L+ +  + + +   G+ P+H A    N ++ + L+  G  +NF  +     +H A   G++ + R+L+ R   ++    D+  P+H A R G+V + ++LL     I        + +H A Q  + D VRLL+  + Q  I+D T      +H A       + ++L+ K  + N +             PLH AC   +  + +LL+     +++    +  +P+  A  +   ++A  LI N   +N   +  + P+H A+  G  E+  +L++     +  T     P+ + +   + +   LL+ N     S   +   P+HVA + G +++ +LL++   + N A    + P+H+A  +  + IV++LL  GA  +C      TPL++A ++   D ++ L+  G     QS++   P+H A Q G  ++  LL+    ++   N +
Sbjct:  201 MKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLL--QYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALIIILFTTNGFTPLHIACKKSHIRVMELLLKS-GASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKS 674          

HSP 6 Score: 181.03 bits (458), Expect = 1.724e-45
Identity = 114/472 (24.15%), Postives = 231/472 (48.94%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLL-------ASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV---PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            ++G++ALH + + GN+  V+ L+D    I+        P+H A + G+  I + L++ G  +    +    PIH A    HL   R+L+  Q  ++    D   P+H A   G+  + KLLL       A    I +  +  FT LH AC++ +  ++ LL+  K    I+  T+     +H A  +   ++ + LI  K ++N +  ++  PLH A  +G+  + +LL++    PD      +    +P+      G  + A+LL+ N       T+    P+H A+  G  ++A +L++R+            P+ +A  +N++ I+RLL+    +   T      P+H+A ++  V+  + L+      N  + + + P+H+A++ G  ++V +LL   A+ +     + TPL+LA+++GH ++++VL+ +  ++  ++   + P+H AC  G  ++ + L+    +++
Sbjct:  270 QNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALIIILFTTNGFTPLHIACKKSHIRVMELLL--KSGASIDAVTEKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGH----TPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVN 735          

HSP 7 Score: 134.42 bits (337), Expect = 4.587e-31
Identity = 95/396 (23.99%), Postives = 178/396 (44.95%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSI-------KKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNV 1641
            A R GN+D     L +   IN  +     ALH + ++G+  +V  L+   +   +   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L++    N N    + F+P+  AL  G                                 A +L+ N+ + +  ++T   P+H A+      VA +L++R  ++          + IAS   NV ++RLL+     I +   +   P+H A + G V + ++L+D+   I       + PIH+AS+   ++ V++LL++ A  + I     TPL++A   GH+ V+K+L+D G     +++         + P+H AC+     + +LL+ S  SID   + V
Sbjct:   52 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDI--VLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLEN-GANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALIIILFTTNGFTPLHIACKKSHIRVMELLLKSGASIDAVTEKV 444          

HSP 8 Score: 65.4698 bits (158), Expect = 5.642e-10
Identity = 34/124 (27.42%), Postives = 61/124 (49.19%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLL 600
            L +KS L  LH + + G+L+  + L+ H   +      G+ P+H AC  GN  +VK+L++    +N + +  F P+H A   GH  +  +L+      N  + +   P+  A R G + +  +L
Sbjct:  670 LGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 793          

HSP 9 Score: 60.4622 bits (145), Expect = 1.983e-8
Identity = 32/92 (34.78%), Postives = 47/92 (51.09%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS---TPLDLLKTFGYDDCVSFLSKVLDA 2623
            P+H+AC  GN+ +VK L+ H +N+    +    P+H A + G+ D++  L+ N     C N AS    TPL + K  GY      LS V D 
Sbjct:  711 PLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA---CPNQASMNGITPLAIAKRLGYISVTDVLSLVTDG 799          

HSP 10 Score: 57.3806 bits (137), Expect = 1.534e-7
Identity = 28/85 (32.94%), Postives = 45/85 (52.94%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            P+HLA   G+LNI ++LV H +++    R    P+H AC  GN+ ++K L+ +   ++       TPL      G+ D V+ L K
Sbjct:  678 PLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLK 762          

HSP 11 Score: 53.5286 bits (127), Expect = 2.647e-6
Identity = 39/159 (24.53%), Postives = 73/159 (45.91%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANREI---FHRVRHDDIVKFNELYDAHTLFV-LEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEI 2809
            P+H+A    +LNIV+LL++ G++  C  R+   P+H A +  ++D  +AL+      + ++    TPL L    G+ D V+ L    + V   N+      H    +  +   E+  +H   V  E   G + L VA    + +++ ++L    N   +
Sbjct:  579 PLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAV 737          
BLAST of SMED30013077 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 200.29 bits (508), Expect = 1.309e-51
Identity = 131/494 (26.52%), Postives = 231/494 (46.76%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI--DVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +K G  ALH +   G  + VK L+ +  ++     +G+ P++ A Q  + ++V++L+++G   +   E  F P+  A   GH  V  +L+   ++  V + A       DD++                     P+H A   GN+++  LLL    A++       T LH A ++GN ++V+LL+      KI+  T+     +H    S  E++VE+L+ +   I  K    + PLH A    +    QLL+  +VP   V+    +  + +  A + G  ++AK+L+      N        P+H A       V  +L+     I+  T     PI +A+   +V I+  L+ +  +  +TN   E  +H+A + G  EVV+ L+ +   +         P+HI++  G+ +IV+ LL+ GA  N   T   TPL+LA  +GH DV+  L+D+G ++   + K + P+H A + G  E+A LL+    S D
Sbjct:   98 TKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLD--RGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVP---VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPD 586          

HSP 2 Score: 191.815 bits (486), Expect = 6.280e-49
Identity = 117/493 (23.73%), Postives = 230/493 (46.65%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLV-NIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI----YVYFVNSFKQNN 1701
            ++ GL  LHC  ++G+   V+ L+D    I     +G  P+H A QG + + V+ L++    ++ +       +H A   GH  VA++L+ ++   N KA +   P+H AC+   + +++LLL    +I        T +H A   G+ +IV  L+        N        A+H A  S   E+V  L+    ++  K  ++  PLH +   G   I Q L+     + N      ++P+  A   G  ++A  L+ +   ++ +T+    P+H A+  G  EVA +L+ +    +        P+ +A+  +N ++  LL+    +  +       P+H+A +K  +++   L++   + N    + +  +H+A++ G V++V +LL   A+ N       TPL+LA ++   +V++VL++ G +++ Q+   + P+H  C  G  +I   L+     ++ +  N  Y +L       + + +N   QNN
Sbjct:  292 TRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASP--NTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ-GASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN-GYTALHQAAQQGHTHIINVLLQNN 780          

HSP 3 Score: 179.489 bits (454), Expect = 4.331e-45
Identity = 104/468 (22.22%), Postives = 216/468 (46.15%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            ++SKSG   LH +   GN++    L++    ++    +   P+H A + GN ++VK L++ G  ++        P+H    +GH  V  +L+ R   +  K  +   P+H A +  +++ V+LLL     ++   ++  TALH A   G++ + ++L+  K     N    +    +H AC      ++E+L+     I    +  + P+H A   G+  I   L+     + N  N    + +  A  SGQ E+ + L+ +   +    +  + P+H ++ LG  ++   L+ +       T     P+ +A+   + ++   L+ +  ++  T  +   P+HVA + G +EV  LL+    + + A    + P+H+A+     ++  +LL+ GA  +       TPL++A +K   D++  L++ G +    + +    +H A Q G  ++  LL+  + +++  N
Sbjct:  224 VESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASP--NAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHH-GASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSN 688          

HSP 4 Score: 178.333 bits (451), Expect = 9.645e-45
Identity = 115/465 (24.73%), Postives = 207/465 (44.52%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            +++ +  LH + K GN + VK L+D    I+     G  P+H   + G+  +V+ L++    +    +    P+H A    HL   ++L+   + V+    D    +H A   G+  + K+LL  K + N      FT LH AC++    ++ LL+  K    I   T+S    IH A       IV  L+      N  N      LH A  +G   + + L+      V  K  ++ +P+  +   G+ +I + L+      N +T +   P+H A+  G  +VA  L+D    +   T     P+ +A+    +E+  LL+    +  +       P+HVA      +V  LL+D   + + A      P+HIA++  +++I   LLE+GAD N +       ++LA ++GH D+  +L+    N+   +     P+H A Q     +A++LV+    +D +
Sbjct:  259 ARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL--KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQ-DGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ 720          

HSP 5 Score: 177.563 bits (449), Expect = 1.824e-44
Identity = 108/420 (25.71%), Postives = 184/420 (43.81%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK   +  ++ L+ H   I+ V   G  PIH A   G+ +IV  L+  G   N    +    +H A  +G   V R L+     V  KA DD  P+H + R G  D+V+ LL    + N A +  +T LH A ++G+ D+   L+       I   TK     +H A      E+  +L+ K    +      + PLH A    N+ +A LL+D     +   KN   ++P+  A    Q++IA  L+    D N  TR     +H A+  G  ++  +L+ R  ++         P+ +A+  + V +  +L+    ++ +       P+HV C  G +++V  L+ +   +N         +H A++ G   I+ +LL++ A  N +     T L +A   G+  V   L
Sbjct:  394 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNG--YTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 809          

HSP 6 Score: 144.821 bits (364), Expect = 2.464e-34
Identity = 101/423 (23.88%), Postives = 195/423 (46.10%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            A + G+ +     I++G  +N   +   + +H A   GH+ V   L+ R+  V+      +  +H A   G  ++VK+L+ +   +N      FT L+ A Q+ + ++VR L+       +  AT+     +  A     +++V +L+    E + K    +  LH A    +   A LL+   D N + ++   F+P+  A + G I +A LL+     ++ + R    P+H AS  G   +  +L+DR   I+ +T     P+   + + + +++ +L+     I S       P+H+A Q   +  VQLL+ ++  ++   +  +  +H+A+  G  ++ K+LL+  A  N       TPL++A +K    V ++L+ +G +I+  +     PIH A   G   I   L+    S +T N
Sbjct:   42 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSL--ATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQN-DTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTN 457          

HSP 7 Score: 101.679 bits (252), Expect = 4.074e-21
Identity = 61/222 (27.48%), Postives = 110/222 (49.55%), Query Frame = 1
Query:  961 LYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            L A  +G +E A   I N  D+N   +     +H AS  G  EV   L+ R+ +++  T      + IAS     E++++L+TN  N+ + +     P+++A Q+  +EVV+ L+DN  + + A +    P+ +A + G  ++V +LLE     N      R P L++A  K     + +L+ N  N + +S   + P+H A   G   +A LL++   ++D
Sbjct:   40 LRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD 256          

HSP 8 Score: 54.6842 bits (130), Expect = 7.433e-7
Identity = 24/92 (26.09%), Postives = 45/92 (48.91%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI 507
            L +KSGL  LH + +   ++  + L++    ++     GY P+H  C  GN  IV +L++    +N   +  +  +H A   GH  +  +L+
Sbjct:  686 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 777          

HSP 9 Score: 51.6026 bits (122), Expect = 6.916e-6
Identity = 27/99 (27.27%), Postives = 50/99 (50.51%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRH 2653
            P+H+A   GN+N+  LL++  + ++   R++  P+H A + GN +++K L+     I  K     TPL      G++  V  L   LD +  I  + ++
Sbjct:  232 PLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEML---LDRSAPILSKTKN 327          

HSP 10 Score: 51.6026 bits (122), Expect = 8.399e-6
Identity = 28/102 (27.45%), Postives = 49/102 (48.04%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDI 2662
            P+H+A   GN N+VKLL+D G+ ++   R    P+H    +G+  +++ L+  +  I  K     +PL +     + +CV  L +         H V  DD+
Sbjct:  265 PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ---------HNVPVDDV 357          
BLAST of SMED30013077 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 199.904 bits (507), Expect = 1.776e-51
Identity = 131/494 (26.52%), Postives = 231/494 (46.76%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI--DVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +K G  ALH +   G  + VK L+ +  ++     +G+ P++ A Q  + ++V++L+++G   +   E  F P+  A   GH  V  +L+   ++  V + A       DD++                     P+H A   GN+++  LLL    A++       T LH A ++GN ++V+LL+      KI+  T+     +H    S  E++VE+L+ +   I  K    + PLH A    +    QLL+  +VP   V+    +  + +  A + G  ++AK+L+      N        P+H A       V  +L+     I+  T     PI +A+   +V I+  L+ +  +  +TN   E  +H+A + G  EVV+ L+ +   +         P+HI++  G+ +IV+ LL+ GA  N   T   TPL+LA  +GH DV+  L+D+G ++   + K + P+H A + G  E+A LL+    S D
Sbjct:   87 TKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLD--RGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVP---VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPD 575          

HSP 2 Score: 191.43 bits (485), Expect = 8.084e-49
Identity = 117/493 (23.73%), Postives = 230/493 (46.65%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLV-NIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI----YVYFVNSFKQNN 1701
            ++ GL  LHC  ++G+   V+ L+D    I     +G  P+H A QG + + V+ L++    ++ +       +H A   GH  VA++L+ ++   N KA +   P+H AC+   + +++LLL    +I        T +H A   G+ +IV  L+        N        A+H A  S   E+V  L+    ++  K  ++  PLH +   G   I Q L+     + N      ++P+  A   G  ++A  L+ +   ++ +T+    P+H A+  G  EVA +L+ +    +        P+ +A+  +N ++  LL+    +  +       P+H+A +K  +++   L++   + N    + +  +H+A++ G V++V +LL   A+ N       TPL+LA ++   +V++VL++ G +++ Q+   + P+H  C  G  +I   L+     ++ +  N  Y +L       + + +N   QNN
Sbjct:  281 TRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASP--NTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ-GASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN-GYTALHQAAQQGHTHIINVLLQNN 769          

HSP 3 Score: 179.104 bits (453), Expect = 5.872e-45
Identity = 104/468 (22.22%), Postives = 216/468 (46.15%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            ++SKSG   LH +   GN++    L++    ++    +   P+H A + GN ++VK L++ G  ++        P+H    +GH  V  +L+ R   +  K  +   P+H A +  +++ V+LLL     ++   ++  TALH A   G++ + ++L+  K     N    +    +H AC      ++E+L+     I    +  + P+H A   G+  I   L+     + N  N    + +  A  SGQ E+ + L+ +   +    +  + P+H ++ LG  ++   L+ +       T     P+ +A+   + ++   L+ +  ++  T  +   P+HVA + G +EV  LL+    + + A    + P+H+A+     ++  +LL+ GA  +       TPL++A +K   D++  L++ G +    + +    +H A Q G  ++  LL+  + +++  N
Sbjct:  213 VESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASP--NAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHH-GASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSN 677          

HSP 4 Score: 177.948 bits (450), Expect = 1.342e-44
Identity = 115/465 (24.73%), Postives = 207/465 (44.52%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            +++ +  LH + K GN + VK L+D    I+     G  P+H   + G+  +V+ L++    +    +    P+H A    HL   ++L+   + V+    D    +H A   G+  + K+LL  K + N      FT LH AC++    ++ LL+  K    I   T+S    IH A       IV  L+      N  N      LH A  +G   + + L+      V  K  ++ +P+  +   G+ +I + L+      N +T +   P+H A+  G  +VA  L+D    +   T     P+ +A+    +E+  LL+    +  +       P+HVA      +V  LL+D   + + A      P+HIA++  +++I   LLE+GAD N +       ++LA ++GH D+  +L+    N+   +     P+H A Q     +A++LV+    +D +
Sbjct:  248 ARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL--KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQ-DGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ 709          

HSP 5 Score: 177.178 bits (448), Expect = 2.348e-44
Identity = 108/420 (25.71%), Postives = 184/420 (43.81%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK   +  ++ L+ H   I+ V   G  PIH A   G+ +IV  L+  G   N    +    +H A  +G   V R L+     V  KA DD  P+H + R G  D+V+ LL    + N A +  +T LH A ++G+ D+   L+       I   TK     +H A      E+  +L+ K    +      + PLH A    N+ +A LL+D     +   KN   ++P+  A    Q++IA  L+    D N  TR     +H A+  G  ++  +L+ R  ++         P+ +A+  + V +  +L+    ++ +       P+HV C  G +++V  L+ +   +N         +H A++ G   I+ +LL++ A  N +     T L +A   G+  V   L
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNG--YTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 6 Score: 144.05 bits (362), Expect = 3.343e-34
Identity = 101/423 (23.88%), Postives = 195/423 (46.10%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            A + G+ +     I++G  +N   +   + +H A   GH+ V   L+ R+  V+      +  +H A   G  ++VK+L+ +   +N      FT L+ A Q+ + ++VR L+       +  AT+     +  A     +++V +L+    E + K    +  LH A    +   A LL+   D N + ++   F+P+  A + G I +A LL+     ++ + R    P+H AS  G   +  +L+DR   I+ +T     P+   + + + +++ +L+     I S       P+H+A Q   +  VQLL+ ++  ++   +  +  +H+A+  G  ++ K+LL+  A  N       TPL++A +K    V ++L+ +G +I+  +     PIH A   G   I   L+    S +T N
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSL--ATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQN-DTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTN 446          

HSP 7 Score: 101.293 bits (251), Expect = 4.445e-21
Identity = 62/231 (26.84%), Postives = 114/231 (49.35%), Query Frame = 1
Query:  934 KNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            K ++  +  L A  +G +E A   I N  D+N   +     +H AS  G  EV   L+ R+ +++  T      + IAS     E++++L+TN  N+ + +     P+++A Q+  +EVV+ L+DN  + + A +    P+ +A + G  ++V +LLE     N      R P L++A  K     + +L+ N  N + +S   + P+H A   G   +A LL++   ++D
Sbjct:   20 KKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD 245          

HSP 8 Score: 54.6842 bits (130), Expect = 7.413e-7
Identity = 24/92 (26.09%), Postives = 45/92 (48.91%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI 507
            L +KSGL  LH + +   ++  + L++    ++     GY P+H  C  GN  IV +L++    +N   +  +  +H A   GH  +  +L+
Sbjct:  675 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          

HSP 9 Score: 51.6026 bits (122), Expect = 7.017e-6
Identity = 27/99 (27.27%), Postives = 50/99 (50.51%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRH 2653
            P+H+A   GN+N+  LL++  + ++   R++  P+H A + GN +++K L+     I  K     TPL      G++  V  L   LD +  I  + ++
Sbjct:  221 PLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEML---LDRSAPILSKTKN 316          

HSP 10 Score: 51.2174 bits (121), Expect = 8.740e-6
Identity = 28/102 (27.45%), Postives = 49/102 (48.04%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDI 2662
            P+H+A   GN N+VKLL+D G+ ++   R    P+H    +G+  +++ L+  +  I  K     +PL +     + +CV  L +         H V  DD+
Sbjct:  254 PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ---------HNVPVDDV 346          
BLAST of SMED30013077 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 199.519 bits (506), Expect = 2.594e-51
Identity = 131/494 (26.52%), Postives = 231/494 (46.76%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI--DVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +K G  ALH +   G  + VK L+ +  ++     +G+ P++ A Q  + ++V++L+++G   +   E  F P+  A   GH  V  +L+   ++  V + A       DD++                     P+H A   GN+++  LLL    A++       T LH A ++GN ++V+LL+      KI+  T+     +H    S  E++VE+L+ +   I  K    + PLH A    +    QLL+  +VP   V+    +  + +  A + G  ++AK+L+      N        P+H A       V  +L+     I+  T     PI +A+   +V I+  L+ +  +  +TN   E  +H+A + G  EVV+ L+ +   +         P+HI++  G+ +IV+ LL+ GA  N   T   TPL+LA  +GH DV+  L+D+G ++   + K + P+H A + G  E+A LL+    S D
Sbjct:   87 TKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLD--RGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVP---VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPD 575          

HSP 2 Score: 190.66 bits (483), Expect = 1.272e-48
Identity = 117/493 (23.73%), Postives = 230/493 (46.65%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLV-NIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI----YVYFVNSFKQNN 1701
            ++ GL  LHC  ++G+   V+ L+D    I     +G  P+H A QG + + V+ L++    ++ +       +H A   GH  VA++L+ ++   N KA +   P+H AC+   + +++LLL    +I        T +H A   G+ +IV  L+        N        A+H A  S   E+V  L+    ++  K  ++  PLH +   G   I Q L+     + N      ++P+  A   G  ++A  L+ +   ++ +T+    P+H A+  G  EVA +L+ +    +        P+ +A+  +N ++  LL+    +  +       P+H+A +K  +++   L++   + N    + +  +H+A++ G V++V +LL   A+ N       TPL+LA ++   +V++VL++ G +++ Q+   + P+H  C  G  +I   L+     ++ +  N  Y +L       + + +N   QNN
Sbjct:  281 TRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASP--NTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ-GASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN-GYTALHQAAQQGHTHIINVLLQNN 769          

HSP 3 Score: 178.718 bits (452), Expect = 8.432e-45
Identity = 104/468 (22.22%), Postives = 216/468 (46.15%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            ++SKSG   LH +   GN++    L++    ++    +   P+H A + GN ++VK L++ G  ++        P+H    +GH  V  +L+ R   +  K  +   P+H A +  +++ V+LLL     ++   ++  TALH A   G++ + ++L+  K     N    +    +H AC      ++E+L+     I    +  + P+H A   G+  I   L+     + N  N    + +  A  SGQ E+ + L+ +   +    +  + P+H ++ LG  ++   L+ +       T     P+ +A+   + ++   L+ +  ++  T  +   P+HVA + G +EV  LL+    + + A    + P+H+A+     ++  +LL+ GA  +       TPL++A +K   D++  L++ G +    + +    +H A Q G  ++  LL+  + +++  N
Sbjct:  213 VESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASP--NAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHH-GASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSN 677          

HSP 4 Score: 177.178 bits (448), Expect = 2.409e-44
Identity = 115/465 (24.73%), Postives = 207/465 (44.52%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            +++ +  LH + K GN + VK L+D    I+     G  P+H   + G+  +V+ L++    +    +    P+H A    HL   ++L+   + V+    D    +H A   G+  + K+LL  K + N      FT LH AC++    ++ LL+  K    I   T+S    IH A       IV  L+      N  N      LH A  +G   + + L+      V  K  ++ +P+  +   G+ +I + L+      N +T +   P+H A+  G  +VA  L+D    +   T     P+ +A+    +E+  LL+    +  +       P+HVA      +V  LL+D   + + A      P+HIA++  +++I   LLE+GAD N +       ++LA ++GH D+  +L+    N+   +     P+H A Q     +A++LV+    +D +
Sbjct:  248 ARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL--KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQ-DGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ 709          

HSP 5 Score: 176.407 bits (446), Expect = 3.735e-44
Identity = 108/420 (25.71%), Postives = 184/420 (43.81%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK   +  ++ L+ H   I+ V   G  PIH A   G+ +IV  L+  G   N    +    +H A  +G   V R L+     V  KA DD  P+H + R G  D+V+ LL    + N A +  +T LH A ++G+ D+   L+       I   TK     +H A      E+  +L+ K    +      + PLH A    N+ +A LL+D     +   KN   ++P+  A    Q++IA  L+    D N  TR     +H A+  G  ++  +L+ R  ++         P+ +A+  + V +  +L+    ++ +       P+HV C  G +++V  L+ +   +N         +H A++ G   I+ +LL++ A  N +     T L +A   G+  V   L
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNG--YTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 6 Score: 143.665 bits (361), Expect = 4.822e-34
Identity = 101/423 (23.88%), Postives = 195/423 (46.10%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            A + G+ +     I++G  +N   +   + +H A   GH+ V   L+ R+  V+      +  +H A   G  ++VK+L+ +   +N      FT L+ A Q+ + ++VR L+       +  AT+     +  A     +++V +L+    E + K    +  LH A    +   A LL+   D N + ++   F+P+  A + G I +A LL+     ++ + R    P+H AS  G   +  +L+DR   I+ +T     P+   + + + +++ +L+     I S       P+H+A Q   +  VQLL+ ++  ++   +  +  +H+A+  G  ++ K+LL+  A  N       TPL++A +K    V ++L+ +G +I+  +     PIH A   G   I   L+    S +T N
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSL--ATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQN-DTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTN 446          

HSP 7 Score: 100.908 bits (250), Expect = 5.868e-21
Identity = 62/231 (26.84%), Postives = 114/231 (49.35%), Query Frame = 1
Query:  934 KNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            K ++  +  L A  +G +E A   I N  D+N   +     +H AS  G  EV   L+ R+ +++  T      + IAS     E++++L+TN  N+ + +     P+++A Q+  +EVV+ L+DN  + + A +    P+ +A + G  ++V +LLE     N      R P L++A  K     + +L+ N  N + +S   + P+H A   G   +A LL++   ++D
Sbjct:   20 KKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD 245          

HSP 8 Score: 55.0694 bits (131), Expect = 7.274e-7
Identity = 24/92 (26.09%), Postives = 45/92 (48.91%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI 507
            L +KSGL  LH + +   ++  + L++    ++     GY P+H  C  GN  IV +L++    +N   +  +  +H A   GH  +  +L+
Sbjct:  675 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          

HSP 9 Score: 51.6026 bits (122), Expect = 6.940e-6
Identity = 27/99 (27.27%), Postives = 50/99 (50.51%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRH 2653
            P+H+A   GN+N+  LL++  + ++   R++  P+H A + GN +++K L+     I  K     TPL      G++  V  L   LD +  I  + ++
Sbjct:  221 PLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEML---LDRSAPILSKTKN 316          

HSP 10 Score: 51.2174 bits (121), Expect = 8.499e-6
Identity = 28/102 (27.45%), Postives = 49/102 (48.04%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDI 2662
            P+H+A   GN N+VKLL+D G+ ++   R    P+H    +G+  +++ L+  +  I  K     +PL +     + +CV  L +         H V  DD+
Sbjct:  254 PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ---------HNVPVDDV 346          
BLAST of SMED30013077 vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 198.364 bits (503), Expect = 2.697e-51
Identity = 134/511 (26.22%), Postives = 228/511 (44.62%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI--------------------------------------SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLV--SGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGN----KAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +K G  ALH +   G  + VK L+    +I     +G+ P++ A Q  + D+VKYL+E+G   +   E  F P+  A   GH     IL+                                      S+ +VN        P+H A   GNV++  LLL    A++       T LH A ++GN ++V+LL+   G++  K  D        +H A  S  +++VE+L+ +K  +  +    + PLH A    +    K + Q    V D  ++       + +  A + G   + KLL+    + N        P+H A      +V  +L+     I+  T     PI +A+   ++ I+ LL+ N  +   TN   E  +H+A + G VEVV+ L+ N   ++    +   P+HIAS  G+ EIV++LL+H A  +   T   TPL+++  +G  DV+ VL++ G      + K + P+H A + G  ++A+LL+    + D+   N
Sbjct:   73 TKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTP----LHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDY-----LTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKN 574          

HSP 2 Score: 184.496 bits (467), Expect = 5.617e-47
Identity = 120/522 (22.99%), Postives = 233/522 (44.64%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECET---------------------ILKR------------RPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI---YVYFVNSFK 1692
            ++ GL  LHC+ ++G+   V+ L++ K  +     +G  P+H A QG + + VK+L++    ++ +       +H A   GH  V ++L+ ++   N +A +   P+H AC+   + +++LL+    +I        T +H A   G+ +IV LL+       + +       A+H A  +   E+V  L+     ++ +  EE  PLH A   G   I QLL+     + +      ++P+  +   GQ+++A +L+      + +T+    P+H A+  G  +VA +L+ R+   +                        +L++             P+ IA+  N ++I   L+       +   +   P+H+A Q+G  ++V LL+D   NI+ +    +  +H+A++  +V +  IL +HGAD +       TPL +A   G+  +   L+  G N+  ++   + P+H A Q G   I  +L+      +    N N    I     Y+  V++ K
Sbjct:  275 TRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNI--RGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQ-HMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 793          

HSP 3 Score: 144.436 bits (363), Expect = 1.984e-34
Identity = 97/390 (24.87%), Postives = 178/390 (45.64%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITN-------------------------------NCD------INCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            A R GN+D V   L     IN  +     ALH A ++G+  +V+ L+       ++ ATK  N A+H A ++   E+V++L+ +   IN ++     PL+ A    +  + + L++    N +    + F+P+  AL  G  +   +L+ N                               N D      +N +T +   P+H A+  G   VA +L++R   ++        P+ +AS   N  +++LL+     I +   +   P+H A + G  +VV+LL++    +       + P+H+A++   VE VK LL++ A  + +     T L++A   GHY V+K+L+D   N   +++  + P+H AC+    ++ +LLV    SI
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLG--RGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLE-NGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASI 403          

HSP 4 Score: 144.05 bits (362), Expect = 2.501e-34
Identity = 115/493 (23.33%), Postives = 206/493 (41.78%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVR-LLVSGKVQCK------------------------INDATKSANR--AIHFACMSESEEIVEIL--------IGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVE---------------------------------ILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            A + GN D V   ++ G  +N   +   + +H A   GH+ + + L+ R   V+      +  +H A   G  ++VK+L+     IN      FT L+ A Q+ + D+V+ LL +G  Q                          + + TK   R  A+H A   +  +   +L        +  K  +N   +    PLH A   GN  +A LL++     V+       +P+  A   G   + KLL+     I+  TR    P+H A+  G  +V  +L++R+  +   T     P+ +A+  ++VE                                 + +LL+    N  +       P+H+AC+K  ++V++LL+    +I    +  + PIH+A+  G + IV +LL++GA  +       T L++A   G  +V + L+ NG  ++ ++ ++  P+H A + G  EI QLL+      D    N
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNR-GAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTN 508          

HSP 5 Score: 89.7373 bits (221), Expect = 1.361e-17
Identity = 57/226 (25.22%), Postives = 98/226 (43.36%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI 906
            L +K G   LH + K G+LD  K L+  +   +    +G  P+H A    N  +   L+E G   +   +  + P+H A     + +A  L++     N        P+H A + G+ D+V LLL     I+++     T+LH A Q+   ++  +L   K     +  TK     +  AC   + ++V  L+ +   +N K      PLH A   G+  I  +L+
Sbjct:  537 LATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILT--KHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL 760          

HSP 6 Score: 80.1073 bits (196), Expect = 1.310e-14
Identity = 57/261 (21.84%), Postives = 108/261 (41.38%), Query Frame = 1
Query:  958 ILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLE-------------------------------HGADTNCICTYAR------TPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
             L A  +G ++     +    DIN   +     +H A+  G   +   L+ R   ++  T      + IAS     E++++L+    NI + +     P+++A Q+  ++VV+ L++N  N + A +    P+ +A + G  + V ILLE                               H AD        R      TPL++A   G+ +V+ +L++ G  ++  +     P+H A + G   + +LL+D    ID +
Sbjct:   14 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAK 274          

HSP 7 Score: 53.5286 bits (127), Expect = 1.541e-6
Identity = 26/83 (31.33%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+A   GN+N+  LL++ G+ ++   R+   P+H A + GN +++K L+     I  K     TPL      G+D  V  L
Sbjct:  215 PLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL 297          
BLAST of SMED30013077 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 199.134 bits (505), Expect = 3.127e-51
Identity = 131/494 (26.52%), Postives = 231/494 (46.76%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI--DVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +K G  ALH +   G  + VK L+ +  ++     +G+ P++ A Q  + ++V++L+++G   +   E  F P+  A   GH  V  +L+   ++  V + A       DD++                     P+H A   GN+++  LLL    A++       T LH A ++GN ++V+LL+      KI+  T+     +H    S  E++VE+L+ +   I  K    + PLH A    +    QLL+  +VP   V+    +  + +  A + G  ++AK+L+      N        P+H A       V  +L+     I+  T     PI +A+   +V I+  L+ +  +  +TN   E  +H+A + G  EVV+ L+ +   +         P+HI++  G+ +IV+ LL+ GA  N   T   TPL+LA  +GH DV+  L+D+G ++   + K + P+H A + G  E+A LL+    S D
Sbjct:   87 TKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLD--RGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVP---VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPD 575          

HSP 2 Score: 190.66 bits (483), Expect = 1.502e-48
Identity = 117/493 (23.73%), Postives = 230/493 (46.65%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLV-NIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI----YVYFVNSFKQNN 1701
            ++ GL  LHC  ++G+   V+ L+D    I     +G  P+H A QG + + V+ L++    ++ +       +H A   GH  VA++L+ ++   N KA +   P+H AC+   + +++LLL    +I        T +H A   G+ +IV  L+        N        A+H A  S   E+V  L+    ++  K  ++  PLH +   G   I Q L+     + N      ++P+  A   G  ++A  L+ +   ++ +T+    P+H A+  G  EVA +L+ +    +        P+ +A+  +N ++  LL+    +  +       P+H+A +K  +++   L++   + N    + +  +H+A++ G V++V +LL   A+ N       TPL+LA ++   +V++VL++ G +++ Q+   + P+H  C  G  +I   L+     ++ +  N  Y +L       + + +N   QNN
Sbjct:  281 TRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASP--NTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ-GASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN-GYTALHQAAQQGHTHIINVLLQNN 769          

HSP 3 Score: 178.333 bits (451), Expect = 1.099e-44
Identity = 104/468 (22.22%), Postives = 216/468 (46.15%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            ++SKSG   LH +   GN++    L++    ++    +   P+H A + GN ++VK L++ G  ++        P+H    +GH  V  +L+ R   +  K  +   P+H A +  +++ V+LLL     ++   ++  TALH A   G++ + ++L+  K     N    +    +H AC      ++E+L+     I    +  + P+H A   G+  I   L+     + N  N    + +  A  SGQ E+ + L+ +   +    +  + P+H ++ LG  ++   L+ +       T     P+ +A+   + ++   L+ +  ++  T  +   P+HVA + G +EV  LL+    + + A    + P+H+A+     ++  +LL+ GA  +       TPL++A +K   D++  L++ G +    + +    +H A Q G  ++  LL+  + +++  N
Sbjct:  213 VESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASP--NAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHH-GASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSN 677          

HSP 4 Score: 177.178 bits (448), Expect = 2.487e-44
Identity = 115/466 (24.68%), Postives = 207/466 (44.42%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            +++ +  LH + K GN + VK L+D    I+     G  P+H   + G+  +V+ L++    +    +    P+H A    HL   ++L+   + V+    D    +H A   G+  + K+LL  K + N      FT LH AC++    ++ LL+  K    I   T+S    IH A       IV  L+      N  N      LH A  +G   + + L+      V  K  ++ +P+  +   G+ +I + L+      N +T +   P+H A+  G  +VA  L+D    +   T     P+ +A+    +E+  LL+    +  +       P+HVA      +V  LL+D   + + A      P+HIA++  +++I   LLE+GAD N +       ++LA ++GH D+  +L+    N+   +     P+H A Q     +A++LV+    +D + 
Sbjct:  248 ARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL--KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQ-DGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQT 710          

HSP 5 Score: 176.407 bits (446), Expect = 3.990e-44
Identity = 108/420 (25.71%), Postives = 184/420 (43.81%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK   +  ++ L+ H   I+ V   G  PIH A   G+ +IV  L+  G   N    +    +H A  +G   V R L+     V  KA DD  P+H + R G  D+V+ LL    + N A +  +T LH A ++G+ D+   L+       I   TK     +H A      E+  +L+ K    +      + PLH A    N+ +A LL+D     +   KN   ++P+  A    Q++IA  L+    D N  TR     +H A+  G  ++  +L+ R  ++         P+ +A+  + V +  +L+    ++ +       P+HV C  G +++V  L+ +   +N         +H A++ G   I+ +LL++ A  N +     T L +A   G+  V   L
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNG--YTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 6 Score: 143.665 bits (361), Expect = 6.032e-34
Identity = 101/423 (23.88%), Postives = 195/423 (46.10%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            A + G+ +     I++G  +N   +   + +H A   GH+ V   L+ R+  V+      +  +H A   G  ++VK+L+ +   +N      FT L+ A Q+ + ++VR L+       +  AT+     +  A     +++V +L+    E + K    +  LH A    +   A LL+   D N + ++   F+P+  A + G I +A LL+     ++ + R    P+H AS  G   +  +L+DR   I+ +T     P+   + + + +++ +L+     I S       P+H+A Q   +  VQLL+ ++  ++   +  +  +H+A+  G  ++ K+LL+  A  N       TPL++A +K    V ++L+ +G +I+  +     PIH A   G   I   L+    S +T N
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSL--ATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQN-DTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTN 446          

HSP 7 Score: 100.908 bits (250), Expect = 6.418e-21
Identity = 61/222 (27.48%), Postives = 110/222 (49.55%), Query Frame = 1
Query:  961 LYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            L A  +G +E A   I N  D+N   +     +H AS  G  EV   L+ R+ +++  T      + IAS     E++++L+TN  N+ + +     P+++A Q+  +EVV+ L+DN  + + A +    P+ +A + G  ++V +LLE     N      R P L++A  K     + +L+ N  N + +S   + P+H A   G   +A LL++   ++D
Sbjct:   29 LRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD 245          

HSP 8 Score: 54.6842 bits (130), Expect = 8.335e-7
Identity = 24/92 (26.09%), Postives = 45/92 (48.91%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI 507
            L +KSGL  LH + +   ++  + L++    ++     GY P+H  C  GN  IV +L++    +N   +  +  +H A   GH  +  +L+
Sbjct:  675 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          

HSP 9 Score: 51.6026 bits (122), Expect = 7.000e-6
Identity = 27/99 (27.27%), Postives = 50/99 (50.51%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRH 2653
            P+H+A   GN+N+  LL++  + ++   R++  P+H A + GN +++K L+     I  K     TPL      G++  V  L   LD +  I  + ++
Sbjct:  221 PLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEML---LDRSAPILSKTKN 316          

HSP 10 Score: 51.2174 bits (121), Expect = 8.573e-6
Identity = 28/102 (27.45%), Postives = 49/102 (48.04%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDI 2662
            P+H+A   GN N+VKLL+D G+ ++   R    P+H    +G+  +++ L+  +  I  K     +PL +     + +CV  L +         H V  DD+
Sbjct:  254 PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ---------HNVPVDDV 346          
BLAST of SMED30013077 vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 199.904 bits (507), Expect = 1.204e-50
Identity = 118/460 (25.65%), Postives = 218/460 (47.39%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHC 1614
            SK+G   LH +    NL+  + L++    +     +G  P+H A + GN  +V+ L++ G  +    +    P+H A  NGH+ ++ IL+     +  K  +   PIH A +  ++D V+LLL     I+    +  T LH A   G+H + ++L+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  N +  +P+  A  +G  E+AK L+ N   +N   +  + P+H A+ +G T +  +L++   +    T     P+ IA+   +VE +  L+    +      +   P+HVA + G V V +LL++   + N A    + P+H+A  +  ++IVK+LL  G   +       TPL++A ++   +V++ L+  G +   +S++   P+H A Q G  E+  LL+    
Sbjct:  203 SKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKG--AKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQA 659          

HSP 2 Score: 198.749 bits (504), Expect = 2.994e-50
Identity = 126/495 (25.45%), Postives = 230/495 (46.46%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQC----------------------DIECETILKR------------RPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            +K  L  LHC+ +NG++   + L+DH   I+    +G  PIH A QG + D V+ L++    ++ +      P+H A   GH  VA++L+ +    N +A +   P+H AC+  +V +++LLL +  +I+       T LH A   G+  IV+ L+       +++        +H A  +   E+ + L+  K ++N K  ++  PLH A   G+  + +LL++  + N N       +P+  A   G +E    L+       C T+    P+H A+  G   VA +L++R                        DI  + +L R             P+ IA+  N VE+ R L+    +  + + +   P+H+A Q+G  E+V LL+    N N  N   + P+H+ ++ G V +  +L++HG   +       TPL++A+  G+  + K L+ +  ++  ++   + P+H A Q G  +I  LL+ +  S
Sbjct:  269 TKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNV--KVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLEN-NANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDI-VKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGAS 759          

HSP 3 Score: 195.282 bits (495), Expect = 3.897e-49
Identity = 119/454 (26.21%), Postives = 213/454 (46.92%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR----QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            L  LH +   G+    K L+D          +G+ P+H AC+  +  +++ L+++G  ++ + E    P+H A   GHL + + L+ R     + N+K      P+H A R G+ ++ K LL +K  +N    +  T LH A + G+ ++V+LL+        N AT + +  +H A      E V  L+ K+    C   +   PLH A   G   +A+LL++  D + N       +P+  A++   ++I KLL+      +        P+H A+     EVA  L+        E++    P+ +A+   + E++ LL++   N    N     P+H+  Q+G V V  +LI +   ++        P+H+AS  G +++VK LL+H AD N       +PL+ A ++GH D+  +L+ NG +    S     P+  A + G+  +  +L
Sbjct:  339 LTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKV---ETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENN--ANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLER-DAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 4 Score: 190.66 bits (483), Expect = 1.110e-47
Identity = 117/466 (25.11%), Postives = 217/466 (46.57%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
             K  L ALH + +N +      L+ +  + + +   G+ P+H A    N ++ + L+  G  +NF  +    P+H A   G++ + R+L+ R   +  K  D+  P+H A R G+V + ++LL     I        + +H A Q  + D VRLL+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++       +P+  A   G + I K L+      N S    E P+H A+  G TEVA  L+  +  +  +    + P+  A+   +  +++LL+ N+ N          P+H+A ++G VE V  L++   +  C   K   P+H+A++ G+V + ++LLE  A  N       TPL++A    + D+ K+L+  G +    +   + P+H A +    E+A+ L+    S + E+
Sbjct:  170 GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLL--QYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKT-GASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAES 632          

HSP 5 Score: 177.948 bits (450), Expect = 9.571e-44
Identity = 129/524 (24.62%), Postives = 229/524 (43.70%), Query Frame = 1
Query:  136 SKRLDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRP-----------------------------IHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            S  LD+ + HLR  ++I                 +++GLN LH + K G++  V  L+  +  +E     G   +H A   G  ++V+ L+  G  +N   +K F P++ A    HL V + L+      N+   D   P                             +H A R  +     +LL +    +V     FT LH A    N ++ +LL++      +N   ++    +H A    +  +V +L+ +  +I  K  +E+ PLH A  NG+  I+++L+D     +  K     SPI  A     ++  +LL+  + +I+  T     P+H A+  G   VA +L+D+        +    P+ IA   N+V ++ LL+    +I +  +    P+HVA   G + +V+ L+    + N +N K+  P+H+A+  G  E+ K LL++ A  N      +TPL+ A   GH ++ K+L++N  N    +     P+H A + G  E    L++   S
Sbjct:   22 SGNLDKALDHLRNGVDINTC--------------NQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRG--ASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDH-GAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS 528          

HSP 6 Score: 145.591 bits (366), Expect = 9.185e-34
Identity = 96/397 (24.18%), Postives = 183/397 (46.10%), Query Frame = 1
Query:  520 VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQ-----------------------------IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            V  +  D +     A R+GN+D     L +   IN  +      LH A ++G+  +V  L+  ++   +   TK  N A+H A ++  +E+V  L+     +N ++ +   PL+ A    +  + + L++    N N    + F+P+  AL  G                                 A +L+ N+ + +  ++T   P+H A+      VA +L++R   +         P+ IAS   NV ++RLL+     I++   +   P+H A + G V + ++L+D+   I       + PIH+A++   ++ V++LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     + +LL+ +  SID
Sbjct:    5 VGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEI--ILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASID 398          

HSP 7 Score: 108.612 bits (270), Expect = 1.973e-22
Identity = 72/292 (24.66%), Postives = 129/292 (44.18%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHML 1104
            L + +G   LH + + G+++ V  L++ +    C+   G+ P+H A + G   + + L+E     N   +    P+H A  + +L + ++L+ R    +  A +   P+H A +   V++ + LL    + N    +  T LH A Q+G+ ++V LL+S   Q   N   KS    +H         + ++LI     ++        PLH A   GN  + + L+     +VN K    +SP+  A   G  +I  LL+ N    N  +     P+  A  LG+  V  +L
Sbjct:  498 LATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSK--QANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQH-QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 8 Score: 81.6481 bits (200), Expect = 3.935e-14
Identity = 58/268 (21.64%), Postives = 118/268 (44.03%), Query Frame = 1
Query:  922 NVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKP-----------------------------IHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +V  + A+  +  L A  SG ++ A   + N  DIN   +     +H AS  G  ++   L+ ++  +E  T      + IA+     E++R L+    N+ + + +   P+++A Q+  +EVV+ L++N  N N A +    P                             +HIA+ N       +LL++  + + +     TPL++A    + +V+++L++ G ++         P+H A + G   + +LL+D    I+T+  +
Sbjct:    4 SVGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKD 271          

HSP 9 Score: 66.2402 bits (160), Expect = 2.011e-9
Identity = 38/143 (26.57%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLV-NIKAPDDSRPIHYACRTGNV---DLVKLLLASKCAINVADSEKFT 648
            L +KSGL  LH   + G++     LI H   ++     GY P+H A   GN  +VK+L++    +N   +  + P+H A   GH  +  +L+      N  + D + P+  A R G +   D++K++      + V+D  + +
Sbjct:  663 LGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMS 805          

HSP 10 Score: 54.6842 bits (130), Expect = 6.006e-6
Identity = 34/139 (24.46%), Postives = 63/139 (45.32%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIIN 2773
            P+H+A   GN+ +VK L+ H +++    +    P+H A + G+ D++  L+ N  + +  +   +TPL + K  GY      L  V D    +    +H   + F E  D   +  +  D G  ++      R SR ++
Sbjct:  704 PLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHR--MSFPETVD--EILDVSEDEGEELISFKAERRDSRDVD 838          
BLAST of SMED30013077 vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 2.320e-50
Identity = 131/494 (26.52%), Postives = 231/494 (46.76%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI--DVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +K G  ALH +   G  + VK L+ +  ++     +G+ P++ A Q  + ++V++L+++G   +   E  F P+  A   GH  V  +L+   ++  V + A       DD++                     P+H A   GN+++  LLL    A++       T LH A ++GN ++V+LL+      KI+  T+     +H    S  E++VE+L+ +   I  K    + PLH A    +    QLL+  +VP   V+    +  + +  A + G  ++AK+L+      N        P+H A       V  +L+     I+  T     PI +A+   +V I+  L+ +  +  +TN   E  +H+A + G  EVV+ L+ +   +         P+HI++  G+ +IV+ LL+ GA  N   T   TPL+LA  +GH DV+  L+D+G ++   + K + P+H A + G  E+A LL+    S D
Sbjct:   87 TKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLD--RGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVP---VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPD 575          

HSP 2 Score: 190.66 bits (483), Expect = 1.114e-47
Identity = 117/493 (23.73%), Postives = 230/493 (46.65%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLV-NIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI----YVYFVNSFKQNN 1701
            ++ GL  LHC  ++G+   V+ L+D    I     +G  P+H A QG + + V+ L++    ++ +       +H A   GH  VA++L+ ++   N KA +   P+H AC+   + +++LLL    +I        T +H A   G+ +IV  L+        N        A+H A  S   E+V  L+    ++  K  ++  PLH +   G   I Q L+     + N      ++P+  A   G  ++A  L+ +   ++ +T+    P+H A+  G  EVA +L+ +    +        P+ +A+  +N ++  LL+    +  +       P+H+A +K  +++   L++   + N    + +  +H+A++ G V++V +LL   A+ N       TPL+LA ++   +V++VL++ G +++ Q+   + P+H  C  G  +I   L+     ++ +  N  Y +L       + + +N   QNN
Sbjct:  281 TRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASP--NTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQ-GASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN-GYTALHQAAQQGHTHIINVLLQNN 769          

HSP 3 Score: 178.333 bits (451), Expect = 7.797e-44
Identity = 104/468 (22.22%), Postives = 216/468 (46.15%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            ++SKSG   LH +   GN++    L++    ++    +   P+H A + GN ++VK L++ G  ++        P+H    +GH  V  +L+ R   +  K  +   P+H A +  +++ V+LLL     ++   ++  TALH A   G++ + ++L+  K     N    +    +H AC      ++E+L+     I    +  + P+H A   G+  I   L+     + N  N    + +  A  SGQ E+ + L+ +   +    +  + P+H ++ LG  ++   L+ +       T     P+ +A+   + ++   L+ +  ++  T  +   P+HVA + G +EV  LL+    + + A    + P+H+A+     ++  +LL+ GA  +       TPL++A +K   D++  L++ G +    + +    +H A Q G  ++  LL+  + +++  N
Sbjct:  213 VESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASP--NAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHH-GASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSN 677          

HSP 4 Score: 177.178 bits (448), Expect = 1.907e-43
Identity = 115/466 (24.68%), Postives = 207/466 (44.42%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            +++ +  LH + K GN + VK L+D    I+     G  P+H   + G+  +V+ L++    +    +    P+H A    HL   ++L+   + V+    D    +H A   G+  + K+LL  K + N      FT LH AC++    ++ LL+  K    I   T+S    IH A       IV  L+      N  N      LH A  +G   + + L+      V  K  ++ +P+  +   G+ +I + L+      N +T +   P+H A+  G  +VA  L+D    +   T     P+ +A+    +E+  LL+    +  +       P+HVA      +V  LL+D   + + A      P+HIA++  +++I   LLE+GAD N +       ++LA ++GH D+  +L+    N+   +     P+H A Q     +A++LV+    +D + 
Sbjct:  248 ARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL--KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQ-DGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQT 710          

HSP 5 Score: 176.407 bits (446), Expect = 2.807e-43
Identity = 108/420 (25.71%), Postives = 184/420 (43.81%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK   +  ++ L+ H   I+ V   G  PIH A   G+ +IV  L+  G   N    +    +H A  +G   V R L+     V  KA DD  P+H + R G  D+V+ LL    + N A +  +T LH A ++G+ D+   L+       I   TK     +H A      E+  +L+ K    +      + PLH A    N+ +A LL+D     +   KN   ++P+  A    Q++IA  L+    D N  TR     +H A+  G  ++  +L+ R  ++         P+ +A+  + V +  +L+    ++ +       P+HV C  G +++V  L+ +   +N         +H A++ G   I+ +LL++ A  N +     T L +A   G+  V   L
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNG--YTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 6 Score: 143.28 bits (360), Expect = 4.384e-33
Identity = 101/423 (23.88%), Postives = 195/423 (46.10%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            A + G+ +     I++G  +N   +   + +H A   GH+ V   L+ R+  V+      +  +H A   G  ++VK+L+ +   +N      FT L+ A Q+ + ++VR L+       +  AT+     +  A     +++V +L+    E + K    +  LH A    +   A LL+   D N + ++   F+P+  A + G I +A LL+     ++ + R    P+H AS  G   +  +L+DR   I+ +T     P+   + + + +++ +L+     I S       P+H+A Q   +  VQLL+ ++  ++   +  +  +H+A+  G  ++ K+LL+  A  N       TPL++A +K    V ++L+ +G +I+  +     PIH A   G   I   L+    S +T N
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSL--ATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQN-DTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTN 446          

HSP 7 Score: 100.908 bits (250), Expect = 4.736e-20
Identity = 61/222 (27.48%), Postives = 110/222 (49.55%), Query Frame = 1
Query:  961 LYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            L A  +G +E A   I N  D+N   +     +H AS  G  EV   L+ R+ +++  T      + IAS     E++++L+TN  N+ + +     P+++A Q+  +EVV+ L+DN  + + A +    P+ +A + G  ++V +LLE     N      R P L++A  K     + +L+ N  N + +S   + P+H A   G   +A LL++   ++D
Sbjct:   29 LRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD 245          

HSP 8 Score: 54.6842 bits (130), Expect = 5.548e-6
Identity = 24/92 (26.09%), Postives = 45/92 (48.91%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI 507
            L +KSGL  LH + +   ++  + L++    ++     GY P+H  C  GN  IV +L++    +N   +  +  +H A   GH  +  +L+
Sbjct:  675 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          
BLAST of SMED30013077 vs. UniProt/SwissProt
Match: sp|Q4UMH6|Y381_RICFE (Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0381 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 8.141e-50
Identity = 131/467 (28.05%), Postives = 224/467 (47.97%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEND 1635
            + +G   LH + K+GNL  VK+LI+++ +I     +G   +HYA    N D+V  LI  G  +N   +     +HYA  +G+L +  +LIS    VN K       ++ A   G+ DLV LL+A    +N       T LHYA + GN D+V LL+             +A   +HFA  S +  +V  LI  K +I+ K +     LH+A  +GN  +   LI     +++ K     + + +A  SG + +   LI N  DI+  T + E  +HFA+  G   + + LI  + DI  +T      +  A+ + N+ ++ LLI N  +I +  D+    +H A + G + +V LLI    ++N   +     +H A + G +++V +L+  GAD N       T L+ A E  +  +  +L+  G ++  ++     P+H A      ++  LL+ +   I+T+N+
Sbjct:  668 TDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVN------NAKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIK-NKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNN 1127          

HSP 2 Score: 194.512 bits (493), Expect = 4.128e-49
Identity = 127/464 (27.37%), Postives = 227/464 (48.92%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEND 1635
            G+ +LHC+ KNGNLD  K L  +  D+     +G   +HYA + GN  +VK+LIE+   ++   +     +HYA    +  +  +LI+    VN K  +    +HYA   GN+DLV LL++    +N   +   T L+ A   G+ D+V LL++      +N  T +    +H+A  S + ++V +LI     +N  N + +  LH+A  +GN  +   LI     +++ K     + + +A  SG + +   LI N  DI+  T + E  +HFA+  G   + + LI  + DI  +T      +  A+ + N+ ++  LI N  +I +  +  E  +H A + G + +V LLI N  +IN   D  +  +H A E+G + +V +L+  G D N       T L+ A + G  D+  +L+  G ++  ++      +H A ++    +  LL+     ++ +N+
Sbjct:  638 GVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIA--YGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVN--NAKTI--LHFAAKSGNLNLVNWLIK-NKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNN 1094          

HSP 3 Score: 194.126 bits (492), Expect = 4.959e-49
Identity = 132/451 (29.27%), Postives = 214/451 (47.45%), Query Frame = 1
Query:  295 VKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRP--IHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPIL-YALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            V  LI H  +    + HG   +H A + GN D+ K L ++G  +N   +     +HYA  +G+L + + LI  Q  NI A  D+    +HYA    N DLV LL+A    +N       TALHYA   GN D+V LL+S      +N  T S    ++ A    S ++V +LI    ++N K D     LHYA  +GN  +  LLI       N  N      IL +A  SG + +   LI N  DI+  T + E  +HFA+  G   + + LI  + DI  +T      +  A+ + N+ ++  LI N  +I +  +  E  +H A + G + +V  LI N  +I+   +     +H A+E+G + +V +L+ +G D N       T L+ A E G+ ++  +LI  G ++  ++      +H A   G  ++  LL+     ++ + D+
Sbjct:  621 VPLLITHGANPNATNCHGVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQ-ANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHG--ADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIH------NGANVNNAKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDD 1062          

HSP 4 Score: 172.17 bits (435), Expect = 3.371e-42
Identity = 121/431 (28.07%), Postives = 203/431 (47.10%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDI------------ECVDF---------------------HGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNC 1428
            + +GL ALH +  +GNLD V  LI H  D+              VD+                     +G   +HYA + GN D+V  LI +G  +N     A   +H+A  +G+L +   LI  +  ++ K       +H+A  +GN++LV  L+ +K  I+   +   T LH+A + GN ++V  L+  K    I+  T S    +HFA  S +  +V  LI  K +I+ K +     LH+A  +GN  +  LLI     ++N K  +  + + YA+ SG + +  LLI    D+N  T + E  +HFA  LG  ++  +L+ R  D+  +T      +  A  ++N+ ++ LL+    ++ + N+  E P+H A     +++V LLI N  +IN  N+     ++   E     I+K  +  GAD N 
Sbjct:  734 TDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVN----NAKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNK--ADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIH-NGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETVLNSIMEFNNCNILKSFILGGADINL 1157          

HSP 5 Score: 145.206 bits (365), Expect = 7.946e-34
Identity = 91/303 (30.03%), Postives = 155/303 (51.16%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETIL 1143
            + SG   LH + ++GNL+ V +LI +K DI      G   +H+A + GN ++V +LI++   ++         +H+A  +G+L +   LI  +  ++ K       +H+A  +GN++LV LL+ +   IN    +  TALHYA + GN ++V LL+   +   +N  T S    +HFA    S ++V +L+ +  ++N K D+ +  LHYA  + N A+  LL+ V   +VN KN    +P+ YA+    +++  LLI N  DIN    + E  ++         +    I    DI  ET+L
Sbjct:  862 TNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGID--VNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLM-VYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETVLNSIMEFNNCNILKSFILGGADINLETML 1161          

HSP 6 Score: 125.946 bits (315), Expect = 7.626e-28
Identity = 88/347 (25.36%), Postives = 164/347 (47.26%), Query Frame = 1
Query:  580 VDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            V+ V LL+      N  +     +LH A + GN D+ +LL   K    +N  T +    +H+A  S +  +V+ LI  +  I+ K D     LHYA +  N  +  LLI     +VN K     + + YA+  G +++  LLI++  D+N  T + E  ++ A   G  ++ ++LI    D+  +T      +  A  + N++++ LLI N  N+ +     +  +H A + G + +V  LI N  +I+   +     +H A+E+G + +V  L+++ AD +       T L+ A + G+ ++   LI N  +I  ++      +H A ++G   +   L+ +   I
Sbjct:  618 VESVPLLITHGANPNATNCHGVISLHCAAKNGNLDLAKLL--AKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLI-AYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVNNA----KTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADI 957          

HSP 7 Score: 84.7297 bits (208), Expect = 3.192e-15
Identity = 54/213 (25.35%), Postives = 102/213 (47.89%), Query Frame = 1
Query:  985 IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +E   LLIT+  + N +       +H A+  G  ++A +L     D+  +T      +  A  + N+ +++ LI N  NI +  D  E  +H A      ++V LLI    ++N   D  +  +H A  +G +++V +L+ HGAD N       T LY A + G  D+  +LI  G ++  ++      +H A ++G  ++  LL+ +  +++
Sbjct:  618 VESVPLLITHGANPNATNCHGVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVN 830          

HSP 8 Score: 58.5362 bits (140), Expect = 3.779e-7
Identity = 29/82 (35.37%), Postives = 45/82 (54.88%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +H A  SGNLN+V LL+ +G+++          +HYA E+GNL+L+  L+H    ++ K ++  T L      G  D VS L
Sbjct:  968 LHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLL 1049          

HSP 9 Score: 56.9954 bits (136), Expect = 1.109e-6
Identity = 37/151 (24.50%), Postives = 74/151 (49.01%), Query Frame = 1
Query: 1183 VEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEND 1635
            VE + LLIT+  N  +TN      +H A + G +++ +LL  N  ++N   D     +H A ++G + +VK L+E+ A+ +       T L+ A    + D+  +LI  G ++  ++      +H A  +G  ++  LL+     ++ + +
Sbjct:  618 VESVPLLITHGANPNATNCHGVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTN 768          

HSP 10 Score: 56.6102 bits (135), Expect = 1.466e-6
Identity = 28/84 (33.33%), Postives = 47/84 (55.95%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            +H A  SGNLN+V  L+ + +++     S +  +H+A E+GNL+L+  L+ N   IH K ++  T L      G  + V++L K
Sbjct:  836 LHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIK 919          

HSP 11 Score: 54.6842 bits (130), Expect = 4.842e-6
Identity = 35/119 (29.41%), Postives = 60/119 (50.42%), Query Frame = 1
Query: 1282 VEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            VE V LLI +  N N  N   +  +H A++NG +++ K+L ++GAD N       T L+ A + G+  + K LI+N  NI  ++      +H A      ++  LL+     ++ + DN
Sbjct:  618 VESVPLLITHGANPNATNCHGVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDN 736          

HSP 12 Score: 54.6842 bits (130), Expect = 4.883e-6
Identity = 27/84 (32.14%), Postives = 47/84 (55.95%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            +H A  SGNLN+V  L+ + +++     S +  +H+A ++GNL+L+  L+ N   IH K ++  T L      G  + V++L K
Sbjct:  869 LHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIK 952          

HSP 13 Score: 54.299 bits (129), Expect = 6.458e-6
Identity = 28/82 (34.15%), Postives = 44/82 (53.66%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +H A  +GNL++ KLL  +G+++     + +  +HYA ++GNL L+K L+ N   IH K     T L    +F   D V  L
Sbjct:  642 LHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLL 723          

HSP 14 Score: 54.299 bits (129), Expect = 7.089e-6
Identity = 27/82 (32.93%), Postives = 45/82 (54.88%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +H A  SGNLN+V  L+ + +++     S +  +H+A ++GNL+L+  L+ N   IH K ++  T L      G  + VS L
Sbjct:  902 LHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLL 983          
BLAST of SMED30013077 vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 194.126 bits (492), Expect = 1.325e-48
Identity = 131/494 (26.52%), Postives = 233/494 (47.17%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI--DVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +K G  ALH +   G  + VK L+ +  ++     +G+ P++ A Q  + ++VK+L+++G   +   E  F P+  A   GH  V  +L+   ++  V + A       DD++                     P+H A   GN+++  LLL    A++       T LH A ++GN ++V+LL+      KI+  T+     +H    S  E++VE+L+ +   I  K    + PLH A    +    QLL+  +VP   V+    +  + +  A + G  ++AK+L+    + N        P+H A      +V  +L+     I+  T     PI +A+   +V I+  L+ +  +  +TN   E  +H+A + G  EVV+ L+ +   +         P+HI++  G+ +IV+ LL+ GA  N   T   TPL+L+  +GH DV+  L+D+G ++   + K + P+H A + G  E+A LL+    S D
Sbjct:  104 TKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGA--KIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVP---VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPD 592          

HSP 2 Score: 187.193 bits (474), Expect = 1.790e-46
Identity = 116/493 (23.53%), Postives = 230/493 (46.65%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI----YVYFVNSFKQNN 1701
            ++ GL  LHC  ++G+   V+ L+D    I     +G  P+H A QG + + V+ L++    ++ +       +H A   GH  VA++L+ ++   N KA +   P+H AC+   + +++LLL    +I        T +H A   G+ +IV  L+        N        A+H A  S   E+V  L+    ++  K  ++  PLH +   G   I Q L+     + N      ++P+  +   G  ++A  L+ +   ++ +T+    P+H A+  G  EVA++L+ +    +        P+ +A+  +N ++  LL+    +  +       P+H+A +K  +++   L++   + N    + +  +H+A++ G V++V +LL   A+ N       TPL+LA ++   +V++VL++ G +++ Q+   + P+H  C  G  +I   L+     ++ +  N  Y  L       + + +N   QNN
Sbjct:  298 TRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS--PNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQ-QGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN-GYTPLHQAAQQGHTHIINVLLQNN 786          

HSP 3 Score: 182.185 bits (461), Expect = 7.223e-45
Identity = 112/462 (24.24%), Postives = 220/462 (47.62%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            +K+GL+ LH + +  +L+ V+ L+ H   ++ V       +H A   G+  + K L++     N      F P+H AC    + V  +L+ +   +I+A  +S   PIH A   G+V++V  L+    + N  +    TALH A + G  ++VR LV    Q  +    K     +H +      +IV+ L+ +    N        PLH +   G++ +A  L+D    +++    + F+P+  A   G++E+A LL+  +   + + ++   P+H A+     +VA +L+D+             P+ IA+  N ++I   L+    +  +   +    +H+A Q+G V++V LL+  + N+N +N   + P+H+A++  RV + ++L+  GA  +       TPL++    G+  +   L+ +   +  ++   + P+H A Q G   I  +L+ ++ S
Sbjct:  331 TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ--VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLD-HGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNAS 788          

HSP 4 Score: 175.637 bits (444), Expect = 7.114e-43
Identity = 108/421 (25.65%), Postives = 186/421 (44.18%), Query Frame = 1
Query:  244 SGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            +G   LH +CK   +  ++ L+ H   I+ V   G  PIH A   G+ +IV  L+  G   N    +    +H A  +G   V R L+     V  KA DD  P+H + R G  D+V+ LL    + N A +  +T LH + ++G+ D+   L+       I   TK     +H A      E+  +L+ K    +      + PLH A    N+ +A LL+D     +   KN   ++P+  A    Q++IA  L+    D N  TR     +H A+  G  ++  +L+ R  ++         P+ +A+  + V +  +L+    ++ +       P+HV C  G +++V  L+ +   +N        P+H A++ G   I+ +LL++ A  N +     T L +A   G+  V   L
Sbjct:  399 NGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNG--YTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 5 Score: 175.252 bits (443), Expect = 8.160e-43
Identity = 105/470 (22.34%), Postives = 219/470 (46.60%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN--RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            ++SKSG   LH +   GN++    L++    ++    +   P+H A + GN ++VK L++ G  ++        P+H    +GH  V  +L+ R   +  K  +   P+H A +  +++ V+LLL     ++   ++  TALH A   G++ + ++L+  K     N   K+ N    +H AC     +++E+L+     I    +  + P+H A   G+  I   L+     + N  N    + +  A  SGQ E+ + L+ +   +    +  + P+H ++ LG  ++   L+ +       T     P+ +++   + ++   L+ +  ++  T  +   P+HVA + G +EV  LL+    + + A    + P+H+A+     ++  +LL+ GA  +       TPL++A +K   D++  L++ G +    + +    +H A Q G  ++  LL+  + +++  N
Sbjct:  230 VESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKA----NPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMH-HGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSN 694          

HSP 6 Score: 168.703 bits (426), Expect = 1.010e-40
Identity = 107/449 (23.83%), Postives = 218/449 (48.55%), Query Frame = 1
Query:  286 LDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            LDY+K    +  DI   + +G   +H A + G+ ++V  L++    ++   +K    +H A + G   V ++L++    VN ++ +   P++ A +  ++++VK LL +  + ++A  + FT L  A QQG+  +V LL+    + K+         A+H A   +  +   +L+      + ++     PLH A   GN  +A LL++     V+     + +P+  A   G   + KLL+     I+  TR    P+H  +  G  +V  ML+DR   I  +T     P+ +A+  +++  ++LL+ ++  +    ++    +HVA   G  +V ++L+D   N N        P+HIA +  R++++++LL+HGA    +     TP+++A   GH ++   L+ +G +    +++    +H A ++G  E+ + LV     ++ +
Sbjct:   58 LDYIK----NGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLP------ALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRA-AAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAK 495          

HSP 7 Score: 146.362 bits (368), Expect = 6.872e-34
Identity = 100/423 (23.64%), Postives = 196/423 (46.34%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            A + G+ +     I++G  +N   +   + +H A   GH+ V   L+ R+  V+      +  +H A   G  ++VK+L+ +   +N      FT L+ A Q+ + ++V+ L+       +  AT+     +  A     +++V +L+    E + K    +  LH A    +   A LL+   D N + ++   F+P+  A + G I +A LL+     ++ + R    P+H AS  G   +  +L+DR   I+ +T     P+   + + + +++ +L+     I S       P+H+A Q   +  VQLL+ ++  ++   +  +  +H+A+  G  ++ K+LL+  A+ N       TPL++A +K    V ++L+ +G +I+  +     PIH A   G   I   L+    S +T N
Sbjct:   48 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSL--ATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQ-NDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTN 463          

HSP 8 Score: 100.908 bits (250), Expect = 5.118e-20
Identity = 63/222 (28.38%), Postives = 112/222 (50.45%), Query Frame = 1
Query:  961 LYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            L A  +G +E A   I N  DIN   +     +H AS  G  EV   L+ R+ +++  T      + IAS     E++++L+TN  N+ + +     P+++A Q+  +EVV+ L+DN  + + A +    P+ +A + G  ++V +LLE+  DT       R P L++A  K     + +L+ N  N + +S   + P+H A   G   +A LL++   ++D
Sbjct:   46 LRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN--DTK---GKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVD 262          

HSP 9 Score: 58.5362 bits (140), Expect = 4.730e-7
Identity = 25/92 (27.17%), Postives = 46/92 (50.00%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI 507
            L +KSGL  LH + +   ++  + L++    ++     GY P+H  C  GN  IV +L++    +N   +  + P+H A   GH  +  +L+
Sbjct:  692 LSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 783          
BLAST of SMED30013077 vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 191.43 bits (485), Expect = 6.550e-48
Identity = 129/502 (25.70%), Postives = 228/502 (45.42%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI--------------------------------------SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI--DVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +K G  ALH +   G  + VK L+ +  ++     +G+ P++ A Q  + ++V++L+++G   +   E  F P+  A   GH  V  +L+                                      S+ +VN        P+H A   GN+++  LLL    A++       T LH A ++GN ++V+LL+      KI+  T+     +H    S  E++VE+L+ +   I  K    + PLH A    +    QLL+  +VP   V+    +  + +  A + G  ++AK+L+    + N        P+H A       V  +L+     I+  T     PI +A+   +V I+  L+ +  +  +TN   E  +H+A + G  EVV+ L+ +   +         P+HI++  G+ +IV+ LL+ GA  N   T   TPL+L+  +GH DV+  L+D+G ++   + K + P+H A + G  E+A LL+    S D
Sbjct:  104 TKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGA--KIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVP---VDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPD 600          

HSP 2 Score: 186.422 bits (472), Expect = 2.474e-46
Identity = 116/493 (23.53%), Postives = 229/493 (46.45%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI----YVYFVNSFKQNN 1701
            ++ GL  LHC  ++G+   V+ L+D    I     +G  P+H A QG + + V+ L++    ++ +       +H A   GH  VA++L+ ++   N KA +   P+H AC+   + +++LLL    +I        T +H A   G+ +IV  L+        N        A+H A  S   E+V  L+    ++  K  ++  PLH +   G   I Q L+     + N      ++P+  +   G  ++A  L+ +   ++ +T+    P+H A+  G  EVA +L+ +    +        P+ +A+  +N ++  LL+    +  +       P+H+A +K  +++   L++   + N    + +  +H+A++ G V++V +LL   A+ N       TPL+LA ++   +V++VL++ G +++ Q+   + P+H  C  G  +I   L+     ++ +  N  Y  L       + + +N   QNN
Sbjct:  306 TRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS--PNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQ-QGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKN-GYTPLHQAAQQGHTHIINVLLQNN 794          

HSP 3 Score: 181.8 bits (460), Expect = 8.010e-45
Identity = 112/462 (24.24%), Postives = 220/462 (47.62%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            +K+GL+ LH + +  +L+ V+ L+ H   ++ V       +H A   G+  + K L++     N      F P+H AC    + V  +L+ +   +I+A  +S   PIH A   G+V++V  L+    + N  +    TALH A + G  ++VR LV    Q  +    K     +H +      +IV+ L+ +    N        PLH +   G++ +A  L+D    +++    + F+P+  A   G++E+A LL+  +   + + ++   P+H A+     +VA +L+D+             P+ IA+  N ++I   L+    +  +   +    +H+A Q+G V++V LL+  + N+N +N   + P+H+A++  RV + ++L+  GA  +       TPL++    G+  +   L+ +   +  ++   + P+H A Q G   I  +L+ ++ S
Sbjct:  339 TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLL-KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQ--VEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLD-HGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNAS 796          

HSP 4 Score: 175.637 bits (444), Expect = 5.578e-43
Identity = 108/421 (25.65%), Postives = 186/421 (44.18%), Query Frame = 1
Query:  244 SGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            +G   LH +CK   +  ++ L+ H   I+ V   G  PIH A   G+ +IV  L+  G   N    +    +H A  +G   V R L+     V  KA DD  P+H + R G  D+V+ LL    + N A +  +T LH + ++G+ D+   L+       I   TK     +H A      E+  +L+ K    +      + PLH A    N+ +A LL+D     +   KN   ++P+  A    Q++IA  L+    D N  TR     +H A+  G  ++  +L+ R  ++         P+ +A+  + V +  +L+    ++ +       P+HV C  G +++V  L+ +   +N        P+H A++ G   I+ +LL++ A  N +     T L +A   G+  V   L
Sbjct:  407 NGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSIT--TKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNG--YTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          

HSP 5 Score: 171.014 bits (432), Expect = 1.513e-41
Identity = 114/465 (24.52%), Postives = 206/465 (44.30%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            +++ +  LH + K GN + VK L+D    I+     G  P+H   + G+  +V+ L++    +    +    P+H A    HL   ++L+   + V+    D    +H A   G+  + K+LL  K   N      FT LH AC++    ++ LL+  K    I   T+S    IH A       IV  L+      N  N      LH A  +G   + + L+      V  K  ++ +P+  +   G+ +I + L+      N +T +   P+H ++  G  +VA  L+D    +   T     P+ +A+    +E+  LL+    +  +       P+HVA      +V  LL+D   + + A      P+HIA++  +++I   LLE+GAD N +       ++LA ++GH D+  +L+    N+   +     P+H A Q     +A++LV+    +D +
Sbjct:  273 ARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLL--KHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQ-DGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQ 734          

HSP 6 Score: 164.466 bits (415), Expect = 1.749e-39
Identity = 108/457 (23.63%), Postives = 218/457 (47.70%), Query Frame = 1
Query:  286 LDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEIL--------IGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            LDY+K    +  D+   + +G   +H A + G+ ++V  L++    ++   +K    +H A + G   V ++L++    VN ++ +   P++ A +  ++++V+ LL +  + ++A  + FT L  A QQG+  +V LL+    + K+         A+H A   +  +   +L        I  K  +N   +    PLH A   GN  +A LL++     V+     + +P+  A   G   + KLL+     I+  TR    P+H  +  G  +V  ML+DR   I  +T     P+ +A+  +++  ++LL+ ++  +    ++    +HVA   G  +V ++L+D   N N        P+HIA +  R+ ++++LL+HGA    +     TP+++A   GH ++   L+ +G +    +++    +H A ++G  E+ + LV     ++ +
Sbjct:   58 LDYIK----NGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLP------ALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRA-AAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAK 503          

HSP 7 Score: 142.51 bits (358), Expect = 1.027e-32
Identity = 90/390 (23.08%), Postives = 178/390 (45.64%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITN-------------------------------NCDI------NCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            A R G+++     + +   +N+ +     ALH A ++G+ ++V  L+  + +  ++ ATK  N A+H A ++   E+V++L+     +N ++     PL+ A    +  + + L+D    + +    + F+P+  AL  G  ++  LL+ N                               N DI      N +T +   P+H A+  G   VA +L++R   ++        P+ +AS   N  +++LL+     I +   +   P+H   + G  +VV++L+D    I       + P+H+A++   +  V++LL+H    + +     T L++A   GHY V+KVL+D   N   +++  + P+H AC+     + +LL+    SI
Sbjct:   48 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELL--QREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLD-NGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASI 434          

HSP 8 Score: 93.5893 bits (231), Expect = 9.068e-18
Identity = 62/230 (26.96%), Postives = 112/230 (48.70%), Query Frame = 1
Query:  961 LYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSI--------KKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            L A  +G +E A   I N  D+N   +     +H AS  G  EV   L+ R+ +++  T      + IAS     E++++L+TN  N+ + +     P+++A Q+  +EVV+ L+DN  + + A +    P+ +A + G  ++V +LLE+  DT       R P L++A  K     + +L+ N  N + +S           + P+H A   G   +A LL++   ++D
Sbjct:   46 LRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN--DTK---GKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVD 270          

HSP 9 Score: 87.0409 bits (214), Expect = 8.717e-16
Identity = 54/226 (23.89%), Postives = 96/226 (42.48%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI 906
            + +K G   LH + K G L+    L+      +     G  P+H A    N  +   L++ G   +   +  + P+H A     + +A  L+      N         +H A + G+VD+V LLL+    +N+++    T LH A Q+   ++  +LV+      ++  TK     +H  C   + +IV  L+    ++N K      PLH A   G+  I  +L+
Sbjct:  568 ITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAH--VDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 791          
BLAST of SMED30013077 vs. TrEMBL
Match: Q16FI9 (AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014742 PE=4 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 2.276e-92
Identity = 157/480 (32.71%), Postives = 285/480 (59.38%), Query Frame = 1
Query:  232 LDSK--SGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQ------LVNIKAPDDSR------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRA-IHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            +D+K   G   LH + +NG+L+ VKFLID++ +++   + G+ P+H A Q G+ ++VK LI++   ++  Q K   P+H+A  NGHL V ++LI  +      L+  +A  D+       P+H+A + G++++VKLL+ ++  +    +E +T LH+A + G+ ++V+LL+  +      D T++     ++ A ++   E+V++LI  +  ++   +E   PL+ A  NG+  + +LLID    NV+    E ++P+  A  +G +E+ KLLI N  +++ +      P++ AS  G  EV  +LID + +++        P+ +AS N ++E+++LLI N  N+ +T ++   P+H A Q G +EVV+LLIDN  N++   ++   P+H+AS+NG +E+VK+L+E+ A+ +       TPL+ A++ GH +V K+LIDN  N++    + W P+H A QNG  E+ +LL+D+  ++DT
Sbjct:  276 VDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANV---DTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLID-NKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDT 751          

HSP 2 Score: 318.931 bits (816), Expect = 8.733e-91
Identity = 155/479 (32.36%), Postives = 281/479 (58.66%), Query Frame = 1
Query:  232 LDSK--SGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATK-SANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID----------VPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            +D+K   G   LH + +NG+L+ VKFLID++ +++     G+ P+H A Q G+ ++VK LIE+   ++  + + + P+H+A  NGHL V + LI +R  V+    +   P+H A   G++++VKLL+ ++  ++   +  +T LH A Q G+ ++V+ L+  +      D T+      +H A  +   E+V++LI  K  ++   ++ + PLH+A  NG+  + +LLID              NV+    +  +P+ +A  +G +E+ KLLI N  ++  +      P+HFAS  G  EV  +LI+ + +++        P+++AS N ++E+++LLI N  N+ +T +E   P++VA + G +EVV+LLIDN  N++   ++   P+H+AS+NG +E+VK+L+++ A+ +       TPLY+A++ GH +V K+LIDN  N++    + W P+H A QNG  E+ +LL+++  ++DT
Sbjct:  144 VDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANV---DTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDT 619          

HSP 3 Score: 311.612 bits (797), Expect = 3.716e-88
Identity = 152/473 (32.14%), Postives = 275/473 (58.14%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRR------------PIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            G   LH + +NG+L+ VK LID++ +++     G+ P+H A Q G+ ++VK LIE+   ++  + + + P+H+A  NGHL V + LI +R  V+    +   P+H A + G++++VKLL+ ++  ++   +E +T LH+A Q G+ ++V+ L+  +    ++         +H A  +   E+V++LI  +  ++ K +    PLH A  NG+  + + LID    NV+    E ++P+  A  +G +E+ KLLI N  +++ +      P+HFAS  G  EV  +LID + ++  + +++ R            P+  AS N ++E+++LLI N  N+ +T +E   P+H A + G +EVV+LLI+N  N++   ++   P+++AS NG +E+VK+L+ + A+ +       TPLY+A++ GH +V K+LIDN  N++    + W P+H A QNG  E+ +LL+D+  ++DT
Sbjct:   85 GWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNR--ANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLID-NRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANV-VKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDT 553          

HSP 4 Score: 308.145 bits (788), Expect = 6.634e-87
Identity = 154/473 (32.56%), Postives = 270/473 (57.08%), Query Frame = 1
Query:  244 SGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNI------NCAN-----DKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
             G   LH + +NG+L  VK LID+  +++     G+ P+H A + G  ++VK LI++G  ++  Q++ + P+H A  NGHL V ++LI +R  V+ K      P+H A + G++++VKLL+ ++  ++   +E +T LH+A Q G+ ++V+ L+  +    ++         +H A  +   E+V++LI  +  ++ K +E   PLH+A  NG+  + + LID    NV+    E ++P+  A  +G +E+ KLLI N  +++        P+H AS  G  EV   LID + +++        P+ +AS N ++E+++LLI N  N+ +T ++   P+H A Q G +EVV+LLIDN  N+      N AN     +K + P+H AS+NG +E+VK+L+E+ A+         TPL+ A+  GH +V K+LI+N  N++    + W P++ A  NG  E+ +LL+++  ++DT
Sbjct:   18 GGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNR--ANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLID-NRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDT 487          

HSP 5 Score: 294.664 bits (753), Expect = 4.570e-82
Identity = 149/458 (32.53%), Postives = 261/458 (56.99%), Query Frame = 1
Query:  295 VKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGK--VQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVE-----------IVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            VKFLIDH  +I+  +  G  P+H A Q G+  +VK LI++G  ++   ++ + P+H A  NG+L V ++LI     V+    +   P+H A   G++++VKLL+ ++  ++   +  +T LH A Q G+ ++V+LL+  +  V  K N+        +HFA  +   E+V+ LI  +  ++   DE   PLH A  NG+  + +LLI+    NV+ K  E ++P+ +A  +G +E+ K LI N  +++ +      P+H A+  G  EV  +LI+ + +++ +      P+ +AS N ++E+++ LI N  N+ +T  E   P+HVA Q G +EVV+LLIDN  N++   +K + P+H AS+NG +E           +VK+L+E+ A+ +       TPL+ A++ GH +V K+LI+N  N+     + W P+H A +NG  E+ +LL+++  ++DT
Sbjct:    2 VKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWT----PLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIE-NRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDT 454          

HSP 6 Score: 237.269 bits (604), Expect = 7.613e-62
Identity = 118/347 (34.01%), Postives = 195/347 (56.20%), Query Frame = 1
Query:  586 LVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            +VK L+     I+ A++   T LH A Q G+  +V+LL+       ++         +H A  +   E+V++LI     ++   DE   PLH A  NG+  + +LLID    NV+ K    ++P+  A  +G +E+ KLLI N  +++        P+HFAS  G  EV   LID + +++        P+ +AS N ++E+++LLI N  N+ +  +E   P+H A Q G +EVV+ LIDN  N++   D+   P+H+A+ENG +E+VK+L+E+ A+ +       TPL++A++ GH +V K LIDN  N++    + W P+H A QNG  E+ +LL+D+  ++DT
Sbjct:    1 MVKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNG--ANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLID-NRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDT 344          

HSP 7 Score: 221.09 bits (562), Expect = 2.065e-56
Identity = 118/400 (29.50%), Postives = 220/400 (55.00%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILIS-RQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSA----------------------NRA------------IHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDK 1341
            G+  LH + +NG+L+ VK LI+++ ++      G+ P+H+A + G+ ++VK LIE+   ++  Q + + P++ A +NGHL V ++LI+ R  V+    +   P++ A + G++++VKLL+ +K  ++   +E +T LH A Q G+ ++V+LL+  +      D TK+                       N+A            +H A  +   E+V++LI  +  ++   ++ + PLH+A  NG+  + +LLID    NV+    E ++P+  A  +G +E+ KLLI N  +++ +      P+HFAS  G  EV  +LID + +++        P+ +AS N ++E+++LLI N  N+ +T ++   P++VA   G +EVV+LLIDN  N++   ++
Sbjct:  393 GITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANV---DTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLID-NRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANVDTTQNE 788          

HSP 8 Score: 207.223 bits (526), Expect = 1.131e-51
Identity = 97/280 (34.64%), Postives = 167/280 (59.64%), Query Frame = 1
Query:  790 IVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            +V+ LI     I+  N+    PLH A  NG+  + +LLID    NV+ +  E ++P+  A  +G +E+ KLLI N  +++ +      P+H A+  G  EV  +LID + +++ +      P+ +AS N ++E+++LLI N  N+ +  +E   P+H A Q G +EVV+ LIDN  N++   D+   P+H+AS+NG +E+VK+L+E+ A+ +       TPL+ A++ GH +V K LIDN  N++    + W P+H A +NG  E+ +LL+++  ++DT+
Sbjct:    1 MVKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLID-NGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTK 279          

HSP 9 Score: 67.3958 bits (163), Expect = 1.633e-7
Identity = 30/83 (36.14%), Postives = 49/83 (59.04%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+HLA  +G L +VKLL+D+G+N++        P+H A ENG+L+++K L+ N   +  K +   TPL +    G+ + V  L
Sbjct:   55 PLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLL 137          

HSP 10 Score: 65.4698 bits (158), Expect = 6.613e-7
Identity = 29/83 (34.94%), Postives = 49/83 (59.04%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+HLA  +G+L +VKLL+D+ +N++        P+H A +NG+L+++K L+ N   +  K +   TPL      G+ + V FL
Sbjct:   88 PLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFL 170          

HSP 11 Score: 64.3142 bits (155), Expect = 1.661e-6
Identity = 30/90 (33.33%), Postives = 51/90 (56.67%), Query Frame = 2
Query: 2336 SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +N+  + P+H+A  +G+L +VKLL+D+G+N++        P+H A ENG L+++K L+ N   +        TPL L    G+ + V  L
Sbjct:   15 ANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLL 104          

HSP 12 Score: 63.929 bits (154), Expect = 1.887e-6
Identity = 28/83 (33.73%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H A  +G+L +VK L+D+ +N++        P+H A ENG+L+++K L+ N   +  K +   TPL +    G+ + V FL
Sbjct:  220 PLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFL 302          
BLAST of SMED30013077 vs. TrEMBL
Match: Q16FR1 (AAEL014668-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014668 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 2.694e-88
Identity = 167/492 (33.94%), Postives = 274/492 (55.69%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN-RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYA-------------CT-------NGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSL 1656
            G   LH + +NG LD VK LID++ +++     G  P+HYA + GN ++VK LI++   ++  Q + + P+HYA  NG L V ++LI +R  V+    +   P+HYA R GN++LVKLL+ ++  ++ A  E +T LHYA Q G  D+V+LL+  +      D T++     +H+A  + + E+V++LI  +  ++    E   PLHYA             CT       NGN  + +LLI+    NV+    E ++P+ Y+  +G +++ KLLI N  +++ +      P+H+A   G  EV   LID   +++           I S N  + +++LLI N  N+ +T++E   P+H A Q G +EVV+ LIDN  N +  N +     HIAS+NGR+E+VK+L+++GA+ +       TPL+ A+  GH +V K+LIDNG N++ ++ +     H   QNG  E+ +LL+D+  ++DT  DN  +  L
Sbjct:  230 GWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANV---DTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIE-NRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTT-DNEGWTPL 716          

HSP 2 Score: 312.383 bits (799), Expect = 1.070e-87
Identity = 156/483 (32.30%), Postives = 276/483 (57.14%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDI-----ECETILKR---------------RPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            G   LH + +NGNL+ VK LID++ +++   + G+ P+HYA + G  D+VK LI++   ++  Q +   P+HYA  NG+L + ++LI +R  V+    +   P+HYA + G +D+VKLL+ ++  ++   +E  T LHYA + GN ++V+LL+  +    ++ A       +H+A  +   ++V++LI  +  ++   +E   PLHYA  NGN  + +LLID    NV+    E ++P+ YA  +GQ+++ KLLI N  +++ +      P+H+AS  G  E+  +LID + ++     E  T L                  P+  AS N N+E+++LLI N  N+ +  +E   P+H + Q G ++VV+LLI+N  N++   ++   P+H A +NG +E+VK L+++GA+ + + T   T  ++ ++ G   + K+LIDN  N++    + W P+H A QNG  E+ + L+D+  + DT+N
Sbjct:  131 GWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNR--ANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLID-NRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKN 610          

HSP 3 Score: 311.612 bits (797), Expect = 1.644e-87
Identity = 154/482 (31.95%), Postives = 275/482 (57.05%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID-------------VP------DCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            G   LH + +NGNL+ VK LID++ +++   + G+ P+HYA Q G  D+VK LI++   ++  Q +   P+HYA  NG+L + ++LI +R  V+    +   P+HYA R G +D+VKLL+ ++  ++   +E  T LHYA + GN ++V+LL+  +    ++ A       +H+A  +   ++V++LI  +  ++   +E   PLHYA  NGN  + +LLID              P      + NV+    E  +P+ YA  +G +E+ KLLI N  +++ +      P+H++S  G  +V  +LI+ + +++        P+  A  N ++E+++ LI N  N+ + N       H+  Q G + +V+LLIDN  N++  +++   P+H AS+NG +E+VK L+++GA+ +   T   T  ++A++ G  +V K+LIDNG N++  + + W P+H A +NG  E+ +LL+D+  ++DT+N
Sbjct:  197 GCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNR--ANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKN 676          

HSP 4 Score: 308.145 bits (788), Expect = 3.344e-86
Identity = 156/484 (32.23%), Postives = 265/484 (54.75%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL---------------------VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRA-IHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            G   LH + +NGNL+ VK LID++ +++   + G+ P+HYA Q G  D+VK LI++   ++  Q +   P+HYA  NG+L + ++LI  +                      V+    +   P+HYA R GN++LVKLL+ ++  ++ A +E +T LHY+ Q G+  +V+LL+  K      D T++     +H+A  +   E+V+ LI     ++  N       H    NG   + +LLID    NV+  + E ++P+ YA  +G +E+ K LI N  + +          H AS  G  EV  +LID   +++        P+  AS N ++E+++LLI N  N+ + N       H+  Q G +EVV+LLIDN  N++  +++   P+H AS NG +E+VK+L+++GA+ +   T   T  ++A++ G  +V K+LIDNG N++  + + W P+H A +NG  E+ +LL+D+  ++DT+N
Sbjct:  329 GCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANV---DTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLID-NRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKN 808          

HSP 5 Score: 308.145 bits (788), Expect = 3.768e-86
Identity = 163/521 (31.29%), Postives = 279/521 (53.55%), Query Frame = 1
Query:  232 LDSKS--GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKV-------------------------------QCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLM--------------------KPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            +D+K   G   LH + +NGNL+ VK LID++ +++     G+ P+HYA Q G+ D+VK LI++   ++  Q +   P+H A  NGHL V ++LI  +  V+    +   P+HYA R GN++LVKLL+ ++  ++ A  E +T LHYA + G  D+V+LL+  +                                +  ++ A       +H+A  +   ++V++LI  +  ++   +E   PLHYA  NGN  + +LLID    NV+    E ++P+ YA  +GQ+++ KLLI N  +++ +      P+H+AS  G  E+  +LID + +++        P+  AS N  +++++LLI N  N+ +T +E   P+H A + G +E+V+LLIDN  N++ A  +                       P+H AS NG +E+VK+L+E+ A+ +       TPL+ +++ GH  V K+LI+N  N++    + W P+H A QNG  E+ + L+D+  ++DT N
Sbjct:   25 IDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLID-NRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMN 544          

HSP 6 Score: 307.375 bits (786), Expect = 5.958e-86
Identity = 156/477 (32.70%), Postives = 275/477 (57.65%), Query Frame = 1
Query:  259 LHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKW--------------------RPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            LH +   GN++ VK LIDH  +I+  D  G  P+HYA + GN ++VK LI++   ++  Q + + P+HYA  NGH+ V ++LI +R  V+    +   P+H A   G++D+VKLL+ +K  ++ A SE +T LHYA + GN ++V+LL+  +    ++ A       +H+A  +   ++V++LI  +  ++   +E   PLHYA  NGN  + +LLID    NV+    E ++P+ YA  +GQ+++ KLLI N  +++ +      P+H+AS  G  E+  +LID + +++        P+  AS N  +++++LLI N  N+ +T +E   P+H A + G +E+V+LLIDN  N++ A  +   P+H AS+NG++++VK+L+++ A+ +       TPL+ A+  G+ ++ K+LIDN  N++    + W                     P+H A +NG  E+ +LL+++  ++DT
Sbjct:    3 LHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNR--ANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLID-NRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDT 476          

HSP 7 Score: 306.605 bits (784), Expect = 1.375e-85
Identity = 163/515 (31.65%), Postives = 280/515 (54.37%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCK---------INDATKSAN---------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDI-------------------------------NCSTRTQE--RPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEND 1635
            G   LH + +NGNL+ VK LID++ +++   + G+ P+HYA + G  D+VK LI++   ++  Q +   P+HYA  NG+L + ++LI +R  V+    +   P+HYA + G +D+VKLL+ ++  ++   +E  T LHYA + GN ++V+LL+  +             ++ A+++AN           +H+A  + + E+V++LI  +  ++   +E   PLHY+  NG+  + +LLI+    NV+    E ++P+ YA  +G +E+ K LI N  ++                               N  T   E   P+H+AS  G  EV   LID   + + +         IAS N  +E+++LLI N  N+ +TN+E   P+H A + G +EVV+LLIDN  N++  N +     HI S+NGR+E+VK+L+++ A+ +       TPL+ A+  GH +V K+LIDNG N++ ++ +     H A +NG  E+ +LL+D+  ++DT N+
Sbjct:  263 GCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIE-NKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNN 776          

HSP 8 Score: 277.715 bits (709), Expect = 1.954e-75
Identity = 144/421 (34.20%), Postives = 236/421 (56.06%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLID 1506
            G   LH + +NGNL+ VK LI+++ +++     G+ P+HY+ Q G+  +VK LIE+   ++  Q + + P+HYA  NGHL V + LI     V+      S   H   + G + LVKLL+ ++  ++  D+E +T LHYA Q G+ ++V+ L+         +   S   + H A  +   E+V++LI     ++  N+E   PLHYA  NG+  + +LLID    NV+ KNA   +       +G++E+ KLLI N  +++ +      P+H+AS  G  EV  +LID   +++ +         IAS N  +E+++LLI N  N+ +TN+E   P+H A + G +EVV+LLIDN  N++  N +     HI S+NGR+E+VK+L+++GA+ +       T L+ A+  GH +V K+ ID
Sbjct:  448 GCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGST--SFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLID-NGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWTLLHDASLNGHLEVVKLSID 865          

HSP 9 Score: 268.47 bits (685), Expect = 3.492e-72
Identity = 141/425 (33.18%), Postives = 245/425 (57.65%), Query Frame = 1
Query:  355 PIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            P+H A   GN ++VK LI+    ++   ++   P+HYA  NG+L + ++LI +R  V+    +   P+HYA + G++D+VKLL+ ++  ++   +E  T LH A + G+ D+V+LL+  K    ++ A       +H+A  + + E+V++LI  +  ++    E   PLHYA  NG   + +LLID    NV+    E  +P+ YA  +G +E+ KLLI N  +++ +      P+H+AS  G  +V  +LID + +++        P+  AS N N+E+++LLI N  N+ +   E   P+H A + G ++VV+LLIDN  N++   ++   P+H AS NG +E+VK+L+++ A+ +       TPL+ A++ G  DV K+LIDN  N++    +   P+H A +NG  E+ +LL+D+  ++DT
Sbjct:    2 PLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNK--ANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLID-NRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDT 423          

HSP 10 Score: 160.614 bits (405), Expect = 1.852e-36
Identity = 80/225 (35.56%), Postives = 134/225 (59.56%), Query Frame = 1
Query:  952 SPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            +P+  A   G IE+ KLLI +N +I+        P+H+AS  G  E+  +LID + +++        P+  AS N ++++++LLI N  N+ +T +E   P+H A + G ++VV+LLIDN  N++ A  +   P+H AS NG +E+VK+L+++ A+ +       TPL+ A+  G  DV K+LIDN  N++    +   P+H A QNG  E+ +LL+D+  ++DT
Sbjct:    1 TPLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDT 225          

HSP 11 Score: 69.707 bits (169), Expect = 3.887e-8
Identity = 31/83 (37.35%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H A   GN+ +VKLL+DH +N++  D     P+HYA  NGNL+++K L+ N   +    +   TPL      G+ D V  L
Sbjct:    2 PLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLL 84          

HSP 12 Score: 64.3142 bits (155), Expect = 1.660e-6
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H A  +G+L++VKLL+D+ +N++        P+HYA  NGNL+L+K L+ N   +    +   TPL      G  D V  L
Sbjct:  101 PLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLL 183          

HSP 13 Score: 63.5438 bits (153), Expect = 3.117e-6
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H A  +G L++VKLL+D+ +N++        P+HYA +NGNL+L+K L+ N   +    +   TPL      G  D V  L
Sbjct:  167 PLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLL 249          

HSP 14 Score: 62.7734 bits (151), Expect = 5.063e-6
Identity = 29/83 (34.94%), Postives = 47/83 (56.63%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H A  +GNL +VKLL+D+ +N++        P+HYA +NG++D++K L+ N   +    +   TPL      G+ D V  L
Sbjct:   35 PLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLL 117          

HSP 15 Score: 62.3882 bits (150), Expect = 5.901e-6
Identity = 30/83 (36.14%), Postives = 45/83 (54.22%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H A  +G L++VKLL+D+ +N++        P+HYA  NGNL+L+K L+ N   +    +   TPL      G  D V  L
Sbjct:  233 PLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLL 315          

HSP 16 Score: 62.3882 bits (150), Expect = 6.316e-6
Identity = 30/83 (36.14%), Postives = 45/83 (54.22%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H A  +G L++VKLL+D+ +N++        P+HYA  NGNL+L+K L+ N   +    +   TPL      G  D V  L
Sbjct:  299 PLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLL 381          
BLAST of SMED30013077 vs. TrEMBL
Match: A0A1X7T5X6 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 5.580e-82
Identity = 172/486 (35.39%), Postives = 285/486 (58.64%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDH-KCDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPD--DSRPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAK-LLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDNVNYFSL 1656
             K G   LH +C+ G+ + VK L +H +C+IE  D    +P+H AC+ GN DIV++L I+  C +N +    + P+HYAC  GH  + +IL +    N++A    + RP+H AC +GNVD+V+ L+ +K C +N  D   +T LHYAC++G+ + V++L +   QC I       NR +H AC S + +IV  ++I K C++N K      PLHYAC  G+  I ++L + P CN+  ++  +  P+  A  SG ++I + L+I  +CD+N   R    P+H+A   G  E+  +L +  QC++E E     RP+  A  + NV+I+R L+I  HC++ + +     P+H AC+KG  E V++L ++  CNI   ++   +P+H A E+G V+IV+ ++++   D N I     TPL+ A EKGH+++ K+L ++  CN+E +     RP+H AC++G  +I + L++D HC ++ + D + Y  L
Sbjct:  245 GKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKIL-TNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAK-DRIGYTPL 728          

HSP 2 Score: 290.426 bits (742), Expect = 6.351e-78
Identity = 167/477 (35.01%), Postives = 277/477 (58.07%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDH-KCDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPD--DSRPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAK-LLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDN-GCNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTE 1629
             ++G   LH +C+ G  + V+ L DH +C+IE  D    +P+H AC+ GN DIV +L I+  C +N      + P+HYAC  GH  + +IL +    NI+     + RP+H AC +GNVD+V+ L+  K C +N      +T LHYAC++G+ +IV++L +   QC +       +R +H AC S + +IV  ++I K C++N K  +   PLHYAC  G+  I ++L + P CN+  ++     P+  A  SG ++I + L+I  +CD+N        P+H+A   G  E+  +L +  QC++E E     RP+  A  + NV+I+R L+I  HC++ + +     P+H AC+KG  E V++L ++  CNI   ++   +P+H A E+G V+IV+ ++++   D N       TPL+ A EKGH+++ K+L ++  CNIE +   K RP+HNAC++G  +I + L++D HC ++ +
Sbjct:   41 GRNGYTPLHYACEEGCFEIVRILTDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKIL-TNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAK 516          

HSP 3 Score: 273.863 bits (699), Expect = 2.531e-72
Identity = 163/480 (33.96%), Postives = 270/480 (56.25%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDH-KCDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPD--DSRPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAK-LLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVKIL-LEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDN 1638
             ++G   LH +C+ G+ + VK L +H +C+IE  D+   +P+H AC+ GN DIV++L I+  C +N      + P+HYAC  GH  + +IL +    N++A    + RP+H AC +GNVD+V+ L+ +K C +N  D   +T LHYAC++G+ + V++L +   QC I       NR +H AC S + +IV  ++I K C++N        PLHYAC  G+  I ++L +   CN+  + +    P+  A  SG ++I + L+I  +CD+N   R    P+H+A   G  E   +L +  QC+IE E     RP+  A  + NV+I+R L+I  HC++ +       P+H AC+KG  E+V+ L ++  CN    +    +P+H A ++  V+IV+ L ++   D N       TPL+ A EKGH+++ K+L ++  CN E + +   R +H AC+ G  +I + L++D H  ++ +  N
Sbjct:  449 GRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKIL-TNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLHKACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKILTNHPQCNTEAEDVYDDRSLHKACEFGRLDIVRYLVIDKHRDVNAKGRN 927          

HSP 4 Score: 264.618 bits (675), Expect = 3.003e-69
Identity = 162/500 (32.40%), Postives = 263/500 (52.60%), Query Frame = 1
Query:  244 SGLNALHCSCKNGNLDYVKFLIDH-KCDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDD--SRPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAK-LLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLID-NHCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL-----------------------------------IDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD 1605
            +G   LH +C+ G+ + VK L +H +C++E       +P+H AC+ GN DIV++L I   C +N      + P+HYAC  GH    +IL +    NI+A D+  +RP+H AC +GNVD+V+ L+  K C +N      +T LHYAC++G+ +IV++L +   QC I     S +R +H AC S + +IV  ++I K C++N K      PLHYAC  G+  I ++L +   CN+  + +    P+  A  SG ++I + L+I  +CD+N   R    P+H+A   G  E   +L +  QC+IE +     RP+  A  + NV+I+R L+I  HC++ +       P+H AC+KG  E+V++L + + CN+        +P+H A E+G V+IV+ ++++   D N       TPL+ A EKGH++  K+L                                   ID  C++  +    + P+H AC+ G  EI + L +
Sbjct:  315 NGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKIL-TNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTN 813          

HSP 5 Score: 258.455 bits (659), Expect = 3.169e-67
Identity = 154/451 (34.15%), Postives = 254/451 (56.32%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDH-KCDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDD--SRPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAK-LLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVKIL-LEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDN-GCNIECQSIKKWRPIHNA 1563
            G   LH +C+ G+ + VK L +H +C++E       +P+H AC+ GN DIV++L I   C +N      + P+HYAC  GH    +IL +    NI+A D+  +RP+H AC +GNVD+V+ L+  K C +N      +T LHYAC++G+ +IV++L +   QC +       +R +H AC S + +IV  ++I K C++N K+     PLHYAC  G+    ++L + P CN+  ++     P+  A  SG ++I + L+I  +CD+N   R    P+H+A   G  E+   L +  QC+ + E +   RP+  A  + NV+I+R L+I  H ++ +   +   P+H AC+KG  E+V++L ++  CN    +    + +H A E GR++IV+ L ++   D N       TPL+ A EKGH+++ K+L ++  CNIE ++     P+H A
Sbjct:  520 GYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKIL-TNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLHKACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKILTNHPQCNTEAEDVYDDRSLHKACEFGRLDIVRYLVIDKHRDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAENNDNKWPLHLA 969          

HSP 6 Score: 248.825 bits (634), Expect = 5.509e-64
Identity = 152/445 (34.16%), Postives = 246/445 (55.28%), Query Frame = 1
Query:  340 FHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRTGNVDLV-KLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIA-KLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLID-NHCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDN-GCNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDN 1638
            F   + + YAC+  N DIV++L I+  C +N      + P+HYAC  G   + RIL      NI+  D+S  RP+H AC +GNVD+V  L++   C +N      +T LHYAC++G+ +IV++L +   QC I       +R +H AC S + +IV  ++I K C++N        PLHYAC  G+  I ++L +   CN+  +      P+  A  SG ++I   L+I  +CD+N   +    P+H+A   G  E+  +L +  QC+IE E     RP+  A  + NV+I+R L+I  HC++ +       P+H AC+KG  E+V++L + + CN+        +P+H A E+G V+IV+ +++    D N       TPL+ A EKGH++  K+L ++  CNIE +     RP+H AC++G  +I + L++D HC ++ +  N
Sbjct:    8 FEDRRSLVYACKFRNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEEGCFEIVRILTDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKIL-TNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRN 451          

HSP 7 Score: 221.476 bits (563), Expect = 3.822e-55
Identity = 131/382 (34.29%), Postives = 220/382 (57.59%), Query Frame = 1
Query:  538 DDSRPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIV-EILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAK-LLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEIL-RLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDNVNYFSL 1656
            +D R + YAC+  NVD+V+ L+  K C +N      +T LHYAC++G  +IVR+L +   QC I     S +R +H AC S + +IV  ++I K C +N K      PLHYAC  G+  I ++L + P CN+  + +    P+  A  SG ++I + L+I  +CD+N        P+H+A   G  E+  +L +  QC++E E     RP+  A  + NV+I+  L+I  HC++ +   +   P+H AC+KG  E+V++L ++  CNI   ++   +P+H A E+G V+IV+ ++++   D N I     TPL+ A EKGH+++ K+L ++  CN+E +     RP+H AC++G  +I + L+++ HC ++ + D + Y  L
Sbjct:    9 EDRRSLVYACKFRNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEEGCFEIVRIL-TDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAK-DRIGYTPL 388          

HSP 8 Score: 62.7734 bits (151), Expect = 5.405e-6
Identity = 33/86 (38.37%), Postives = 50/86 (58.14%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGS-NLECPDRSNKRPIHYACENGNLDLIKALV-HNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLS 2608
            P+H AC  G+   VK+L +H   N+E  D  N RP+H ACE+GN+D+++ LV   +C ++ K     TPL      G+ + V FL+
Sbjct:  727 PLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLT 812          

HSP 9 Score: 62.3882 bits (150), Expect = 7.848e-6
Identity = 36/95 (37.89%), Postives = 52/95 (54.74%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGS-NLECPDRSNKRPIHYACENGNLDLIKALV-HNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREI 2635
            P+H AC  G   IV++L DH   N+E  D SN RP+H ACE+GN+D++  LV   +C ++ K     TPL      G+ + V  L+     N E+
Sbjct:   47 PLHYACEEGCFEIVRILTDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEV 141          

HSP 10 Score: 62.003 bits (149), Expect = 8.688e-6
Identity = 34/86 (39.53%), Postives = 51/86 (59.30%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGS-NLECPDRSNKRPIHYACENGNLDLIKALVHN-NCAIHCKNHASSTPLDLLKTFGYDDCVSFLS 2608
            P+H AC  G+  IVK+L +H   NLE     N RP+H ACE+GN+D+++ LV N +C ++ K+    TPL      G+ + V  L+
Sbjct:  319 PLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILT 404          

HSP 11 Score: 62.003 bits (149), Expect = 8.688e-6
Identity = 34/86 (39.53%), Postives = 51/86 (59.30%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGS-NLECPDRSNKRPIHYACENGNLDLIKALVHN-NCAIHCKNHASSTPLDLLKTFGYDDCVSFLS 2608
            P+H AC  G+  IVK+L +H   NLE     N RP+H ACE+GN+D+++ LV N +C ++ K+    TPL      G+ + V  L+
Sbjct:  523 PLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILT 608          
BLAST of SMED30013077 vs. TrEMBL
Match: A0A1X7TD77 (ANK_REP_REGION domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 2.289e-79
Identity = 168/477 (35.22%), Postives = 273/477 (57.23%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDH-KCDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLV-KLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIA-KLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIA-QLLVDSHCSIDTENDN 1638
            + GL+ LH +C+N + + VK L ++ +C+ E  D    +P+H  CQ GN DIV +L I+  C +N      + P+HYAC  GH  + +IL +R+    K   + RP+H AC +GNVD+V  L++   C ++V  S   T LHYAC++G+ +IV++L +   QC I        R +H AC S   +IV  ++I K C++N K    + PLHYAC  G+  I ++L + P CN+  +N     P+  A  SG ++I   L+I  +CD+N        P+H+A   G  E+  +L +  QC+IE E     RP+  A  + NV+I+R L+I  HC++  T   +  P+H AC+KG  E+V++L ++  CNI   +D   +P+H A E+G+++IV+ ++++   D N       TPL+ A +KGH+++ K+L ++  CNIE +     RP+H A Q+G  +I   L++D HC ++ +  N
Sbjct:  113 RDGLSPLHVACENSHFETVKVLTNYPQCNTEAEDESNDRPLHKVCQSGNVDIVHHLVIDKHCHVNAKGMDGYTPLHYACEKGHFEIVKILSNRRQFEAKDKSNDRPLHKACESGNVDIVHHLVIGKHCDVSVTGSNDLTPLHYACKKGHFEIVKIL-TNHPQCNIEAEDDYNYRPLHKACESGILDIVRHLVIDKHCDVNAKRWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAENKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKACESGNVDIVRHLVIGKHCDVSVTGSNDLTPLHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGKLDIVRHLVIDKHCDVNAKGWNGLTPLHYACKKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGRN 588          

HSP 2 Score: 283.493 bits (724), Expect = 1.906e-76
Identity = 167/483 (34.58%), Postives = 278/483 (57.56%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLID----HKCDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIV-EILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAK-LLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEIL-RLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDN 1638
             + G   LH +C NGN   V+FL       +C+IE  D    +P+H ACQ GN DIV +L I+  C +N  +     P+H AC N H    ++L +    N +A D+S  RP+H  C++GNVD+V  L+  K C +N    + +T LHYAC++G+ +IV++L S + Q +  D  KS +R +H AC S + +IV  ++IGK C+++     ++ PLHYAC  G+  I ++L + P CN+  ++   + P+  A  SG ++I + L+I  +CD+N        P+H+A   G  E+  +L +  QC+IE E     RP+  A  + N++I+  L+I  HC++ +       P+H AC+KG  E+V++L ++  CNI   +    +P+H A E+G V+IV+ +++    D +   +   TPL+ A EKGH+++ K+L ++  CNIE +    +RP+H AC++G  +I + L++D HC ++ +  N
Sbjct:   41 GRDGFTPLHVACFNGNFKIVQFLTSCTEITECNIEAKDNGQNRPLHLACQSGNVDIVHHLMIDKHCDVNAKRRDGLSPLHVACENSHFETVKVLTNYPQCNTEAEDESNDRPLHKVCQSGNVDIVHHLVIDKHCHVNAKGMDGYTPLHYACEKGHFEIVKIL-SNRRQFEAKD--KSNDRPLHKACESGNVDIVHHLVIGKHCDVSVTGSNDLTPLHYACKKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGILDIVRHLVIDKHCDVNAKRWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAENKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKACESGNVDIVRHLVIGKHCDVSVTGSNDLTPLHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGKLDIVRHLVIDKHCDVNAKGWN 520          

HSP 3 Score: 257.684 bits (657), Expect = 1.394e-67
Identity = 159/482 (32.99%), Postives = 268/482 (55.60%), Query Frame = 1
Query:  244 SGLNALHCSCKNGNLDYVKFLIDH-KCDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIV-EILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITN---NCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCE---IAQLLVDSHCSIDTENDN 1638
            +GL  LH +C+ G+ + VK L +H +C+IE  D    +P+H AC+ GN DIV++L I   C ++        P+HYAC  GH  + +IL +    NI+A DD   RP+H AC +G +D+V+ L+  K C +N       T LHYAC++G+ +IV++L +   QC I    KS +R +H A  S + +IV  ++I K C++N K    + PLHYAC  G+  I ++L + P CN+  ++   + P+  A  SG ++I + L+ +   +CD+N        P+H+A   G  E+  +L +    +IE +     RP+  A ++ N++ +R L+I  HC++ +   +   P+H AC+ G  E V++L D+  CNI   +D   +P+H A ++  V+IV+ ++++   D N       TPL+ A + GH+++ K+L ++  CNIE +     +P+H AC   F     +  LL+D  C ++ +  N
Sbjct:  384 NGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKACESGNVDIVRHLVIGKHCDVSVTGSNDLTPLHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGKLDIVRHLVIDKHCDVNAKGWNGLTPLHYACKKGHFEIVKIL-TNHPQCNIEAEDKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGRNGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGNVDIVRHLVIDKKKHCDVNAKGGNGLTPLHYACKKGHFEIVKILTNHPHFNIEAKDNSNDRPLHKACASKNLDSVRHLVIDKHCDVNAKGMDGYTPLHYACKTGHFENVKILTDHPQCNIEAEDDYNDRPLHEACKSINVDIVRHLVIDKHCDVNAKGRNGYTPLHYACKVGHFEIVKILTNHPQCNIESEDNNLEKPLHLACTCIFKNVNIVRHLLIDKRCDVNAKERN 864          

HSP 4 Score: 248.054 bits (632), Expect = 2.793e-64
Identity = 157/454 (34.58%), Postives = 249/454 (54.85%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDH-KCDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRTGNVDLV-KLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILI---GKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIE-IAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASE--NGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNA 1563
            L  LH +C+ G+ + VK L +H +C+IE  D + Y+P+H AC+ G  DIV++L I+  C +N        P+HYAC  GH  + +IL +    NI+A D S  RP+H A ++GN+D+V  L++   C +N       T LHYAC++G+ +IV++L +   QC I        R +H AC S + +IV  L+    K C++N K    + PLHYAC  G+  I ++L + P  N+  K+     P+  A  S  ++ +  L+I  +CD+N        P+H+A   G  E   +L D  QC+IE E     RP+  A  + NV+I+R L+I  HC++ +       P+H AC+ G  E+V++L ++  CNI   ++ L KP+H+A       V IV+ +L++   D N       TPL+ A E+ H+ + K+L ++  CNIE ++    RP+H A
Sbjct:  454 LTPLHYACEKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGKLDIVRHLVIDKHCDVNAKGWNGLTPLHYACKKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGRNGLTPLHYACEKGHFEIVKIL-TNHPQCNIEAEDDYNYRPLHKACESGNVDIVRHLVIDKKKHCDVNAKGGNGLTPLHYACKKGHFEIVKILTNHPHFNIEAKDNSNDRPLHKACASKNLDSVRHLVIDKHCDVNAKGMDGYTPLHYACKTGHFENVKILTDHPQCNIEAEDDYNDRPLHEACKSINVDIVRHLVIDKHCDVNAKGRNGYTPLHYACKVGHFEIVKILTNHPQCNIESEDNNLEKPLHLACTCIFKNVNIVRHLLIDKRCDVNAKERNGYTPLHYACEESHFKIVKILTNHPQCNIEAENKNNKRPLHLA 906          

HSP 5 Score: 214.542 bits (545), Expect = 3.052e-53
Identity = 153/479 (31.94%), Postives = 239/479 (49.90%), Query Frame = 1
Query:  268 SCKNGNLDYV-KFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIE----SGCMMNFLQEKAFHPIHYACMNGHL-AVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLL-ASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITN-NCDINCSTRTQERPIHFASTLGFTE-VAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNH--CNIKSTNDENEQPIHVACQKGFVEVV-QLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGA-DTNCICTYARTPLYLATEKGHYDVSK-VLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD-SHCSIDTENDNVNYFSL 1656
            +CK+ NLD + + +I  + D+      G+ P+H AC  GN  IV++L      + C +         P+H AC +G++  V  ++I +   VN K  D   P+H AC   + + VK+L    +C     D      LH  CQ GN DIV  LV  K  C +N         +H+AC     EIV+IL  ++ +   K+     PLH AC +GN  I   L+    C+V+   + + +P+ YA   G  EI K+L  +  C+I        RP+H A   G  + V H++ID+ CD+  +      P+  A    + EI+++L TNH  CNI++ N  N++P+H A Q G +++V  L+ID HC++N      + P+H A E G  EIVKIL  H   +          PL+ A E G+ D+ + ++I   C++         P+H AC+ G  EI ++L +   C+I+ E D+ NY  L
Sbjct:   17 ACKSNNLDILHQIVIYKQYDVNAKGRDGFTPLHVACFNGNFKIVQFLTSCTEITECNIEAKDNGQNRPLHLACQSGNVDIVHHLMIDKHCDVNAKRRDGLSPLHVACENSHFETVKVLTNYPQCNTEAEDESNDRPLHKVCQSGNVDIVHHLVIDK-HCHVNAKGMDGYTPLHYACEKGHFEIVKILSNRR-QFEAKDKSNDRPLHKACESGNVDIVHHLVIGKHCDVSVTGSNDLTPLHYACKKGHFEIVKILTNHPQCNIEAEDDYNYRPLHKACESGILDIVRHLVIDKHCDVNAKRWNGLTPLHYACEKGHFEIVKIL-TNHPQCNIEAENKSNDRPLHKAFQSGNLDIVCHLVIDKHCDVNAKGWNGLTPLHYACEKGHFEIVKILTNHPQCNIEAEDKSNDRPLHKACESGNVDIVRHLVIGKHCDVSVTGSNDLTPLHYACEKGHFEIVKILTNHPQCNIEAE-DDYNYRPL 491          

HSP 6 Score: 153.68 bits (387), Expect = 5.539e-34
Identity = 96/279 (34.41%), Postives = 145/279 (51.97%), Query Frame = 1
Query:  244 SGLNALHCSCKNGNLDYVKFLIDHK-CDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDD--SRPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFAC---MSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYA-----LNSGQIEIAKLLITNNCDINCSTR 1041
            +GL  LH +CK G+ + VK L +H   +IE  D    +P+H AC   N D V++L I+  C +N      + P+HYAC  GH    +IL      NI+A DD   RP+H AC++ NVD+V+ L+  K C +N      +T LHYAC+ G+ +IV++L +   QC I     +  + +H AC         +  +LI K+C++N K      PLHYAC   +  I ++L + P CN+  +N     P+  A     L   Q +IA  L+    D  C+T+
Sbjct:  658 NGLTPLHYACKKGHFEIVKILTNHPHFNIEAKDNSNDRPLHKACASKNLDSVRHLVIDKHCDVNAKGMDGYTPLHYACKTGHFENVKILTDHPQCNIEAEDDYNDRPLHEACKSINVDIVRHLVIDKHCDVNAKGRNGYTPLHYACKVGHFEIVKIL-TNHPQCNIESEDNNLEKPLHLACTCIFKNVNIVRHLLIDKRCDVNAKERNGYTPLHYACEESHFKIVKILTNHPQCNIEAENKNNKRPLHLAFSHKPLTESQWDIASYLVQ---DKGCNTQ 932          

HSP 7 Score: 125.176 bits (313), Expect = 3.131e-25
Identity = 89/287 (31.01%), Postives = 145/287 (50.52%), Query Frame = 1
Query:  841 EEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLIT----NNCDINCSTRTQERPIHFASTLGFTE-VAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNH--CNIKSTNDENEQPIHVACQKGFVEVVQ-LLIDNHCNINCANDKLMKPIHIASENGRVEIVKIL-----LEHGADTNCICTYARTPLYLATEKGHYD-VSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD-SHCSIDTENDNVNYFSL 1656
            E+   L  AC + N  I   ++     +VN K  + F+P+  A  +G  +I + L +      C+I      Q RP+H A   G  + V H++ID+ CD+  +      P+ +A  N++ E +++L TN+  CN ++ ++ N++P+H  CQ G V++V  L+ID HC++N        P+H A E G  EIVKIL      E    +N        PL+ A E G+ D V  ++I   C++         P+H AC+ G  EI ++L +   C+I+ E D+ NY  L
Sbjct:    9 EDRISLIDACKSNNLDILHQIVIYKQYDVNAKGRDGFTPLHVACFNGNFKIVQFLTSCTEITECNIEAKDNGQNRPLHLACQSGNVDIVHHLMIDKHCDVNAKRRDGLSPLHVACENSHFETVKVL-TNYPQCNTEAEDESNDRPLHKVCQSGNVDIVHHLVIDKHCHVNAKGMDGYTPLHYACEKGHFEIVKILSNRRQFEAKDKSN------DRPLHKACESGNVDIVHHLVIGKHCDVSVTGSNDLTPLHYACKKGHFEIVKILTNHPQCNIEAE-DDYNYRPL 287          
BLAST of SMED30013077 vs. TrEMBL
Match: A0A1X7T2L1 (ANK_REP_REGION domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 1.354e-75
Identity = 168/480 (35.00%), Postives = 262/480 (54.58%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDH-KCDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAP--DDSRPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAK-LLITNNCDINCSTRTQERPIHFAS-TLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLID-NGCNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDN 1638
              +G   LH +C N N + V+FL    +C+IE       +P+H ACQ GN DIV++L I+  C +N  +  +  P+H AC+NG+    + L S    NI+A   D  RP+H AC++GNVD+V+ L+  K C +N         LH AC   N + V+ L S   +C I        R +H AC S S +IV  ++I K C+I+ K  + + PLH AC NGN    Q L    +CN+  K      P+  A  SG ++I + L+I  +CD+N        P+H A     F  V  +    +C++E E  LKRRP+  A  + +V+I+R L+I  HC+I +   +   P+HVAC  G  E VQLL  +  CNI   +   ++P+H+A ++G V+IV+ ++++   D N    +  TPL+ A EKGH+++ K+L +   CN E ++    RP+H AC++G  +I + L++D HC ++ +  N
Sbjct:  180 GSNGYTPLHVACLNHNFETVQFLTSSTECNIEAEGIDQIRPLHLACQSGNVDIVRHLVIDKHCDINAKERDSLTPLHVACLNGNFETVQFLTSSTECNIEAEGIDQIRPLHLACQSGNVDIVRHLVIDKHCDVNAKGMNGLIPLHVACLNHNFETVQFLTSS-TECNIEAECDLKRRPLHSACQSGSVDIVRHLVIDKHCDIDAKGRDGLTPLHVACLNGNFETVQFLTSSTECNIEAKGINHIRPLHLACQSGNVDIVRHLVIDKHCDVNAKGMNGLIPLHVACLNHNFETVQFLTSSIECNMEAECDLKRRPLHSACQSGSVDIVRHLVINKHCDIDAKGRDGLTPLHVACLNGNFETVQLLTSSTECNIEAEDIGQIRPLHLACQSGHVDIVRHLVIDKHCDVNAKRRFDHTPLHYACEKGHFEIVKILTNYPQCNTEAENSLNDRPLHKACESGNVDIVRHLVIDKHCDVNAKGRN 658          

HSP 2 Score: 241.891 bits (616), Expect = 4.773e-64
Identity = 155/455 (34.07%), Postives = 246/455 (54.07%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDH-KCDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDD--SRPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAK-LLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLID-NHCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQ 1569
            +  L  LH +C NGN + V+FL    +C+IE       +P+H ACQ GN DIV++L I+  C +N        P+H AC+N +    + L S    NI+A  D   RP+H AC++G+VD+V+ L+  K C I+    +  T LH AC  GN + V+ L S   +C I     +  R +H AC S + +IV  ++I K C++N K    + PLH AC N N    Q L    +CN+  +   +  P+  A  SG ++I + L+I  +CDI+   R    P+H A   G  E   +L    +C+IE E I + RP+ +A  + +V+I+R L+I  HC++ +    +  P+H AC+KG  E+V++L +   CN    N    +P+H A E+G V+IV+ ++++   D N       TPL++A    +++  +VL  +  CNIE +   + RP+H AC+
Sbjct:  249 RDSLTPLHVACLNGNFETVQFLTSSTECNIEAEGIDQIRPLHLACQSGNVDIVRHLVIDKHCDVNAKGMNGLIPLHVACLNHNFETVQFLTSSTECNIEAECDLKRRPLHSACQSGSVDIVRHLVIDKHCDIDAKGRDGLTPLHVACLNGNFETVQFLTSS-TECNIEAKGINHIRPLHLACQSGNVDIVRHLVIDKHCDVNAKGMNGLIPLHVACLNHNFETVQFLTSSIECNMEAECDLKRRPLHSACQSGSVDIVRHLVINKHCDIDAKGRDGLTPLHVACLNGNFETVQLLTSSTECNIEAEDIGQIRPLHLACQSGHVDIVRHLVIDKHCDVNAKRRFDHTPLHYACEKGHFEIVKILTNYPQCNTEAENSLNDRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGSTPLHVACLIRNFETVEVLTSSTECNIEAERFDQIRPLHLACK 702          

HSP 3 Score: 226.868 bits (577), Expect = 7.372e-59
Identity = 154/477 (32.29%), Postives = 250/477 (52.41%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDH-KCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNI--KAPDDSRPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAK-LLITNNCDINCSTRTQERPIHFAS-TLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDN-GCNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTE 1629
            +  +G   LH +C NG+L  V++LI   +C+IE  D  G +P+HY    G+ +IV          + L +K        CM      A+ L    ++N+     +D R ++ AC++GNVD+V+ L+  K C +N   S  +T LH AC   N + V+ L S   +C I        R +H AC S + +IV  ++I K C+IN K  + + PLH AC NGN    Q L    +CN+  +  ++  P+  A  SG ++I + L+I  +CD+N        P+H A     F  V  +    +C+IE E  LKRRP+  A  + +V+I+R L+I  HC+I +   +   P+HVAC  G  E VQ L  +  CNI       ++P+H+A ++G V+IV+ ++++   D N        PL++A    +++  + L  +  CN+E +   K RP+H+ACQ+G  +I + L+++ HC ID +
Sbjct:   58 EEGTGSTPLHKACYNGSLSIVEYLISKPQCNIEAKDNKGNQPLHYGACQGHKEIV----------SILGKKVSEDGLSKCMTS----AKQLAEPDIMNLLNDHYEDRRSLNSACKSGNVDIVRHLVIDKHCDVNSKGSNGYTPLHVACLNHNFETVQFLTSS-TECNIEAEGIDQIRPLHLACQSGNVDIVRHLVIDKHCDINAKERDSLTPLHVACLNGNFETVQFLTSSTECNIEAEGIDQIRPLHLACQSGNVDIVRHLVIDKHCDVNAKGMNGLIPLHVACLNHNFETVQFLTSSTECNIEAECDLKRRPLHSACQSGSVDIVRHLVIDKHCDIDAKGRDGLTPLHVACLNGNFETVQFLTSSTECNIEAKGINHIRPLHLACQSGNVDIVRHLVIDKHCDVNAKGMNGLIPLHVACLNHNFETVQFLTSSIECNMEAECDLKRRPLHSACQSGSVDIVRHLVINKHCDIDAK 519          

HSP 4 Score: 184.496 bits (467), Expect = 1.447e-44
Identity = 112/318 (35.22%), Postives = 172/318 (54.09%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDH-KCDIECVDFHGYKPIHYACQGGNPDIVKYL-IESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDD--SRPIHYACRTGNVDLVKLLLASK-CAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAK-LLITNNCDINCSTRTQERPIHFASTL-GFTEVAHMLIDRQCDIECETILKRRPIFIA 1167
             + GL  LH +C NGN + V+FL    +C+IE    +  +P+H ACQ GN DIV++L I+  C +N        P+H AC+N +    + L S    N++A  D   RP+H AC++G+VD+V+ L+ +K C I+    +  T LH AC  GN + V+LL S   +C I        R +H AC S   +IV  ++I K C++N K   +  PLHYAC  G+  I ++L + P CN   +N+    P+  A  SG ++I + L+I  +CD+N   R    P+H A  +  F  V  +    +C+IE E   + RP+ +A
Sbjct:  384 GRDGLTPLHVACLNGNFETVQFLTSSTECNIEAKGINHIRPLHLACQSGNVDIVRHLVIDKHCDVNAKGMNGLIPLHVACLNHNFETVQFLTSSIECNMEAECDLKRRPLHSACQSGSVDIVRHLVINKHCDIDAKGRDGLTPLHVACLNGNFETVQLLTSS-TECNIEAEDIGQIRPLHLACQSGHVDIVRHLVIDKHCDVNAKRRFDHTPLHYACEKGHFEIVKILTNYPQCNTEAENSLNDRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGSTPLHVACLIRNFETVEVLTSSTECNIEAERFDQIRPLHLA 700          

HSP 5 Score: 171.785 bits (434), Expect = 2.108e-40
Identity = 133/468 (28.42%), Postives = 221/468 (47.22%), Query Frame = 1
Query:  466 ACMNGHLAVARILISRQL----------------------------------VNIKAPD-DSRPIHYACRTGNVDLVKLLLAS-KCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSA------------------NRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAK-LLITNNCDINCSTRTQERPIHFASTLG-FTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILR-LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDNVNYFSLINIYVYFVN 1683
            AC+  HL V   L  +                                    +N++     S P+H AC  G++ +V+ L++  +C I   D++    LHY   QG+ +IV +L     +  ++    SA                   R+++ AC S + +IV  ++I K C++N K      PLH AC N N    Q L    +CN+  +  ++  P+  A  SG ++I + L+I  +CDIN   R    P+H A   G F  V  +    +C+IE E I + RP+ +A  + NV+I+R L+I  HC++ +       P+HVAC     E VQ L  +  CNI    D   +P+H A ++G V+IV+ ++++   D +       TPL++A   G+++  + L  +  CNIE + I   RP+H ACQ+G  +I + L++D HC ++ +  N     LI ++V  +N
Sbjct:    2 ACIYNHLPVVEYLTGQPNCNINNNNERHPLLAATDKEHLEIVEHFIESTGCDINVREEGTGSTPLHKACYNGSLSIVEYLISKPQCNIEAKDNKGNQPLHYGACQGHKEIVSILGKKVSEDGLSKCMTSAKQLAEPDIMNLLNDHYEDRRSLNSACKSGNVDIVRHLVIDKHCDVNSKGSNGYTPLHVACLNHNFETVQFLTSSTECNIEAEGIDQIRPLHLACQSGNVDIVRHLVIDKHCDINAKERDSLTPLHVACLNGNFETVQFLTSSTECNIEAEGIDQIRPLHLACQSGNVDIVRHLVIDKHCDVNAKGMNGLIPLHVACLNHNFETVQFLTSSTECNIEAECDLKRRPLHSACQSGSVDIVRHLVIDKHCDIDAKGRDGLTPLHVACLNGNFETVQFLTSSTECNIEAKGINHIRPLHLACQSGNVDIVRHLVIDKHCDVNAKGMN----GLIPLHVACLN 465          
BLAST of SMED30013077 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 204.142 bits (518), Expect = 7.286e-53
Identity = 144/580 (24.83%), Postives = 256/580 (44.14%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAI---------------------------------NVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI---YVYFVNSFKQNN*NHLYL*ITIQNSKCIATEFNVSSHHSI*TKNY*KHFINQFDEIIRKNVISQT*C 1866
            +K GL  LHC  ++G+   V+ L+D    I     +G  P+H A QG + + V+ L++    ++ +       +H A   GH  VA++++ ++   N KA +   P+H AC+   V +++LLL    ++                                 N  +    TALH A + G  D+VR L+      K++   K    A+H A      EIV++L+ K    +        PLH A   G++  A LL++    +++    + F+P+  A   GQIE AKLL+      + + +T   P+H A+      VA +L+D              P+ IA+  N +EI   L+       +   +   P+H+A Q+G V++V LL+  + N+N  N   + P+H+A++  RV + ++LL HGA+ +       TPL++A   G+  +   L++N   I  ++   + P+H A Q G   I  +L+    S +    N N    I     Y+  V++ +          +T +N   +     VS  H +        F++  D+ ++ ++I Q  C
Sbjct:  272 TKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNG--AKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEH-GASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRG---------LTDEN---LTATPPVSEKHKLNVPETMNEFLDMSDDEVQPDLIGQDLC 836          

HSP 2 Score: 191.43 bits (485), Expect = 7.228e-49
Identity = 129/503 (25.65%), Postives = 233/503 (46.32%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR-----------------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI--DVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            +K G  ALH +   G  D V+ L+ +  ++     +G+ P++ A Q  + ++V++L+E G   +   E  F P+  A   GH  V  +L+   ++  V + A       DD++                             P+H A   GN+++  LLL    A++       T LH A ++GN ++V+LL+      KI+  TK     +H    S  E++VE+L+ +   I  K    + PLH A    +    QLL+  DVP   V+    +  + +  A + G  ++AK+++    + N        P+H A      +V  +L+     ++  T     PI +A+   +  I++ L  +  +  +TN   E  +H+A + G  +VV+ L+ N   ++         +HIAS  G+ EIV++LL+ GA  +   T   TPL+LA  +GH + + +L+++G ++   + K + P+H A + G  E A+LL+    + DT
Sbjct:   70 TKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRG--AKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVP---VDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDT 567          

HSP 3 Score: 180.259 bits (456), Expect = 2.305e-45
Identity = 106/468 (22.65%), Postives = 217/468 (46.37%), Query Frame = 1
Query:  244 SGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN--RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            SG   LH +   GN++    L++    ++ +  +   P+H A + GN ++VK L++ G  ++   +    P+H    +GH  V  +L+ R   +  K  +   P+H A +  +++ V+LLL     ++   ++  TALH A   G++ + +++V  K     N   K+ N    +H AC     +++E+L+     +    +  + P+H A   G++ I + L      + N  N    + +  A  +GQ ++ + L+ N   ++   +  +  +H AS LG  E+  +L+ +       T     P+ +A    + E   LL+ +  ++ +   +   P+HVA + G +E  +LL+      + A    + P+H+A+      +  +LL+HGA  +       TPL++A +K   ++   L++ G      + +   P+H A Q G  ++  LL+  + +++  N N
Sbjct:  208 SGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKA----NPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHH-GASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKN 670          

HSP 4 Score: 171.785 bits (434), Expect = 7.504e-43
Identity = 115/463 (24.84%), Postives = 206/463 (44.49%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +++ +  LH + K GN + VK L+D    I+     G  P+H   + G+  +V+ L++ G  +    +    P+H A    HL   ++L+   + V+    D    +H A   G+  + K+++  K   N      FT LH AC++    ++ LL+  K    +   T+S    IH A     E IV+ L       N  N      LH A   G   + + L+      V+ K  ++ + +  A   G+ EI +LL+      + +T +   P+H A   G  E A +L++    +   T     P+ +A+    +E  +LL+       +       P+HVA       V  LL+D+  + + A      P+HIA++  ++EI   LLE GA+TN +     +PL+LA ++G  D+  +L+    N+   +     P+H A Q     +A++L++    +D
Sbjct:  239 ARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLL--KHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQN-GAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVD 698          

HSP 5 Score: 136.732 bits (343), Expect = 5.518e-32
Identity = 101/461 (21.91%), Postives = 200/461 (43.38%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILIS----------------------------RQL------VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEIL--------IGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            A + GN +     +++G  +N   +   + +H A   GH+ V   L+                             R+L      VN ++ +   P++ A +  ++++V+ LL    + ++A  + FT L  A QQG+  +V LL+    + K+         A+H A   +  +   +L        +  K            PLH A   GN  +A LL++     V+     + +P+  A   G   + KLL+     I+  T+    P+H  +  G  +V  ML+DR   I  +T     P+ +A+  +++  ++LL+ +   +    ++    +HVA   G  +V ++++D   N N        P+HIA +  RV+++++LL+HGA    +     TP+++A   GH ++ K L  +G +    +++    +H A + G  ++ + L+ +   +D
Sbjct:   14 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLP------ALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNR-GAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVD 467          

HSP 6 Score: 120.168 bits (300), Expect = 5.962e-27
Identity = 73/301 (24.25%), Postives = 137/301 (45.51%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDS-----RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQC 1119
            + +K    ALH + + G  + V+ L+            GY P+H A + G+ +    L+E G  ++   +K F P+H A   G +  A++L+ ++     APD +      P+H A    N  +  LLL    + + A    +T LH A ++   +I   L+  +   + N  T+     +H A    S ++V +L+ K   +N  N   + PLH A       +A++L++     V+      ++P+  A + G +++   L+ N   IN  T++   P+H A+  G T + +ML+  + 
Sbjct:  468 IKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKR----AAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLL--EFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNH-GAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRA 761          

HSP 7 Score: 94.3597 bits (233), Expect = 4.872e-19
Identity = 62/282 (21.99%), Postives = 127/282 (45.04%), Query Frame = 1
Query:  904 IDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHC---------NINCANDKL----------------------------MKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +D+  CN N  NA     +  A   G +E+   L+     ++ +T+     +H AS  G T+V   L+    ++  ++     P+++A+  N++E++R L+ +  +     ++   P+ VA Q+G  +VV LL++N           +I    D                                P+HIA+  G + +  +LL  GA  + +     TPL++A ++G+ ++ K+L+D G  I+ ++     P+H   ++G  ++ ++L+D    I ++  N
Sbjct:   31 VDINICNQNGLNA-----LHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKN 307          

HSP 8 Score: 84.3445 bits (207), Expect = 6.847e-16
Identity = 61/263 (23.19%), Postives = 114/263 (43.35%), Query Frame = 1
Query:  961 LYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLE-------------------------------HGADTNC-ICTYAR-----TPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            L A  +G +E A   +    DIN   +     +H AS  G  EV   L+     ++  T      + IAS     +++R L+TN  N+ + +     P+++A Q+  +EVV+ L+++  + + A +    P+ +A + G  ++V +LLE                               H AD    + TY       TPL++A   G+ +V+ +L++ G  ++  +     P+H A + G   + +LL+D    ID +  +
Sbjct:   12 LRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKD 274          

HSP 9 Score: 60.8474 bits (146), Expect = 9.770e-9
Identity = 32/124 (25.81%), Postives = 61/124 (49.19%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILIS-RQLVNIKAPDDSRPIHYACRTGNVDLVKLL 600
            + +K+GL  LH + +   +   + L++H  +++     GY P+H AC  GN  +V +L+E+   +N   +  + P+H A   GH  +  +L+  R   N    + +  +  A R G + +V  L
Sbjct:  666 MGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 789          

HSP 10 Score: 53.9138 bits (128), Expect = 1.176e-6
Identity = 22/83 (26.51%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+HLA     + + ++L++HG+ ++   ++   P+H AC  GN+ ++  L+ N   I+ K  +  TPL      G+   ++ L
Sbjct:  674 PLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINML 756          

HSP 11 Score: 52.7582 bits (125), Expect = 2.311e-6
Identity = 25/83 (30.12%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+AC    + +++LL+ HG++L+    S   PIH A   G+ +++K L H+  + +  N    T L +    G  D V +L
Sbjct:  377 PLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYL 459          

HSP 12 Score: 51.9878 bits (123), Expect = 3.934e-6
Identity = 70/292 (23.97%), Postives = 117/292 (40.07%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANR---EIFHRVRHDDIVKFNELYDAHTLFVLEYDTG-LSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVN-RNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFN---LMMAIKDNDPFSVQYLL---AKFTFGANPRQCLSTALGIAMSL 3187
            P+H+A   GN+N+  LL++ G+ ++   R++  P+H A + GN +++K L+     I  K     TPL      G++  V  L    + +L   +      H     D +   +L   H + V +     L+ L VA      ++   I+D+  N         ALN F             LH + C  +        L+   + + V  +G T + +A   G+++  +++      PN         L MA +      V+YLL   AK    A   Q   TAL IA  L
Sbjct:  212 PLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPN-----AKALNGFTP-----------LHIA-CKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQ---TALHIASRL 483          
BLAST of SMED30013077 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 203.371 bits (516), Expect = 1.257e-52
Identity = 129/494 (26.11%), Postives = 225/494 (45.55%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAI---------------------------------NVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            +K GL  LHC  ++G+   V+ L+D    I     +G  P+H A QG + + V+ L++    ++ +       +H A   GH  VA++++ ++   N KA +   P+H AC+   V +++LLL    ++                                 N  +    TALH A + G  D+VR L+      K++   K    A+H A      EIV++L+ K    +        PLH A   G++  A LL++    +++    + F+P+  A   GQIE AKLL+      + + +T   P+H A+      VA +L+D              P+ IA+  N +EI   L+       +   +   P+H+A Q+G V++V LL+  + N+N  N   + P+H+A++  RV + ++LL HGA+ +       TPL++A   G+  +   L++N   I  ++   + P+H A Q G   I  +L+    S
Sbjct:  300 TKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNG--AKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEH-GASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRAS 790          

HSP 2 Score: 194.512 bits (493), Expect = 6.988e-50
Identity = 129/495 (26.06%), Postives = 233/495 (47.07%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI--DVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            +K G  ALH +   G  D V+ L+ +  ++     +G+ P++ A Q  + ++V++L+E G   +   E  F P+  A   GH  V  +L+   ++  V + A       DD++                     P+H A   GN+++  LLL    A++       T LH A ++GN ++V+LL+      KI+  TK     +H    S  E++VE+L+ +   I  K    + PLH A    +    QLL+  DVP   V+    +  + +  A + G  ++AK+++    + N        P+H A      +V  +L+     ++  T     PI +A+   +  I++ L  +  +  +TN   E  +H+A + G  +VV+ L+ N   ++         +HIAS  G+ EIV++LL+ GA  +   T   TPL+LA  +GH + + +L+++G ++   + K + P+H A + G  E A+LL+    + DT
Sbjct:  106 TKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLD--RGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVP---VDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDT 595          

HSP 3 Score: 184.496 bits (467), Expect = 9.222e-47
Identity = 108/472 (22.88%), Postives = 221/472 (46.82%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN--RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            ++SKSG   LH +   GN++    L++    ++ +  +   P+H A + GN ++VK L++ G  ++   +    P+H    +GH  V  +L+ R   +  K  +   P+H A +  +++ V+LLL     ++   ++  TALH A   G++ + +++V  K     N   K+ N    +H AC     +++E+L+     +    +  + P+H A   G++ I + L      + N  N    + +  A  +GQ ++ + L+ N   ++   +  +  +H AS LG  E+  +L+ +       T     P+ +A    + E   LL+ +  ++ +   +   P+HVA + G +E  +LL+      + A    + P+H+A+      +  +LL+HGA  +       TPL++A +K   ++   L++ G      + +   P+H A Q G  ++  LL+  + +++  N N
Sbjct:  232 VESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKA----NPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHH-GASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKN 698          

HSP 4 Score: 181.8 bits (460), Expect = 6.761e-46
Identity = 112/420 (26.67%), Postives = 191/420 (45.48%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID-VPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK   +  ++ L+ H   ++ V   G  PIH A   G+ +IVK L   G   N    +    +H A   G   V R L+     V+IKA DD   +H A R G  ++V+LLL      + A +  +T LH A ++G+ +   LL+  +    ++ ATK     +H A      E  ++L+ K+   +      + PLH A    N+ +A LL+D     +   KN   ++P+  A    Q+EI   L+    + N  TR    P+H A+  G  ++  +L+ +  ++         P+ +A+  + V +  +L+ +   + +       P+HVAC  G +++V  L++N   IN        P+H A++ G   I+ +LL+H A  N +     T L +A   G+  V   L
Sbjct:  402 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLL--EHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNG--YTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 817          

HSP 5 Score: 136.346 bits (342), Expect = 7.874e-32
Identity = 85/382 (22.25%), Postives = 177/382 (46.34%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEI-----------------------------AKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            A R GN++     L +   IN+ +     ALH A ++G+ ++V  L+  K+   ++ ATK  N A+H A ++   ++V  L+     +N ++     PL+ A    +  + + L++    + +    + F+P+  AL  G  ++                             A LL+ N+ + +  +++   P+H A+  G   VA +L++R   ++        P+ +A+   N  +++LL+     I +   +   P+H   + G  +VV++L+D    I       + P+H+A++   +  V++LL+H    + +     T L++A   GHY V+KV++D   N   +++  + P+H AC+    ++ +LL+    S+
Sbjct:   50 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELL--KLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEH-GASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASL 428          

HSP 6 Score: 135.576 bits (340), Expect = 1.070e-31
Identity = 104/466 (22.32%), Postives = 206/466 (44.21%), Query Frame = 1
Query:  241 KSGLNALHC-SCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            KS  NA +  + + GNL+     +    DI   + +G   +H A + G+ ++V  L++ G  ++   +K    +H A + G   V R L++    VN ++ +   P++ A +  ++++V+ LL    + ++A  + FT L  A QQG+  +V LL+    + K+                                        +  LH A    +   A LL+   D N + ++   F+P+  A + G I +A LL+     ++   R    P+H A+  G   +  +L+DR   I+ +T     P+   + + + +++ +L+     I S       P+H+A Q   +  VQLL+ +   ++   +  +  +H+A+  G  ++ K++++  A+ N       TPL++A +K    V ++L+ +G +++  +     PIH A   G   I + L     S +T N
Sbjct:   40 KSDSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKV---------------------------------------RLPALHIAARKDDTKSAALLLQN-DHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTN 465          

HSP 7 Score: 86.6557 bits (213), Expect = 1.107e-16
Identity = 58/231 (25.11%), Postives = 109/231 (47.19%), Query Frame = 1
Query:  934 KNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            K ++  +  L A  +G +E A   +    DIN   +     +H AS  G  EV   L+     ++  T      + IAS     +++R L+TN  N+ + +     P+++A Q+  +EVV+ L+++  + + A +    P+ +A + G  ++V +LLE     N      R P L++A  K     + +L+ N  N + +S   + P+H A   G   +A LL++   ++D
Sbjct:   39 KKSDSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVD 264          

HSP 8 Score: 60.8474 bits (146), Expect = 9.659e-9
Identity = 32/124 (25.81%), Postives = 61/124 (49.19%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILIS-RQLVNIKAPDDSRPIHYACRTGNVDLVKLL 600
            + +K+GL  LH + +   +   + L++H  +++     GY P+H AC  GN  +V +L+E+   +N   +  + P+H A   GH  +  +L+  R   N    + +  +  A R G + +V  L
Sbjct:  694 MGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 817          

HSP 9 Score: 53.9138 bits (128), Expect = 1.034e-6
Identity = 22/83 (26.51%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+HLA     + + ++L++HG+ ++   ++   P+H AC  GN+ ++  L+ N   I+ K  +  TPL      G+   ++ L
Sbjct:  702 PLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINML 784          

HSP 10 Score: 53.1434 bits (126), Expect = 2.051e-6
Identity = 25/83 (30.12%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+AC    + +++LL+ HG++L+    S   PIH A   G+ +++K L H+  + +  N    T L +    G  D V +L
Sbjct:  405 PLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYL 487          

HSP 11 Score: 52.373 bits (124), Expect = 3.237e-6
Identity = 70/292 (23.97%), Postives = 117/292 (40.07%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANR---EIFHRVRHDDIVKFNELYDAHTLFVLEYDTG-LSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVN-RNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFN---LMMAIKDNDPFSVQYLL---AKFTFGANPRQCLSTALGIAMSL 3187
            P+H+A   GN+N+  LL++ G+ ++   R++  P+H A + GN +++K L+     I  K     TPL      G++  V  L    + +L   +      H     D +   +L   H + V +     L+ L VA      ++   I+D+  N         ALN F             LH + C  +        L+   + + V  +G T + +A   G+++  +++      PN         L MA +      V+YLL   AK    A   Q   TAL IA  L
Sbjct:  240 PLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPN-----AKALNGFTP-----------LHIA-CKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQ---TALHIASRL 511          
BLAST of SMED30013077 vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 202.216 bits (513), Expect = 2.989e-52
Identity = 133/494 (26.92%), Postives = 235/494 (47.57%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI--DVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +K G  ALH +   G  D VK L+ +  ++     +G+ P++ A Q  + D+V+YL+++G   +   E  F P+  A   GH  V  +L+   ++  V + A       DD++                     P+H A   GN+++  LLL    A++       T LH A ++GN ++V+LL+  +   +I+  TK     +H    S  E++VE+L+ +   I  K    + PLH A    +    QLL+  +VP   V+    +  + +  A + G  ++AK+++    + N        P+H A      +V  +L+     I+  T     PI +A+   +  I+  L+ +  +  +TN   E  +H+A + G  EVV+ L+ N   ++  +     P+HI+S  G+ EI++ LL+HGA  +   T   TPL+LA  +GH DV+ +L+D G ++   + K + P+H A + G  E+A LL+      D
Sbjct:   51 TKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLL--ERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVP---VDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPD 539          

HSP 2 Score: 190.274 bits (482), Expect = 1.518e-48
Identity = 110/466 (23.61%), Postives = 224/466 (48.07%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            +K GL  LHC  ++G+   V+ L+D    I     +G  P+H A QG + + V+ L+     ++ +       +H A   GH  VA++++ ++   N KA +   P+H AC+   + +++LLL    +I        T +H A   G+ +IV  L++       N        A+H A  +   E+V+ L+     ++ K+ ++  PLH +   G   I Q L+    C  +      ++P+  A   G  ++A +L+     +  +T+    P+H A+  G  EVA++L+ ++   +        P+ +A+  +N ++  LL+    +  +       P+H+A +K  +E+   L++   + N    + + P+H+AS+ G V++V +L+   A  N       TPL+LA ++   +V++VL+++G  ++ ++   + P+H AC  G  ++   L+ +   ++ + 
Sbjct:  245 TKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASP--NTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACP-DSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKT 707          

HSP 3 Score: 185.267 bits (469), Expect = 4.978e-47
Identity = 123/503 (24.45%), Postives = 231/503 (45.92%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN--RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTE---------------------------------VAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            ++SKSG   LH +   GN++    L++    ++    +   P+H A + GN ++VK L+E G  ++   +    P+H    +GH  V  +L+ R   +  K  +   P+H A +  +++ V+LLL  +  ++   ++  TALH A   G++ + +++V  K     N   K+ N    +H AC     +++E+L+     I    +  + P+H A   G++ I   L++    + N  N    + +  A  +GQ E+ K L+ N   ++  ++  + P+H +S LG  E                                 VA +L+D+   +   T     P+ +A+    +E+  LL+       ++      P+HVA      +V  LL+D   + + A      P+HIA++  ++EI   LLE+GADTN I     +PL+LA+++G+ D+  +L+     I   +     P+H A Q     +A++LV+   ++D E 
Sbjct:  177 VESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKA----NPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNH-GASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPET 674          

HSP 4 Score: 172.555 bits (436), Expect = 4.542e-43
Identity = 111/466 (23.82%), Postives = 213/466 (45.71%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            ++GLNALH + K G+++ V  LI     ++     G   +H A   G  D+VK L+ +G  +N   +  F P++ A    HL                                D+V+ LL +  + ++A  + FT L  A QQG+  +V LL+    + K+         A+H A   +  +   +L+      + ++     PLH A   GN  +A LL++     V+ K   + +P+  A   G   + KLL+     I+  T+    P+H  +  G  +V  ML+DR   I  +T     P+ +A+  +++  ++LL+ +   +    ++    +HVA   G  +V ++++D   N N        P+HIA +  R++++++LL+HGA    +     TP+++A   GH ++   L+++G +    +++    +H A + G  E+ + LV +   +D ++ +
Sbjct:   19 QNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHL--------------------------------DVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLP------ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNR-GAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKD 445          

HSP 5 Score: 134.806 bits (338), Expect = 1.820e-31
Identity = 85/369 (23.04%), Postives = 172/369 (46.61%), Query Frame = 1
Query:  601 LASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEI-----------------------------AKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            L S   IN+ +     ALH A ++G+ ++V  L+  K+   ++ ATK  N A+H A ++   ++V+ L+     +N ++     PL+ A    +  + + L+D    + +    + F+P+  AL  G  ++                             A LL+ N+ + +  +++   P+H A+  G   VA +L++R   ++ +      P+ +AS   N  +++LL+     I +   +   P+H   + G  +VV++L+D    I       + P+H+A++   +  V++LL H    + +     T L++A   GHY V+KV++D   N   +++  + P+H AC+    ++ +LL+    SI
Sbjct:    8 LKSGVDINICNQNGLNALHLASKEGHVEVVTQLI--KMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDN-GSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASI 373          

HSP 6 Score: 82.8037 bits (203), Expect = 1.652e-15
Identity = 56/219 (25.57%), Postives = 104/219 (47.49%), Query Frame = 1
Query:  985 IEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +E A   + +  DIN   +     +H AS  G  EV   LI     ++  T      + IAS     ++++ L+TN  N+ + +     P+++A Q+  ++VV+ L+DN  + + A +    P+ +A + G  ++V +LLE     N      R P L++A  K     + +L+ N  N + +S   + P+H A   G   +A LL++   ++D +  N
Sbjct:    1 LEKALDYLKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARN 214          

HSP 7 Score: 53.1434 bits (126), Expect = 1.918e-6
Identity = 28/98 (28.57%), Postives = 49/98 (50.00%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVR 2650
            P+H+A   GN+N+  LL++ G+ ++   R++  P+H A + GN +++K L+     I  K     TPL      G++  V  L   LD    I  + +
Sbjct:  185 PLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEML---LDRGAPILSKTK 279          
BLAST of SMED30013077 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 198.364 bits (503), Expect = 6.791e-51
Identity = 131/503 (26.04%), Postives = 228/503 (45.33%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAI---------------------------------NVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVN 1644
            +K GL  LHC  ++G+   V+ L+D    I     +G  P+H A QG + + V+ L++    ++ +       +H A   GH  VA++++ ++   N KA +   P+H AC+   V +++LLL    ++                                 N  +    TALH A + G  D+VR L+      K++   K    A+H A      EIV++L+ K    +        PLH A   G++  A LL++    +++    + F+P+  A   GQIE AKLL+      + + +T   P+H A+      VA +L+D              P+ IA+  N +EI   L+       +   +   P+H+A Q+G V++V LL+  + N+N  N   + P+H+A++  RV + ++LL HGA+ +       TPL++A   G+  +   L++N   I  ++   + P+H A Q G   I  +L+    S +    N N
Sbjct:  252 TKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGA--KVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLE-HGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGN 751          

HSP 2 Score: 184.496 bits (467), Expect = 1.323e-46
Identity = 129/503 (25.65%), Postives = 233/503 (46.32%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR-----------------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI--DVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            +K G  ALH +   G  D V+ L+ +  ++     +G+ P++ A Q  + ++V++L+E G   +   E  F P+  A   GH  V  +L+   ++  V + A       DD++                             P+H A   GN+++  LLL    A++       T LH A ++GN ++V+LL+      KI+  TK     +H    S  E++VE+L+ +   I  K    + PLH A    +    QLL+  DVP   V+    +  + +  A + G  ++AK+++    + N        P+H A      +V  +L+     ++  T     PI +A+   +  I++ L  +  +  +TN   E  +H+A + G  +VV+ L+ N   ++         +HIAS  G+ EIV++LL+ GA  +   T   TPL+LA  +GH + + +L+++G ++   + K + P+H A + G  E A+LL+    + DT
Sbjct:   50 TKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGA--KIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVP---VDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDT 547          

HSP 3 Score: 175.252 bits (443), Expect = 1.070e-43
Identity = 106/470 (22.55%), Postives = 218/470 (46.38%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN--RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            + SG   LH +   GN++    L++    ++ +  +   P+H A + GN ++VK L++ G  ++   +    P+H    +GH  V  +L+ R   +  K  +   P+H A +  +++ V+LLL     ++   ++  TALH A   G++ + +++V  K     N   K+ N    +H AC     +++E+L+     +    +  + P+H A   G++ I + L      + N  N    + +  A  +GQ ++ + L+ N   ++   +  +  +H AS LG  E+  +L+ +       T     P+ +A    + E   LL+ +  ++ +   +   P+HVA + G +E  +LL+      + A    + P+H+A+      +  +LL+HGA  +       TPL++A +K   ++   L++ G      + +   P+H A Q G  ++  LL+  + +++  N N
Sbjct:  186 THSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKA----NPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTH-HGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKN 650          

HSP 4 Score: 174.481 bits (441), Expect = 1.759e-43
Identity = 112/421 (26.60%), Postives = 191/421 (45.37%), Query Frame = 1
Query:  244 SGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            +G   LH +CK   +  ++ L+ H   ++ V   G  PIH A   G+ +IVK L   G   N    +    +H A   G   V R L+     V+IKA DD   +H A R G  ++V+LLL      + A +  +T LH A ++G+ +   LL+       ++ ATK     +H A      E  ++L+ K+   +      + PLH A    N+ +A LL+D     +   KN   ++P+  A    Q+EI   L+    + N  TR    P+H A+  G  ++  +L+ +  ++         P+ +A+  + V +  +L+ +   + +       P+HVAC  G +++V  L++N   IN        P+H A++ G   I+ +LL+H A  N +     T L +A   G+  V   L
Sbjct:  353 NGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGAS--LSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNG--YTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 769          

HSP 5 Score: 130.183 bits (326), Expect = 7.173e-30
Identity = 88/375 (23.47%), Postives = 170/375 (45.33%), Query Frame = 1
Query:  520 VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITN--NCDINCSTRTQER------PIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            +NI   +    +H A + G+V++V  LL    +++ A  +  TALH A   G  D+VR LV+      +N  +++    ++ A      E+V  L+      +   ++   PL  A   G+  +  LL++      + K       +  A      + A LL+ N  N D+     T         P+H A+  G   VA +L++R   ++        P+ +A+   N  +++LL+     I +   +   P+H   + G  +VV++L+D    I       + P+H+A++   +  V++LL+H    + +     T L++A   GHY V+KV++D   N   +++  + P+H AC+    ++ +LL+    S+
Sbjct:   13 INICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGAN--VNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASL 380          

HSP 6 Score: 114.775 bits (286), Expect = 3.316e-25
Identity = 73/300 (24.33%), Postives = 137/300 (45.67%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDS-----RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQ 1116
            + +K    ALH + + G  + V+ L+            GY P+H A + G+ +    L+E G  ++   +K F P+H A   G +  A++L+ ++     APD +      P+H A    N  +  LLL    + + A    +T LH A ++   +I   L+  +   + N  T+     +H A    S ++V +L+ K   +N  N   + PLH A       +A++L++     V+      ++P+  A + G +++   L+ N   IN  T++   P+H A+  G T + +ML+  +
Sbjct:  448 IKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKR----AAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLL--EFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLN-HGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHR 740          

HSP 7 Score: 93.5893 bits (231), Expect = 1.056e-18
Identity = 69/313 (22.04%), Postives = 132/313 (42.17%), Query Frame = 1
Query:  709 KVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIK--------STNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            K    IN   ++   A+H A      E+V  L+     ++    +    LH A   G   + + L+     NVN ++   F+P+  A     +E+ + L+ +    + +T     P+  A   G  +V  +L++     + +  ++   + IA+  ++ +   LL+ N  N          +       P+H+A   G + V  LL++    ++      + P+H+A++ G   +VK+LL+ GA  +       TPL+     GH  V ++L+D G  I  ++     P+H A Q       QLL+     +D
Sbjct:    8 KTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELV-TNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVD 315          

HSP 8 Score: 93.2041 bits (230), Expect = 1.349e-18
Identity = 62/282 (21.99%), Postives = 127/282 (45.04%), Query Frame = 1
Query:  904 IDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHC---------NINCANDKL----------------------------MKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +D+  CN N  NA     +  A   G +E+   L+     ++ +T+     +H AS  G T+V   L+    ++  ++     P+++A+  N++E++R L+ +  +     ++   P+ VA Q+G  +VV LL++N           +I    D                                P+HIA+  G + +  +LL  GA  + +     TPL++A ++G+ ++ K+L+D G  I+ ++     P+H   ++G  ++ ++L+D    I ++  N
Sbjct:   11 VDINICNQNGLNA-----LHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKN 287          

HSP 9 Score: 60.4622 bits (145), Expect = 1.294e-8
Identity = 32/124 (25.81%), Postives = 61/124 (49.19%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILIS-RQLVNIKAPDDSRPIHYACRTGNVDLVKLL 600
            + +K+GL  LH + +   +   + L++H  +++     GY P+H AC  GN  +V +L+E+   +N   +  + P+H A   GH  +  +L+  R   N    + +  +  A R G + +V  L
Sbjct:  646 MGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 769          

HSP 10 Score: 53.9138 bits (128), Expect = 1.108e-6
Identity = 22/83 (26.51%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+HLA     + + ++L++HG+ ++   ++   P+H AC  GN+ ++  L+ N   I+ K  +  TPL      G+   ++ L
Sbjct:  654 PLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINML 736          

HSP 11 Score: 53.1434 bits (126), Expect = 2.120e-6
Identity = 25/83 (30.12%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+AC    + +++LL+ HG++L+    S   PIH A   G+ +++K L H+  + +  N    T L +    G  D V +L
Sbjct:  357 PLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYL 439          

HSP 12 Score: 52.373 bits (124), Expect = 3.231e-6
Identity = 70/292 (23.97%), Postives = 117/292 (40.07%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANR---EIFHRVRHDDIVKFNELYDAHTLFVLEYDTG-LSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVN-RNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFN---LMMAIKDNDPFSVQYLL---AKFTFGANPRQCLSTALGIAMSL 3187
            P+H+A   GN+N+  LL++ G+ ++   R++  P+H A + GN +++K L+     I  K     TPL      G++  V  L    + +L   +      H     D +   +L   H + V +     L+ L VA      ++   I+D+  N         ALN F             LH + C  +        L+   + + V  +G T + +A   G+++  +++      PN         L MA +      V+YLL   AK    A   Q   TAL IA  L
Sbjct:  192 PLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPN-----AKALNGFTP-----------LHIA-CKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQ---TALHIASRL 463          
BLAST of SMED30013077 vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 196.823 bits (499), Expect = 8.674e-51
Identity = 114/466 (24.46%), Postives = 222/466 (47.64%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            SK+G   LH +    NL   + L++   ++     +G  P+H A + GN  +V+ L++ G  ++   +    P+H A  NGH+ V  IL+ +   +  K  +   PIH A +  ++D V+ LL     I+    +  T LH A   G+H + ++L+      K N    +    +H AC       +++L+     +    +  + PLH A   G+  I + L+     + N  N +  +P+  A  +G  E+A+ L+ N   ++   +  + P+H A+ +G  E+  +L++ + + +  T     P+ IA+   +    R+L+  +        +   P+HVAC+ G V+V +LL++   N N A    + P+H+A  +  +++VK+L+  G   +       TPL++A ++   +V+  L+  G N   +S++   P+H A Q G  ++  LL+    +++  N
Sbjct:  178 SKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKG--AKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQR-GASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGN 640          

HSP 2 Score: 192.586 bits (488), Expect = 1.818e-49
Identity = 121/425 (28.47%), Postives = 204/425 (48.00%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDC-NVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRR-----PIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK  ++  +  L+ H   +E V   G  P+H A   G+ +IVK L++ G   N    K   P+H A   GH  VA+ L+     V+ KA DD  P+H A R G+ +LVKLLL  K   + A +   T LH A ++G+    R+L+ G  Q      TK     +H AC     ++ E+L+ +    N      + PLH A  + N  + +LL+      +   +N   ++P+  A    Q+E+A  L+    + N  +     P+H A+  G  ++  +LI +Q ++     ++ +     P+ + +   +V I  +L+    ++ S +      +HVAC  G +++V+ L+    ++NC       P+H A++ G  +IV +LL+HGA  N I T   +PL +A   G+  V  VL
Sbjct:  346 GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQ--TKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNG--YTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 3 Score: 183.726 bits (465), Expect = 1.379e-46
Identity = 112/468 (23.93%), Postives = 224/468 (47.86%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNC-----ICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            +K  L  LHC+ +NG++  ++ L+D    I+    +G  PIH A QG + D V+ L++    ++ +      P+H A   GH  +A++L+ +    N +A +   P+H AC+  ++  + LLL    ++        T LH A   G+ +IV+ L+  +     N +       +H A  +   E+ + L+    +++ K  ++  PLH A   G+K + +LL++    N +       +P+  A   G     ++L+  N      T+    P+H A   G  +VA +L++R  +          P+ +A  +NN+++++LL++   +  ST      P+H+A ++  +EV   L+    N N  + + + P+H+A++ GR ++V +L+    + N          A TPL+L  ++GH  ++ +L+  G ++   S   +  +H AC  G  ++ + L+     ++
Sbjct:  244 TKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLL--QRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEH-KANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVN 708          

HSP 4 Score: 179.104 bits (453), Expect = 3.715e-45
Identity = 128/529 (24.20%), Postives = 229/529 (43.29%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLL--ASKCAI---------------------------NVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLI----------------------TNHCNI-----------KSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            ++GLN LH + K G++  V  L+ H  D+E     G   +H A   G   +V  L+  G  +N   +K F P++ A    HL V + L+      ++   D   P+  A + G+ ++V LL+   +K  +                           +V     FT LH A    N  + +LL++      +N   K+    +H A    +  +V +L+ +  +I+ +  +E+ PLH A  NG+  + ++L+D     +  K     SPI  A     ++  + L+  N +I+  T     P+H A+  G   +A +L+D+        +    P+ IA   N++  + LL+                        H NI            ++N + E P+H+A + G  EV Q L+ N   ++        P+H A+  G  E+VK+LLEH A+ +   T   TPL++A  +GH   +++L+D        + K + P+H AC+ G  ++A+LL++   + +    N
Sbjct:   18 QNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRG--ANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQ-GAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKN 543          

HSP 5 Score: 168.703 bits (426), Expect = 6.068e-42
Identity = 109/459 (23.75%), Postives = 206/459 (44.88%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR----QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQ-----PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            L  LH +   G+    K L+D          +G+ P+H AC+  +   +  L++    +  + E    P+H A   GHL + + L+ R       N+K      P+H A R G+ ++ + LL +   ++    +  T LH A + G+ ++V+LL+  K     + AT + +  +H A          IL+    +      +   PLH AC  G   +A+LL++    N N       +P+  A++   +++ KLL++     + + R    P+H A+     EVA  L+    +   E++    P+ +A+     +++ LLI+   N+   N    Q     P+H+  Q+G V +  +L+    ++  A+      +H+A   G +++VK LL+  A  NC      TPL+ A ++GH D+  +L+ +G      +     P+  A + G+  +  +L
Sbjct:  314 LTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKV---ETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANP--DSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLER-GANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 6 Score: 65.0846 bits (157), Expect = 4.481e-10
Identity = 31/89 (34.83%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARIL 504
            S+ G  ALH +C  GN+  VKFL+  +  + C    GY P+H A Q G+ DIV  L++ G + N +      P+  A   G+++V  +L
Sbjct:  678 SRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 7 Score: 56.9954 bits (136), Expect = 1.314e-7
Identity = 26/85 (30.59%), Postives = 42/85 (49.41%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            P+HL    G++ I  +LV  G+++    R     +H AC  GN+ ++K L+     ++CK     TPL      G+ D V+ L K
Sbjct:  651 PLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLK 735          

HSP 8 Score: 54.6842 bits (130), Expect = 7.265e-7
Identity = 60/260 (23.08%), Postives = 101/260 (38.85%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVL---DA----NREIFH---RVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLA-GTTFLELATIHGNDDFAQKIRERICFPN---ENPYFNLMMAIKDND 3094
            P+H+AC   ++  + LL+ H ++LE    S   P+H A   G+L+++K+L+    + +  N    TPL +    G+ +   FL + L   DA    ++   H   R+ H ++VK    + A+         G + L +A     +     +LD   N Q+ +  K       +                C       A   L    N N     G T L +A  H N D  + +  +   P+    N Y  L +A K N 
Sbjct:  349 PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSA--TTAGHTPLHIAAREGHAHTTRILLDG--NAQQTKMTKKGFTPLHVA---------------CKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQ 589          

HSP 9 Score: 53.9138 bits (128), Expect = 1.002e-6
Identity = 28/109 (25.69%), Postives = 54/109 (49.54%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYD 2686
            +H+AC  GN+ +VK L+   +++ C  R    P+H A + G+ D++  L+ +    +      ++PL + K  GY   +  L  V + +    HR+   + V  +E+ D
Sbjct:  685 LHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESMSAKHRMSFPETV--DEILD 791          

HSP 10 Score: 52.373 bits (124), Expect = 3.657e-6
Identity = 27/93 (29.03%), Postives = 49/93 (52.69%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREI 2635
            P+H+A   GN+ +V+LL+D G+ ++   +    P+H A  NG++ +I+ L+     I  K     +P+ +     + DCV    ++L  N EI
Sbjct:  217 PLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCV---RQLLQYNAEI 306          
BLAST of SMED30013077 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 228.024 bits (580), Expect = 1.157e-62
Identity = 141/510 (27.65%), Postives = 248/510 (48.63%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDS---------------------RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINIYVYF 1677
            +K G  ALH +   G  D V+ L++   +I     +G+ P++ A Q  + +IVK+L+++G   +   E  F P+  A   GH  V  +L+   ++  V + A       DD+                      P+H A   GN+++  LLL    A++       T LH A ++GN+++V+LL+      KI+  T+     +H A  S  E+++E+L+ +   I  K    + PLH A    + A  QLL+      V+    +  +P+  A + G   +AKLL+    + N        P+H A      +V  +L+     I   T     PI +AS   ++ +++LL+ N  +  +TN   E P+H+A + G +EVV+ L+ +   +     +   P+HIAS  G+ EIV++LL+ G+D N       TPLY A+ +GH DV+ +L++NG +I   + K + P+H A + G  E+A LL++ + S D +    N  + +++  ++
Sbjct:   74 TKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLD--RGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLG-RQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHY 580          

HSP 2 Score: 192.2 bits (487), Expect = 9.568e-51
Identity = 123/505 (24.36%), Postives = 226/505 (44.75%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECET-----------------------ILKR------------RPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVN 1644
            ++ GL  LHC+ ++G+   ++ L++    I     +G  P+H A QG +   V+ L+     ++ +      P+H A   GH  VA++L+ R    N +A +   P+H AC+   + +++LLL    +I+       T +H A   G+ ++V+LL+        N         +H A  +   E+V+ L+     +  K  E+  PLH A   G   I QLL+     + N   A   +P+ +A   G  ++A LL+ N  DI+  T+    P+H AS  G  EVA +L+++    + +                        +L +             P+ IA+  N +E+ ++L+           +   P+H+A Q+G  ++V LL+  H +I+ A    +  +H+A++  +V + +IL +H AD N       TPL++A+  G+  +   L+ N   +  ++   + P+H A Q G   +   L+    S +    N N
Sbjct:  268 TRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASS--NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQ-RGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGN 769          

HSP 3 Score: 174.481 bits (441), Expect = 5.233e-45
Identity = 111/422 (26.30%), Postives = 192/422 (45.50%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCK--NDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK   +  ++ L+ H   I      G  PIH A   G+ ++V+ L+++G   N    +   P+H A   G L V + L+ S   V +KA +D  P+H A R G  ++V+LLL      N   +   T L++A ++G+ D+  LL+       I+  TK     +H A      E+  +L+ K    + K      + PLH A    ++ +A LL+D     +   KN   ++P+  A    Q+E+ K+L+    + N  T+    P+H A+  G  ++  +L+ R   I   T      + +A+  + V +  +L  +  ++ +T      P+HVA   G +++V  L+ N   +N        P+H A++ G   +V  LL+H A  N +     T L +A   G+  V   L
Sbjct:  370 GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENG--ADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNG--YTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          

HSP 4 Score: 101.293 bits (251), Expect = 5.145e-22
Identity = 61/274 (22.26%), Postives = 129/274 (47.08%), Query Frame = 1
Query:  904 IDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHC-----------------------------NINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +D+  CN N  NA     +  A   G +++   L+    +I+ +T+     +H A+  G T++  +L++   +I  ++     P+++A+  N++EI++ L+ N  N     ++   P+ VA Q+G  +VV LL+++                               N +  +     P+HIA+  G + +  +LL  GA  +       TPL++A ++G+ ++ K+L+D G  I+ ++     P+H A ++G  ++ ++L++    I  +  N
Sbjct:   35 MDINTCNQNGLNA-----LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKN 303          

HSP 5 Score: 91.2781 bits (225), Expect = 6.874e-19
Identity = 61/257 (23.74%), Postives = 115/257 (44.75%), Query Frame = 1
Query:  952 SPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILL-------------------------------EHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            +  L A  +G +E     +    DIN   +     +H AS  G  +V   L+ R+ +I+  T +    + IA+     +I+R+L+    NI + +     P+++A Q+  +E+V+ L+DN  N + A +    P+ +A + G  ++V +LL                               EH AD      +  TPL++A   G+ +V+ +L++ G  ++  +     P+H A + G   + +LL+D    IDT+
Sbjct:   13 TSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGF--TPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTK 267          

HSP 6 Score: 56.6102 bits (135), Expect = 2.808e-8
Identity = 26/95 (27.37%), Postives = 45/95 (47.37%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQ 516
            L +K GL A+H + +   ++  + L  HK D+       Y P+H A   GN  +V +L+ +  ++N      + P+H A   GH  V   L+  +
Sbjct:  664 LATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHE 758          

HSP 7 Score: 54.6842 bits (130), Expect = 1.105e-7
Identity = 25/83 (30.12%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            PIH+A   G+LN+V+LL+ +G++    +   + P+H A   G L+++K L+ +   +  K     TPL +    G  + V  L
Sbjct:  406 PIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL 488          

HSP 8 Score: 52.373 bits (124), Expect = 6.209e-7
Identity = 27/101 (26.73%), Postives = 50/101 (49.50%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDD 2659
            P+H+AC    + +++LL+ HG+++     S   PIH A   G+L++++ L+ N  + +  N    TPL +    G  + V  L   L +   +  + R D 
Sbjct:  373 PLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTL---LQSGARVGVKAREDQ 470          

HSP 9 Score: 51.2174 bits (121), Expect = 1.491e-6
Identity = 23/85 (27.06%), Postives = 42/85 (49.41%), Query Frame = 2
Query: 2351 QKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            + P+H+A  +G L +VK L+  G+ +    R ++ P+H A   G  ++++ L+      +    + STPL      G+ D  S L
Sbjct:  437 ETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLL 521          

HSP 10 Score: 50.8322 bits (120), Expect = 1.529e-6
Identity = 26/83 (31.33%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+A   GN N+VKLL+D G+ ++   R    P+H A  +G+  +I+ L+  +  I  K     +PL +     +  CV  L
Sbjct:  241 PLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLL 323          

HSP 11 Score: 50.0618 bits (118), Expect = 3.150e-6
Identity = 24/83 (28.92%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+A   GN+N+  LL++ G+ ++   R+   P+H A + GN +++K L+     I  K     TPL      G++  +  L
Sbjct:  208 PLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEML 290          
BLAST of SMED30013077 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.868 bits (577), Expect = 5.446e-62
Identity = 139/505 (27.52%), Postives = 239/505 (47.33%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI--------------------------------------SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +K G  ALH +   G  D V+ L++   +I     +G+ P++ A Q  + +IVK+L+++G   +   E  F P+  A   GH  V  +L+                                      S+ ++N        P+H A   GN+++  LLL    A++       T LH A ++GN+++V+LL+      KI+  T+     +H A  S  E+++E+L+ +   I  K    + PLH A    + A  QLL+      V+    +  +P+  A + G   +AKLL+    + N        P+H A      +V  +L+     I   T     PI +AS   ++ +++LL+ N  +  +TN   E P+H+A + G +EVV+ L+ +   +     +   P+HIAS  G+ EIV++LL+ G+D N       TPLY A+ +GH DV+ +L++NG +I   + K + P+H A + G  E+A LL++ + S D +  N
Sbjct:   73 TKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLD--RGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGR-QAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKN 574          

HSP 2 Score: 210.305 bits (534), Expect = 2.140e-56
Identity = 119/465 (25.59%), Postives = 225/465 (48.39%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLV--SGKVQCK-INDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            ++SG   LH +   GN++    L++    ++    +G  P+H A + GN ++VK L++ G  ++        P+H A  +GH  V  +L+ R   +  K  +   P+H A +  ++  V+LLL  +  ++    +  T LH A   G++ + +LL+   G+   + +N  T      +H AC     +++E+L+     I+   +  + P+H A   G+  + QLL+     + N  N    +P+  A  +GQ+E+ K L+ +   +    R  + P+H AS LG  E+  +L+ R  D    T     P++ AS   + ++  LL+ N  +I     +   P+H+A + G +EV  LL++ + + +      + P+H+A+     ++  +LL+ GA  +       TPL++A +K   +V KVL++ G      + +   P+H A Q G  ++  LL+  H SI
Sbjct:  209 TESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTP-----LHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ-NGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASI 667          

HSP 3 Score: 205.682 bits (522), Expect = 6.428e-55
Identity = 130/464 (28.02%), Postives = 216/464 (46.55%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            +++G+  LH + K GN + VK L+D    I+     G  P+H A + G+  +++ L+E    +    +    P+H A    HLA  ++L+ RQ  V+    D   P+H A   G+  + KLLL      N      FT LH AC++    ++ LL+  K    I+  T+S    IH A       +V++L+      N  N     PLH A   G   + + L+      V  K  E+ +P+  A   G+ EI +LL+    D N  T +   P++FAS  G  +VA +L++   DI   T     P+ IAS    +E+  LL+  + +          P+HVA      +V  LL+D   + +        P+HIA++  ++E+ K+LLE GA+TN +      PL+LA ++GH D+  +L+    +I   +      +H A Q     +A++L      ++T
Sbjct:  242 ARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLL--KHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQ-SGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNT 702          

HSP 4 Score: 192.2 bits (487), Expect = 1.299e-50
Identity = 123/503 (24.45%), Postives = 226/503 (44.93%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECET---------------------ILKR------------RPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVN 1644
            ++ GL  LHC+ ++G+   ++ L++    I     +G  P+H A QG +   V+ L+     ++ +      P+H A   GH  VA++L+ R    N +A +   P+H AC+   + +++LLL    +I+       T +H A   G+ ++V+LL+        N         +H A  +   E+V+ L+     +  K  E+  PLH A   G   I QLL+     + N   A   +P+ +A   G  ++A LL+ N  DI+  T+    P+H AS  G  EVA +L+++    + +                      +L +             P+ IA+  N +E+ ++L+           +   P+H+A Q+G  ++V LL+  H +I+ A    +  +H+A++  +V + +IL +H AD N       TPL++A+  G+  +   L+ N   +  ++   + P+H A Q G   +   L+    S +    N N
Sbjct:  275 TRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASS--NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQR-GSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGN 774          

HSP 5 Score: 179.489 bits (454), Expect = 1.986e-46
Identity = 111/420 (26.43%), Postives = 192/420 (45.71%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI-SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK   +  ++ L+ H   I      G  PIH A   G+ ++V+ L+++G   N    +   P+H A   G L V + L+ S   V +KA +D  P+H A R G  ++V+LLL      N   +   T L++A ++G+ D+  LL+       I+  TK     +H A      E+  +L+ K    + K    + PLH A    ++ +A LL+D     +   KN   ++P+  A    Q+E+ K+L+    + N  T+    P+H A+  G  ++  +L+ R   I   T      + +A+  + V +  +L  +  ++ +T      P+HVA   G +++V  L+ N   +N        P+H A++ G   +V  LL+H A  N +     T L +A   G+  V   L
Sbjct:  377 GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENG--ADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNG--YTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          

HSP 6 Score: 98.9821 bits (245), Expect = 2.897e-21
Identity = 61/282 (21.63%), Postives = 129/282 (45.74%), Query Frame = 1
Query:  904 IDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCN-------------------------------------INCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +D+  CN N  NA     +  A   G +++   L+    +I+ +T+     +H A+  G T++  +L++   +I  ++     P+++A+  N++EI++ L+ N  N     ++   P+ VA Q+G  +VV LL+++                                        +N   +    P+HIA+  G + +  +LL  GA  +       TPL++A ++G+ ++ K+L+D G  I+ ++     P+H A ++G  ++ ++L++    I  +  N
Sbjct:   34 MDINTCNQNGLNA-----LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKN 310          

HSP 7 Score: 88.9669 bits (219), Expect = 3.377e-18
Identity = 62/263 (23.57%), Postives = 115/263 (43.73%), Query Frame = 1
Query:  952 SPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILL-------------------------------EHGADT------NCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE 1629
            +  L A  +G +E     +    DIN   +     +H AS  G  +V   L+ R+ +I+  T +    + IA+     +I+R+L+    NI + +     P+++A Q+  +E+V+ L+DN  N + A +    P+ +A + G  ++V +LL                               EH AD       N       TPL++A   G+ +V+ +L++ G  ++  +     P+H A + G   + +LL+D    IDT+
Sbjct:   12 TSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTK 274          

HSP 8 Score: 56.6102 bits (135), Expect = 2.899e-8
Identity = 26/95 (27.37%), Postives = 45/95 (47.37%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQ 516
            L +K GL A+H + +   ++  + L  HK D+       Y P+H A   GN  +V +L+ +  ++N      + P+H A   GH  V   L+  +
Sbjct:  669 LATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHE 763          

HSP 9 Score: 54.6842 bits (130), Expect = 1.029e-7
Identity = 25/83 (30.12%), Postives = 44/83 (53.01%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            PIH+A   G+LN+V+LL+ +G++    +   + P+H A   G L+++K L+ +   +  K     TPL +    G  + V  L
Sbjct:  413 PIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL 495          

HSP 10 Score: 52.373 bits (124), Expect = 6.284e-7
Identity = 27/101 (26.73%), Postives = 50/101 (49.50%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDD 2659
            P+H+AC    + +++LL+ HG+++     S   PIH A   G+L++++ L+ N  + +  N    TPL +    G  + V  L   L +   +  + R D 
Sbjct:  380 PLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTL---LQSGARVGVKAREDQ 477          

HSP 11 Score: 51.2174 bits (121), Expect = 1.261e-6
Identity = 23/85 (27.06%), Postives = 42/85 (49.41%), Query Frame = 2
Query: 2351 QKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            + P+H+A  +G L +VK L+  G+ +    R ++ P+H A   G  ++++ L+      +    + STPL      G+ D  S L
Sbjct:  444 ETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLL 528          

HSP 12 Score: 51.2174 bits (121), Expect = 1.408e-6
Identity = 26/83 (31.33%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+A   GN N+VKLL+D G+ ++   R    P+H A  +G+  +I+ L+  +  I  K     +PL +     +  CV  L
Sbjct:  248 PLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLL 330          

HSP 13 Score: 50.0618 bits (118), Expect = 2.899e-6
Identity = 24/83 (28.92%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+A   GN+N+  LL++ G+ ++   R+   P+H A + GN +++K L+     I  K     TPL      G++  +  L
Sbjct:  215 PLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEML 297          
BLAST of SMED30013077 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.66 bits (483), Expect = 1.763e-49
Identity = 127/522 (24.33%), Postives = 232/522 (44.44%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID---VPDC---------NVNCKNAEE--------------------FSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI-----YVYFVNSFK 1692
            + GL  LHC+ ++G+   V+ L++    I     +G  P+H A QG + + V+ L++    ++ +       +H A   GH   A++L+ +    N++A +   P+H AC+   + +++LLL    +I        T +H +   GN +IV +L+ G      N        A+H A  +   E+V  L+    +++ K  EE  PLH A   G   I QLL+     PD          +V  +   E                    F+P+  A   G++E+A LL+      + + +    P+H AS     +VA +L+D+             P+ IA+  + +EI   L+       +   +   P+H+  Q+G  +V  LL+  + ++N A    + P+H+A++  +V + +IL++HGA  N       TPL +A   G+  +   L+ +G ++  ++   + P+H A Q G   I  LL+   C     +  VN  + + I     Y+  V++ K
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGG--ASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLK--CGARPNDVTVNGNTALAIARRLGYISVVDTLK 521          

HSP 2 Score: 48.521 bits (114), Expect = 9.597e-6
Identity = 23/86 (26.74%), Postives = 42/86 (48.84%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +Q P+H+A   G L IV+LL+ H ++ +    +   P+H A   G+ D+   L+ +  ++        TPL +   +G  +  S L
Sbjct:  204 EQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLL 289          
BLAST of SMED30013077 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.03 bits (458), Expect = 9.736e-47
Identity = 112/420 (26.67%), Postives = 194/420 (46.19%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK   +  ++ L+ +   IE V   G  P+H +   GN +IV  L++ G   N    +    +H A   G   V R L+     V+ KA ++  P+H A R G +++V+LLL    + + A S  +T LH A ++G+ D+  +L+       +   TK     +H A      E+  +L+ +    +      + PLH A    N+ +A LL+D     +   KN   ++P+  A    Q+EIA  L+    + N  TR    P+H  +  G  +VA +L+ R  D+   T     P+ +A+  + V +  +L+ +  ++ +T      P+ VAC  G +++V  L+ +  ++N        P+H A++ G   IV +LL+ GA  N +     T L +A   G+  V   L
Sbjct:   15 GFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVT--TKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNG--YTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 2 Score: 165.236 bits (417), Expect = 1.051e-41
Identity = 106/437 (24.26%), Postives = 202/437 (46.22%), Query Frame = 1
Query:  403 LIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLINI-----YVYFVNSFK 1692
            L++ G   N      F P+H AC    + V  +L+ +   +I+A  +S   P+H +   GN+++V +LL    + N  +    TALH A + G  ++VR L+    Q  ++   +     +H A      EIV++L+      +        PLH A   G++ +  +L++    ++     + F+P+  A   G++E+A LL+      + + +    P+H AS     +VA +L+D+             P+ IA+  + +EI   L+       +   +   P+H+  Q+G  +V  LL+  + ++N A    + P+H+A++  +V + +IL++HGA  N       TPL +A   G+  +   L+ +G ++  ++   + P+H A Q G   I  LL+   C     +  VN  + + I     Y+  V++ K
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLL-KYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQ--VDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLE-HGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLK--CGARPNDVTVNGNTALAIARRLGYISVVDTLK 431          

HSP 3 Score: 82.4185 bits (202), Expect = 4.141e-16
Identity = 51/178 (28.65%), Postives = 79/178 (44.38%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFA 768
            +K+G   LH + K   L+    L+++  +   +   G  P+H   Q G+ D+   L+     +N   +    P+H A     + VA IL+     VN        P+  AC  GN+ +V  LL     +N      +T LH A QQG+  IV LL+  K   + ND T + N A+  A
Sbjct:  243 AKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KCGARPNDVTVNGNTALAIA 418          

HSP 4 Score: 78.5666 bits (192), Expect = 5.496e-15
Identity = 59/220 (26.82%), Postives = 91/220 (41.36%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIA 894
             K+GL  LH +    N      L+D          +GY P+H A +    +I   L+E G   N +  +   P+H     GH  VA +L++R   VN        P+H A +   V++ ++L+     +N      +T L  AC  GN  +V  L+  +    +N  TK+    +H A       IV +L+  KC     ND           NGN A+A
Sbjct:  210 GKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLL--QHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KCGAR-PND--------VTVNGNTALA 416          

HSP 5 Score: 48.9062 bits (115), Expect = 8.135e-6
Identity = 23/86 (26.74%), Postives = 42/86 (48.84%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +Q P+H+A   G L IV+LL+ H ++ +    +   P+H A   G+ D+   L+ +  ++        TPL +   +G  +  S L
Sbjct:  114 EQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLL 199          
BLAST of SMED30013077 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.303 bits (399), Expect = 1.655e-39
Identity = 123/482 (25.52%), Postives = 207/482 (42.95%), Query Frame = 1
Query:  277 NGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVP------------------------------DC--NVNCKNAEEFSPILYALNSGQIEI-AKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVE-------------VVQLLIDNHC-----NINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNAC 1566
            NG+ D V+ LI  K ++  VD     P+H A   G  +I++ L+ SG  +N    K   P+H AC +   A  + L+     VN +  +   P+H A     V   + ++    + NV+D    TALH+A   G+ ++V  LV+      IN   K   RAIH+A      E+V++L+    ++ CK+ +   PLH A ++G   + +LL+D+                               DC  NVN  N   F+P+ +A  S    +  +LL+ N  D+N  ++  + P+H  +  G    +  LI    +I+CE      P+ IA+   +  ++  LITN  +          P+H+A   GF +             +V    + H       I+  ++     +H A+  G VE + +LL  GAD N    + RT L+ A    +      L+ +G  +  Q  ++  P+H A 
Sbjct:   16 NGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGAN--INAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAA 495          

HSP 2 Score: 142.124 bits (357), Expect = 1.763e-34
Identity = 128/515 (24.85%), Postives = 221/515 (42.91%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILIS-----------------RQLVNIKAPDD-SRP-IHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHD-IVRLLVSGKVQCKINDATKSANRAIHFACM----------------------------SESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDC-NVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIEC-ETILKRRPIFIASSNNNVEILRLLITNHCNIKSTN--DENEQ-PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLID----NGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD 1605
            + SK G + LH +  +G     + LI +  +I+C D  G  P+H A + G+  ++  LI +G            P+H A ++G     R L+S                      I  PD+  R  +H A   GNV+ + LLL++   +N  D  + TALHYA    N   +V L+ SG    ++N+  +     +H+A                              SE++  +E L+ K  +   ++ +   P+HYA   G++   +LL++ P     + K+    SP+  A   G     ++LI +  D++        P+  A+  G T+   +LI     +   E   +R  +  A++N +VE LRLL+ N  + ++ +  D NEQ P+ +A   G  +   LL+    +IN  ++K    +H  +  G  E V +LL+   D +      R PL++A   GH  +   L+     +G  I       + P+H AC NG     +LL++
Sbjct:  299 VQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASG---ARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLE 810          

HSP 3 Score: 121.324 bits (303), Expect = 4.390e-28
Identity = 84/325 (25.85%), Postives = 159/325 (48.92%), Query Frame = 1
Query:  673 GNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDV-SKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVN 1644
            G+ D VR L+  K +    D  K     +H A      EI+E+L+     +N K+++ + PLH AC + ++A  Q L+     +VN ++    +P+  A  +  ++ A+ +I      N S R     +H A+  G +E+ + L+ +  +I       RR I  A+   + E++++L+ +  +++  + +   P+H A   G + VV+LL+D   +I+  N      +H+A  NG+  +V  L++ GA+ N       TPL+ A    H  +  ++L++NG ++  QS     P+H    +G    +Q L+ +   ID E+ + N
Sbjct:   17 GDPDEVRSLIYKKEEVNAVDDEK--RTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLK-HSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGN 338          

HSP 4 Score: 120.168 bits (300), Expect = 8.703e-28
Identity = 112/494 (22.67%), Postives = 196/494 (39.68%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYA-----------------------------CMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAI--NVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCK-NDEEMFPLHYACTNGNKAIAQLLIDVPDCN--VNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLI----TNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLE-HGADT-NCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDS 1608
            G   LH +   GN++ +  L+    D+   D      +HYA    N   V  L+ SG  +N   E+   P+HYA                             C    + +  +L       I+      P+HYA   G+   ++LLL    A   +       + LH A   G+H  + +L+   V   + +   +    +  A +    + V +LI     +  K   +    LH A TNG+    +LL++  D N  V+  +A E +P++ A+ +G  + A LL++    IN         +H  +  G  E   +L+ R  D+       R P+ +A++  ++ IL  L+     +   I  T+     P+H AC  G    V+LL++              P+H A  N      ++L++  GA   NC     R PL+ A    H +  ++L+ +   +    +    P+  AC+NG     ++LV+S
Sbjct:  421 GRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREG--NGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDV-FQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNS 911          

HSP 5 Score: 115.931 bits (289), Expect = 2.023e-26
Identity = 120/506 (23.72%), Postives = 218/506 (43.08%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAV-ARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAI------HFACMS-------------ESEEIV-----EILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFA-------STLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEI-LRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNI--NCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWR-PIHNACQNGFCEIAQLLV---DSHCSIDTENDN 1638
            K G + LH +  +G +  VK L+D   DI+  +  G   +H AC  G   +V  LI+ G  +N   E+ F P+H+A  + H A+   +L++    VN+++ D   P+H     G     + L+ +   I+  D +  T LH A + G+  ++  L        I +   +A R I      H A +S             +   IV     E ++    EI+  ++     LH A + GN     LL+     ++N K+  E + + YA  +  ++    L+ +   +N     +  P+H+A       ST+ F+                TI  +  I + S+ +  +I L  L+    +    + +   P+H A   G    ++LL++       +  +   + P+H+A+ +G    +++L+    D +       TPL LA  +GH D  +VLI +G ++  +     R  +H+A  NG  E  +LLV   DS+ ++D  + N
Sbjct:  202 KKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTL--------ITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLST-GADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVY-------------NTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDAN 685          

HSP 6 Score: 108.997 bits (271), Expect = 2.415e-24
Identity = 98/412 (23.79%), Postives = 174/412 (42.23%), Query Frame = 1
Query:  235 DSKSG--LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFH--PIHYACMNGHLAVARILI----SRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFAC--MSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCD--INCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLI-TNHCNIK------------------------------------STNDENEQPIHVACQKGFVEVVQLLIDNHCNI 1323
            D KSG  ++ LH +  +G+   ++ LI    D++  + +GY P+  A   G+ D V+ LI+ G  +  L+E       +H A  NGH+   R+L+    S + V+    ++  P+  A   G+ D   LLL+   +IN  D++  TALH     G+ + V LL+   V   + +    A   +  AC  M     +V+  +     I   +     PLH+AC NG+    +LL+++        NA  FSP+  A+ +     A++LI       INC       P+H A+     E   +L+     +    +  + P+ +A  N     + +L+ +   ++K                                    +TN   + P+H+A + G   VVQ+L++   +I
Sbjct:  577 DGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASV-LLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGNA--FSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASI 985          

HSP 7 Score: 107.457 bits (267), Expect = 7.261e-24
Identity = 106/511 (20.74%), Postives = 216/511 (42.27%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDD--SRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDI-VRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLL------------------ITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQ------------------KGFVEV----------VQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEH-GA-DTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            ++G  ALH +  NG+ + V FL+    +I   D    + IH+A   G+ ++VK L+  G  +    +K + P+H A  +G + V ++L+    V+I  P+   +  +H AC  G   +V  L+     +N A+   FT LH+A    +  + + LLV+      +N  +K     +H   +       + LI    EI+C++ +   PLH A   G++ +   LI     +   +      P+  A  SG  +  + L                  ++   +I+         +H A++ G  E  ++L+    D+  +   +R  +  A++N NV+ +  L+ +   +   ++    P+H A                    + +++V          ++ L+    +    + +   P+H A+  G    +++LLE  GA  ++    +  +PL+LA   GH+   +VLI +  +++ +    + P+  A   G  +  ++L+    S+
Sbjct:  136 RAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLG-VDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGAD--VNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLI-TNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASV 642          

HSP 8 Score: 67.781 bits (164), Expect = 1.350e-11
Identity = 46/183 (25.14%), Postives = 76/183 (41.53%), Query Frame = 1
Query: 1153 PIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATE---------------------------------KGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLV 1602
            P+  A  N + + +R LI     + + +DE   P+H A   G  E+++LL+ +   +N  ++K + P+H A  +     V+ LL+H AD N      +TPL++A                                    GH ++   L+  G NI     K  R IH A   G  E+ ++LV
Sbjct:    9 PLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLV 191          
BLAST of SMED30013077 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 74.7146 bits (182), Expect = 2.246e-15
Identity = 49/191 (25.65%), Postives = 91/191 (47.64%), Query Frame = 1
Query:  451 HPIHYACM-NGHLAVARILISRQLVNIKAPDDSR-PIHYACRTGNVDLVKLLLASKCAINV---ADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLI 1008
            +P+H ACM N    V  +L S+  + ++   D R P+H++      ++   LL+    +N+    D   +T  H AC  GN ++V+ L    ++  +N  T      +H A   +  E+ + LI     +  K+     PLH A + G+  + +LL  +    VN ++ + ++P+ +AL  G  + A LL+
Sbjct:    4 YPLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLV 194          

HSP 2 Score: 54.299 bits (129), Expect = 2.060e-8
Identity = 45/161 (27.95%), Postives = 73/161 (45.34%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDF---HGYKPIHYACQGGNPDIVKYLIESGCM--MNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLA-SKCAINVADSEKFTALHYACQQGNHDIVRLLV 702
            + G   LH S      +   FL+    ++   D+    G+ P H AC  GN ++VK L +      +N +  +    +H A       V++ LI     V IK   +  P+H A   G++ L++LL    K A+N  D + +T L +A  +G+ D   LLV
Sbjct:   34 QDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLV 194          

HSP 3 Score: 51.2174 bits (121), Expect = 1.930e-7
Identity = 36/121 (29.75%), Postives = 57/121 (47.11%), Query Frame = 1
Query: 1252 PIHVACQKGFVEVVQLLIDNHCNINC---ANDKLMKPIHIASENGRVEIVKILLEH--GADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            P+H +      E+   L+    N+N     +D    P HIA   G +E+VK L +     D N I     T L+LA  K  ++VS+ LI+NG ++  +      P+H A   G  ++ +LL
Sbjct:   39 PLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELL 159          

HSP 4 Score: 51.2174 bits (121), Expect = 2.097e-7
Identity = 41/161 (25.47%), Postives = 74/161 (45.96%), Query Frame = 1
Query: 1147 RRPIFIASSNNNVEILRLLITNHCNIK---STNDENEQPIHVACQKGFVEVVQLLIDNHC--NINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQLLVDSH 1611
            R P+  + S    EI   L++   N+      +D    P H+AC  G +EVV+ L D     ++N   ++ +  +H+A      E+ + L+E+GA       + + PL+ A   G   + ++L   G   +  Q  + W P+ +A   G  + A LLV+ +
Sbjct:   37 RIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKY 197          
BLAST of SMED30013077 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 63.929 bits (154), Expect = 8.795e-11
Identity = 42/164 (25.61%), Postives = 77/164 (46.95%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDI--ECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGH----LAVARILISRQLVNI--KAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLV 702
            DS   +  LH +  N  L  V FL+    D+       H   P+H+A + G   IV +L++ G       ++ F+ +H +  + +    L V   ++S+ L++I  + P     + +A   G+   V  LL    +I +AD+E FT LH+   +G   +++ L+
Sbjct:  105 DSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHA-TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLI 267          

HSP 2 Score: 52.373 bits (124), Expect = 3.631e-7
Identity = 48/255 (18.82%), Postives = 109/255 (42.75%), Query Frame = 1
Query:  820 EINCKNDEEMFPL----HYACTNGNKAIAQLLI--DVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINC-STRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITN-----HCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGH-YDVSKVLIDNGCNIECQSIKKW 1545
            ++N  ++ E  PL    H AC  G+ A  + +I   + + N +  + E  + + +A  + ++ +   L++   D+N  +      P+H+A+  G+  +   L+    D           + ++ +++N+ ++  ++ N       +I   + +    +  A  +G    V  L+    +I  A+ +   P+H  +  G+  ++K L++ GAD        +    +A E    Y + + L  +G +     IKKW
Sbjct:   61 QVNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFDYHGYPIKKW 315          
BLAST of SMED30013077 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 60.077 bits (144), Expect = 1.990e-9
Identity = 35/98 (35.71%), Postives = 57/98 (58.16%), Query Frame = 1
Query: 1255 IHVACQKGFVEVVQLLIDNHC-NINCANDKLMKPIHIASENGRVEIVKILLEHGADTN--CICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIK 1539
            + +AC KG  +VV+ +I+    +IN  ++     +H A+  G +EIV++L+E+GAD N   I  +  TPL  A+  GH DV K L+ NG +   ++ K
Sbjct:  334 LQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAK 431          
BLAST of SMED30013077 vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 52.373 bits (124), Expect = 3.791e-7
Identity = 54/228 (23.68%), Postives = 94/228 (41.23%), Query Frame = 1
Query:  337 DFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQE------------KAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASK-CAINVADSEKF-TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQL------LIDVPDCNVNCKNAEEFSPI 960
            D +   P+HY+CQ G  ++ K +I+     N   E            ++  P+H   +  H     +L+     N+K    S  +H A    N  L+ +LL+SK   IN  D+E   T L+ AC+    +    L+      +I +       AI  A      +IV++LI      + +++    P+ +A   G+  IA +      L+  P   +N   +EE  P+
Sbjct:  425 DNYKRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQSLDPNVKLKSSSL-LHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWT-AIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMVQIRDELVTHPHSQLNS-GSEEKEPL 649          
BLAST of SMED30013077 vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 51.6026 bits (122), Expect = 6.111e-7
Identity = 30/107 (28.04%), Postives = 55/107 (51.40%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCM-MNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKA--PDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGN 678
            A + G+  +VK ++ESG + +N  +      +H+AC+N   +VA+ L+ R     +A  P  +  +H+A R GN+ +V LLL       + D +    +H++    N
Sbjct:   57 AAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSN 163          

HSP 2 Score: 49.2914 bits (116), Expect = 3.055e-6
Identity = 39/162 (24.07%), Postives = 76/162 (46.91%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDI-ECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-----VNIKAPDDS--RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIV-RLLVSG 708
            L+ LH +C N      KFL+    +  +     G   +H+A + GN  IV  L++ G       E+  + +H++  + ++ +   ++   +     V+I + D++   P+ +A   G+   V+LLL     +   D+  F ALH A   G+  ++  L++SG
Sbjct:   85 LSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSG 246          
BLAST of SMED30013077 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 108.612 bits (270), Expect = 1.089e-24
Identity = 106/417 (25.42%), Postives = 186/417 (44.60%), Query Frame = 1
Query:  454 PIHYACMNGHLAVARILISRQLVNIKAPDDSR--PIHYACRTGNVDLVKLLLAS----------KCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEI-VEILIGKKCEIN-CKNDE---EMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQ------CDIECETILKRRPIFIASSNNNVEILR----LLITNHCNIKSTNDENEQPIHVACQKGFVEVV-QLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            P+H AC +G + VA+ L+     ++++ D+ +  P+H+AC  GN+ + KLL  +             +   D E+ TALH A + G+ D+ +L +       +N   +S N+  H   +   E I V I + K   ++ CK+++   E+    +        I   +I    C + C++ ++ +P++ A     ++  + L+ +  DI          +  A+  G  E     ++ Q      CD  C   L      +  SN  + +LR    LL+ N   I S NDE+  PIH A + G V  V  LL  +   IN  +     P+H+A+ +G   +VK LL  G   +       TPL  A  +G  +V+ +L+D    ++     K  P+H A + G  E+ +LL+    +I
Sbjct:    7 PLHVACSHGCIPVAKCLVEAG-ADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGAN--VNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVV----IIICYIIRFRAC-IECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGL------VGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANI 409          

HSP 2 Score: 105.145 bits (261), Expect = 1.549e-23
Identity = 100/433 (23.09%), Postives = 177/433 (40.88%), Query Frame = 1
Query:  355 PIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILIS-----------RQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI----DVPDCNVNCKNA-----------------EEFSPI--------LYALNSGQIEI-------AKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQ-CDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDN 1509
            P+H AC  G   + K L+E+G  +  L E+   P+H+ACM G+L VA++L              ++V  +  ++   +H A   G+ DL KL L     +N     K    H         I  ++   K++      ++   R I          I  I+  + C I C++ ++  PL  A    +    + L+    D+   ++N +N+                 E   P+        L  L  G  ++       ++LL+ N   I+        PIH+A+  G       L+ R    I  E      P+ +A+ + +  +++ L+     I + N     P+  A  +G VEV  +L+D    ++  +     P+H+AS  G VE+VK+LL   A+     +  R  L +A E  H +V+  +ID+
Sbjct:    7 PLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRAC-IECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          

HSP 3 Score: 96.2857 bits (238), Expect = 1.030e-20
Identity = 94/377 (24.93%), Postives = 155/377 (41.11%), Query Frame = 1
Query:  739 KSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCN---------VNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIH-----------------------FAST--------LGFTEVA----HMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNI--KSTNDEN--------------------EQPIHVACQK----GFVE-----------VVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHG-ADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            K+    +H AC      + + L+    ++   ++E+M PLH+AC  GN  +A+LL    +           V  ++ EE + +  A+  G  ++AKL +    ++N    ++ +  H                       F  +        L F +V     +++  R C IEC    K  P+ IA+  N+V+ +R L+ +  +I  K  ND N                    ++P+   C      G V              QLL+DN   I+  ND+ + PIH A++ GRV  V  LL+   A  N     + TPL+LA   GH  V K L+  G  I+ ++   W P+  A   G  E+A +L+D    +D
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRAC-IECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVD 377          

HSP 4 Score: 90.5077 bits (223), Expect = 7.489e-19
Identity = 106/448 (23.66%), Postives = 179/448 (39.96%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYL-----IESGC-----MMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSR--------PIHYACRTGNVDLVKLLLASKCA----------------------------INVADSEKFTALHYACQQGNHDIVRLLV--SGKVQCK-INDATKSANRAIHFACMSESEEIVE--ILIGKKCEINCKNDEEMFPLHYACTNGNKAI------AQLLIDVPDCNVNCKNAEEFSPILYALNSGQIE-IAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEH 1410
            K+ +  LH +C +G +   K L++   D+  +D     P+H+AC  GN  + K L     +  G      M+     +    +H A   GH  +A++ + +   N+ A  +S+         +   C    + + KL   S C                             I   D +K T L  A ++ + D VR L+     +  K IND   S  RA    CM   E  +E    +   C+  C        L+      NK I      +QLL+D   C ++ KN E+ +PI YA   G++  +  LL  +   IN        P+H A+  G   V   L+ R   I+        P+  A++   VE+  +L+     +  T+     P+H+A ++G VE+V+LL+    NI   +      + IA E+   E+   +++H
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKG-ANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDIND-RNSVFRAAAEGCMETLEAALEHQKPVWTICDDVC--------LNGLVGGSNKLILVLRISSQLLLDNGAC-IDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          

HSP 5 Score: 49.6766 bits (117), Expect = 6.230e-6
Identity = 21/53 (39.62%), Postives = 32/53 (60.38%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKAL 2506
            +  P+H+ACS G + + K LV+ G++L   D     P+H+AC  GNL + K L
Sbjct:    4 QMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLL 56          
BLAST of SMED30013077 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 76.2554 bits (186), Expect = 6.060e-15
Identity = 56/230 (24.35%), Postives = 110/230 (47.83%), Query Frame = 1
Query:  748 NRAIHFACMSESEEIVEI--LIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQ-CDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNC 1428
            N  I F     S ++ E+  L+ K  +IN +N + +  LH AC + N  + ++L+D    +++ ++ E ++ +  A + G +EIAK LI N  D+       E P+  A      ++    I+ Q  D++    ++ + +   + +         +  +C  +S +      +HVA  KG+++V+ LL+     IN  +     P+H A+  G+ +  ++L E+GAD N 
Sbjct:   48 NSGIVFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVD-KGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQS--------WLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNA 268          

HSP 2 Score: 66.2402 bits (160), Expect = 1.185e-11
Identity = 49/178 (27.53%), Postives = 77/178 (43.26%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYA------------CMNGHLAV--ARILISRQLVN-------------IKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLL 699
            GL ALH +C + N D VK L+D    ++  D  G+  +H A   G+ +I KYLIE+G  +  +  +   P+  A              N  + V  AR +  + ++N              K   ++  +H A   G + ++ LLL     IN  D++ +T LH A   G  D   LL
Sbjct:   82 GLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELL 259          

HSP 3 Score: 65.0846 bits (157), Expect = 3.215e-11
Identity = 59/226 (26.11%), Postives = 97/226 (42.92%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID-VPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTN 1236
            A  +G+VD VK LLA    IN  + +  TALH AC   N D+V++LV       + D       ++H A    S EI + LI    ++   N+E   PL  A     + +  LL D + +  ++  +A      +  LN  Q  + K     NC      +T+   +H AS+ G+ +V  +L+    +I  +      P+  A+     +   LL  N  +  + N
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRD--NEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEE---EDMEDLLTDEIENQGIDVDDARAVEEKIM-LNDAQSWLNK-----NCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARN 270          

HSP 4 Score: 65.0846 bits (157), Expect = 3.275e-11
Identity = 50/217 (23.04%), Postives = 95/217 (43.78%), Query Frame = 1
Query:  958 ILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNH----------------------CNINCANDKLMK----PIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQ 1530
             L A++SG ++  K L+    DIN         +H A      ++  +L+D+   ++         +  A+S  +VEI + LI N  ++ + N+E E P+ +A ++   +++   I+N                        N NC N+   K     +H+AS  G ++++ +LL+ G + N       TPL+ A   G  D  ++L +NG +   +
Sbjct:   53 FLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNAR 269          

HSP 5 Score: 58.5362 bits (140), Expect = 4.808e-9
Identity = 51/208 (24.52%), Postives = 91/208 (43.75%), Query Frame = 1
Query:  490 VARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLV-SGKVQCKIND------------------ATKSANRAIHFACMSESEEIV-----EILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTR 1041
            V ++L     +N +  D    +H AC   N DLVK+L+    +++V D+E +T+LH A   G+ +I + L+ +G     +N+                    +  N+ I        EE +     +  + K C    K+  E   LH A + G   +  LL+ +    +N K+A+ ++P+  A + GQ +  +LL  N  D N   +
Sbjct:   65 VKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLG-VEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 6 Score: 49.2914 bits (116), Expect = 4.015e-6
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 1
Query: 1363 ASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            A  +G V+ VK LL  GAD N       T L+ A    ++D+ KVL+D G +++ +  + W  +H A   G  EIA+ L+++   +
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADV 141          
BLAST of SMED30013077 vs. Ensembl Nematostella
Match: EDO47820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL87])

HSP 1 Score: 73.559 bits (179), Expect = 4.095e-13
Identity = 72/296 (24.32%), Postives = 132/296 (44.59%), Query Frame = 1
Query:  661 ACQQGNHDIVRLLVSGKVQCKIN---DATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITN--NCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIH-VACQKG--FVEVVQLLI-DNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNI 1521
            A + G ++ V   +S      IN      K+ N A+  A      ++V +L+    +I   ND     L  A     +++  LLID  +     +       +L A   G ++I K L+++    D+NC+      P+             +L+ R  ++  E + +R    + S+ N +E+++ L+ +  +   +  E    +H +A  +G    ++  LLI +  CN +  +     PIH+AS+   V IV  L++ G D N      +TPL++A   GH  VS VL++NG ++
Sbjct:   47 AAKNGEYERVENFLSRTTTSPINVDFKDKKTGNTAMILAASQNHGKVVSLLLNYGADITLSNDAGQSVLDMAP----RSLIPLLIDSVE-----RQGTSSRHLLQAAWQGNVQILKRLLSSPKKVDVNCTNADGMTPL-------------LLVTRDINM-FEQVEQR----LDSAYNPIEVVQELLLHKADCSISGKEGRHALHQIATTRGPNAEKIASLLIKEGGCNPDILDGHRYSPIHLASKENNVPIVLALVDGGGDVNVRGCGGKTPLHIAASNGHQSVSGVLVENGADV 315          

HSP 2 Score: 50.447 bits (119), Expect = 4.716e-6
Identity = 29/96 (30.21%), Postives = 49/96 (51.04%), Query Frame = 1
Query:  232 LDSKSGLNALH--CSCKNGNLDYVKFLI--DHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI 507
            +  K G +ALH   + +  N + +  L+  +  C+ + +D H Y PIH A +  N  IV  L++ G  +N        P+H A  NGH +V+ +L+
Sbjct:  214 ISGKEGRHALHQIATTRGPNAEKIASLLIKEGGCNPDILDGHRYSPIHLASKENNVPIVLALVDGGGDVNVRGCGGKTPLHIAASNGHQSVSGVLV 309          
BLAST of SMED30013077 vs. Ensembl Nematostella
Match: EDO43381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU3])

HSP 1 Score: 73.559 bits (179), Expect = 4.248e-13
Identity = 51/147 (34.69%), Postives = 75/147 (51.02%), Query Frame = 1
Query:  256 ALHCSCKNGNLDYVKFLIDHKCDIECV-DFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIV 690
            ++H + K G+L  +K LI     ++ V D  G   +H A   G+ D VK+L  SG  +       +  IH A M GH+    IL +   +VN K  DD  P+H A  +G+++ VK LLA++      DS   TAL  A + G+ DIV
Sbjct:  904 SIHDAAKKGDLARIKELIGVAPAMKSVPDEKGMTALHIASSNGHLDCVKWLAVSGVDLGQETPTGYTAIHLAAMGGHVNCMMILSAMGSVVNCKTVDDQTPLHLAAMSGHLECVKWLLANRSRTEAEDSNGRTALDIAEEYGHEDIV 1050          

HSP 2 Score: 51.9878 bits (123), Expect = 1.443e-6
Identity = 37/129 (28.68%), Postives = 60/129 (46.51%), Query Frame = 1
Query: 1255 IHVACQKGFVEVVQLLIDNHCNINCAND-KLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            IH A +KG +  ++ LI     +    D K M  +HIAS NG ++ VK L   G D         T ++LA   GH +   +L   G  + C+++    P+H A  +G  E  + L+ +    + E+ N
Sbjct:  905 IHDAAKKGDLARIKELIGVAPAMKSVPDEKGMTALHIASSNGHLDCVKWLAVSGVDLGQETPTGYTAIHLAAMGGHVNCMMILSAMGSVVNCKTVDDQTPLHLAAMSGHLECVKWLLANRSRTEAEDSN 1033          

HSP 3 Score: 50.0618 bits (118), Expect = 5.454e-6
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  553 IHYACRTGNVDLVKLLLASKCAI-NVADSEKFTALHYACQQGNHDIVRLL-VSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNG 879
            IH A + G++  +K L+    A+ +V D +  TALH A   G+ D V+ L VSG     +   T +   AIH A M      + IL      +NCK  ++  PLH A  +G
Sbjct:  905 IHDAAKKGDLARIKELIGVAPAMKSVPDEKGMTALHIASSNGHLDCVKWLAVSG---VDLGQETPTGYTAIHLAAMGGHVNCMMILSAMGSVVNCKTVDDQTPLHLAAMSG 1012          
BLAST of SMED30013077 vs. Ensembl Nematostella
Match: EDO30889 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZG9])

HSP 1 Score: 65.855 bits (159), Expect = 7.007e-13
Identity = 29/97 (29.90%), Postives = 54/97 (55.67%), Query Frame = 1
Query: 1198 LLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDV 1488
            +L+    ++K+ +     P+H A   G  ++ +LLID   ++N  N +   P+H+++  G  E+ ++LL+ GAD   +   ARTP+ +A + G  DV
Sbjct:   13 VLVRRGADVKAVDHHGNTPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLDKGADPRLLDAQARTPMEMAIDSGRIDV 109          

HSP 2 Score: 53.5286 bits (127), Expect = 1.823e-8
Identity = 25/103 (24.27%), Postives = 57/103 (55.34%), Query Frame = 1
Query: 1093 AHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKIL 1401
            A +L+ R  D++        P+  A++    +I +LLI    ++ + N E++ P+H++ + G  EV QLL+D   +    + +   P+ +A ++GR+++++ +
Sbjct:   11 ADVLVRRGADVKAVDHHGNTPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLDKGADPRLLDAQARTPMEMAIDSGRIDVIEAI 113          

HSP 3 Score: 49.2914 bits (116), Expect = 4.757e-7
Identity = 28/103 (27.18%), Postives = 53/103 (51.46%), Query Frame = 1
Query:  304 LIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR----QLVNIKAPDDSRPIHYACRTGNVDLVKLL 600
            L+    D++ VD HG  P+H A   G  DI K LI+    +N L ++   P+H +   G   V ++L+ +    +L++ +A     P+  A  +G +D+++ +
Sbjct:   14 LVRRGADVKAVDHHGNTPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLDKGADPRLLDAQA---RTPMEMAIDSGRIDVIEAI 113          

HSP 4 Score: 48.1358 bits (113), Expect = 1.392e-6
Identity = 22/70 (31.43%), Postives = 39/70 (55.71%), Query Frame = 1
Query: 1396 ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD 1605
            +L+  GAD   +  +  TPL+ A   G  D++K+LID   ++   + +   P+H + + G  E+ QLL+D
Sbjct:   13 VLVRRGADVKAVDHHGNTPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLD 82          

HSP 5 Score: 47.7506 bits (112), Expect = 1.772e-6
Identity = 22/81 (27.16%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  952 SPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIL 1194
            +P+  A  +G+ +IAKLLI    D+N   +  + P+H ++ +G +EV  +L+D+  D        R P+ +A  +  ++++
Sbjct:   30 TPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLDKGADPRLLDAQARTPMEMAIDSGRIDVI 110          

HSP 6 Score: 46.9802 bits (110), Expect = 2.846e-6
Identity = 24/83 (28.92%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  745 ANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEI 993
             N  +H A  +  ++I ++LI K  ++N  N E+  PLH +   G+  + QLL+D    +    +A+  +P+  A++SG+I++
Sbjct:   28 GNTPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLD-KGADPRLLDAQARTPMEMAIDSGRIDV 109          

HSP 7 Score: 46.2098 bits (108), Expect = 5.818e-6
Identity = 24/99 (24.24%), Postives = 51/99 (51.52%), Query Frame = 1
Query: 1303 IDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1599
            +D+H N          P+H A+  GR +I K+L++  +D N +    ++PL+L+   G  +V+++L+D G +      +   P+  A  +G  ++ + +
Sbjct:   24 VDHHGN---------TPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLDKGADPRLLDAQARTPMEMAIDSGRIDVIEAI 113          

HSP 8 Score: 45.8246 bits (107), Expect = 8.815e-6
Identity = 26/93 (27.96%), Postives = 44/93 (47.31%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVN 525
            G   LHC+   G  D  K LID   D+  ++     P+H + + G+ ++ + L++ G     L  +A  P+  A  +G + V    I R L+N
Sbjct:   28 GNTPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLDKGADPRLLDAQARTPMEMAIDSGRIDVIEA-IERALLN 119          
BLAST of SMED30013077 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 202.216 bits (513), Expect = 2.358e-52
Identity = 118/467 (25.27%), Postives = 230/467 (49.25%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            +K  L  LHC+ +NG++  ++ L++H   I+    +G  PIH A QG + D V+ L++    ++ +      P+H A   GH  +A++L+ +    N +A +   P+H AC+  ++  + LLL    ++        T LH A   G+ +IV+ LL  G      N +       +H A  +   E+ + L+    +++ +  ++  PLH A   G+K + +LL+D    N +       +P+  A   G I   ++L+         T+    P+H AS  G  +VA +L++R  +          P+ +A  +NN+++++LL++   +  ST      P+H+A ++  +EV  +L+ N  + NC + + + P+H+AS+ GR ++V +L+   A+ N       TPL+L  ++GH  ++  L+  G ++   S   + P+H AC  G  ++ + L+     ++ + 
Sbjct:  267 TKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRG---ASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDH-KANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKT 729          

HSP 2 Score: 201.83 bits (512), Expect = 3.706e-52
Identity = 114/468 (24.36%), Postives = 225/468 (48.08%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            SK+G   LH +    N+   + L++   ++     +G  P+H A + GN  +V+ L++ G  ++   +    P+H A  NGH+ +  IL+     +  K  +   PIH A +  ++D V+ LL     I+    +  T LH A   G+H + ++L+      K N    +    +H AC       +++L+     +    +  + PLH A   G+  I + L+     + N  N +  +P+  A  +G  E+A+ L+ N   ++   +  + P+H A+ +G  E+  +L+D + + +  T     P+ IA+   ++  +R+L+           +   P+HVA + G V+V +LL++   N N A    + P+H+A  +  +++VK+L+  G   +       TPL++A ++   +V+ VL+ NG +  C+S++   P+H A Q G  ++  +L+    +++  N N
Sbjct:  201 SKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKG--AKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQR-GASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKN 665          

HSP 3 Score: 199.134 bits (505), Expect = 2.441e-51
Identity = 125/421 (29.69%), Postives = 204/421 (48.46%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGN-HDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVP-DCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK  ++  +  L+ H   +E V   G  P+H A   G+ +IVK L++ G   N    K   P+H A   GH  VA+ L+     V+ +A DD  P+H A R G+ +LVKLLL  K   + A +   T LH A ++G+ H I  LL +G  Q K+   TK     +H A      ++ E+L+ +    N      + PLH A  + N  + +LL+      +   +N   ++P+  A    QIE+A +L+ N    NC +     P+H AS  G  ++  MLI +Q ++         P+ + +   +V I   L+    ++ + +     P+HVAC  G +++V+ L+    ++N        P+H A++ G  +IV +LL+HGA  N I +   +PL +A   G+  V  VL
Sbjct:  369 GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKM---TKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNG--YTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 4 Score: 172.94 bits (437), Expect = 3.710e-43
Identity = 109/463 (23.54%), Postives = 215/463 (46.44%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDT 1626
            ++GLN LH + K G++  V  L+    ++E     G   +H A   G   +V  L+  G  +N    K F P++ A    HL V + L+      ++   D   P+  A + G+ ++V LL+       V    +  ALH A +  +     +L+       +   +K+    +H A   E+  + ++L+ +   +N      + PLH A   GN  + +LL+D     ++ +  +E +P+  A  +G + I ++L+ +   I   T+    PIH A+     +    L+    +I+  T+    P+ +A+   +  + ++L+       +       P+H+AC+K  +  + LL+ +  ++    +  + P+H+A+  G + IVK LL+ GA  N       TPL++A+  GH +V++ L+ N   ++ ++     P+H A + G  E+ +LL+D   + D+
Sbjct:   41 QNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKV----RLPALHIAARNDDTRTAAVLLQNDPNPDV--LSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDR-GAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDS 496          

HSP 5 Score: 143.28 bits (360), Expect = 4.756e-34
Identity = 117/488 (23.98%), Postives = 214/488 (43.85%), Query Frame = 1
Query:  268 SCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANR--AIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEK---------------------------------GHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            + ++GNLD     I +  +I   + +G   +H A + G+  +V  L+ SG  +    +K    +H A + G   V   L++    VN ++     P++ A +  ++++VK LL +    ++   + FT L  A QQG+ ++V LL        IN  TK   R  A+H A                     +ND+             +  A LL + P+ +V  K    F+P+  A +   + +A+LL+    ++N + +    P+H AS  G   +  +L+DR   I+ +T  +  P+  A+ N +V I+ +L+ +   I++       PIH+A Q   ++ V+ L+  +  I+      + P+H+A+  G   + K+LL+ GA  N       TPL++A +K                                 GH ++ K L+  G +    ++K   P+H A + G CE+AQ L+ +   +D
Sbjct:   17 AARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALL--------INYGTKGKVRLPALHIAA--------------------RNDD------------TRTAAVLLQNDPNPDVLSKTG--FTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVD 462          

HSP 6 Score: 72.0182 bits (175), Expect = 3.702e-12
Identity = 42/156 (26.92%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLL 699
            +S  G+  LH + + G  D V  LI  + ++   + +G  P+H   Q G+  I   L++ G  +       + P+H AC  G++ + + L+ +Q  VN K      P+H A + G+ D+V LLL      N   S   + L  A + G   ++ +L
Sbjct:  629 ESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 7 Score: 64.3142 bits (155), Expect = 8.582e-10
Identity = 33/124 (26.61%), Postives = 58/124 (46.77%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISR-QLVNIKAPDDSRPIHYACRTGNVDLVKLL 600
            L +K+GL  LH   + G++     L+     +      GY P+H AC  GN  +VK+L++    +N      + P+H A   GH  +  +L+    L N    + + P+  A R G + ++ +L
Sbjct:  661 LGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVL 784          

HSP 8 Score: 55.4546 bits (132), Expect = 3.868e-7
Identity = 31/105 (29.52%), Postives = 48/105 (45.71%), Query Frame = 2
Query: 2297 LFVEK*KYVNL**SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 2611
            + + K   VNL   N     P+HL    G++ I   LV  G+++    R    P+H AC  GN+ ++K L+     ++ K     TPL      G+ D V+ L K
Sbjct:  651 MLISKQANVNL--GNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLK 753          

HSP 9 Score: 54.6842 bits (130), Expect = 5.803e-7
Identity = 27/93 (29.03%), Postives = 50/93 (53.76%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREI 2635
            P+H+A   GN+ +V+LL+D G+ ++   +    P+H A  NG++ +I+ L+ +   I  K     +P+ +     + DCV    ++L  N EI
Sbjct:  240 PLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCV---RQLLQYNAEI 329          

HSP 10 Score: 53.1434 bits (126), Expect = 1.711e-6
Identity = 29/91 (31.87%), Postives = 47/91 (51.65%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL-SKVLDAN 2626
            P+H+A    NL++VKLLV  G +     R+   P+H A +   +++   L+ N  + +C++    TPL L    G  D V+ L SK  + N
Sbjct:  570 PLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVN 660          

HSP 11 Score: 50.8322 bits (120), Expect = 8.888e-6
Identity = 24/83 (28.92%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+AC   ++  + LL+ H ++LE    S   P+H A   G+L+++K L+    + +  N    TPL +    G+ +   FL
Sbjct:  372 PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFL 454          
BLAST of SMED30013077 vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 199.519 bits (506), Expect = 1.729e-51
Identity = 117/462 (25.32%), Postives = 226/462 (48.92%), Query Frame = 1
Query:  250 LNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            L  LHC+ +NG+   ++ L+D+   I+    +G  PIH A QG + D VK L++    ++ +      P+H A   GH  +A++L+ +    N +A +   P+H AC+  ++ ++ LLL    +I        T LH A   G+ +IV++L+        ++        +H A  S   E+ E L+     ++ K  ++  PLH A   G+K + +LL++    N N       SP+  A   G ++  +LL+         T+    P+H AS  G  +VA +L++R  +          P+ +A  +NN++++ LL++   +  S        +H+A ++  VEV   L+ +  + N  + + + P+H+AS+ GR +IV +L+   A+ N       TPL+L  ++GH  ++ +L+  G ++   +   + P+H AC  G  ++ + L+    +++++ 
Sbjct:  211 LTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNV--KVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEH-KANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKT 669          

HSP 2 Score: 180.644 bits (457), Expect = 1.500e-45
Identity = 119/506 (23.52%), Postives = 230/506 (45.45%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMN-----------FLQEKAFHPIHYACMNGHLAVARILISRQ----------------------LVNIKAPDDSR------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            S+ G   L+ + +  +L+ VKFL+++  +       G+ P+  A Q G+ ++V  LI  G               FL    F P+H A    +L VA++L++R                       L++  AP  ++      PIH A +  ++D VK LL     I+    +  T LH A   G+H + ++L+      K N    +    +H AC      ++++L+     I    +  + PLH A   G+  I ++L+     + +  N +  +P+  A  SG  E+A+ L+ N   ++   +  + P+H A+ +G  E+  +L++ + +    T     P+ IA+   +V+ +RLL+           +   P+HVA + G V+V +LL++   N N A    + P+H+A  +  +++V +L+  G   +       T L++A ++   +V+  L+ +G +   +S++   P+H A Q G  +I  LL+    +++  N +
Sbjct:  103 SQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKG--AKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQ-KGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKS 605          

HSP 3 Score: 172.94 bits (437), Expect = 3.788e-43
Identity = 122/504 (24.21%), Postives = 226/504 (44.84%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNL---------------------------------DYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILIS---RQLVNIKAPDD---------SRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS 1617
            ++GLNALH + K G++                                   V  L+++  ++      G+ P++ A Q  + ++VK+L+E+G   +   E  F P+  A   GH  V  +LIS   +  V + A  D           P+H A    N+++ +LLL      N   +++ T LH A + G+  I+ +L+       I   TK+    IH A   +  + V+ L+    EI+    + + PLH A   G+  +A++L+D      N +    F+P+  A     + +  LL+ ++  I   T +   P+H AS +G   +  +L+ +        +    P+ +AS + + E+   L+ N   + +   +++ P+H A + G  E+V+LL+++  N N        P+HIA+  G V+ V++LL+  A    +     TPL++A++ G  DV+++L++ G N          P+H A  +   ++  LLV    S
Sbjct:   38 QNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLL------NRGANDELTPLHCAARNGHFRIIEILLDNG--APIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLD-KGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGS 532          

HSP 4 Score: 145.976 bits (367), Expect = 8.315e-35
Identity = 109/456 (23.90%), Postives = 210/456 (46.05%), Query Frame = 1
Query:  367 ACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGH------------------------LAVARILISRQL----------VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVS----GKVQCK-IND----ATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD 1605
            A + GN D     I++G  +N   +   + +H A   GH                        L +A +    Q+          VN ++     P++ A +  ++++VK LL +    ++   + FT L  A QQG+ ++V LL+S    GKV+   + D     + +    +H A   E+  + ++L+ +        ++E+ PLH A  NG+  I ++L+D     +  K     SPI  A     ++  K L+  N +I+  T     P+H A+  G   +A +L+D+        +    P+ IA   N++ ++ LL+ +  +I++  +    P+HVA   G + +V++L+    + + +N K+  P+H+AS +G  E+ + LL++ A  +      +TPL+ A   GH ++ K+L+++  N    +     P+H A + G  +  +LL+D
Sbjct:   14 AARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGA------NDELTPLHCAARNGHFRIIEILLDN-GAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLD 462          

HSP 5 Score: 124.02 bits (310), Expect = 3.841e-28
Identity = 95/372 (25.54%), Postives = 166/372 (44.62%), Query Frame = 1
Query:  562 ACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIV-RLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTE-----------VAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNV 1641
            A R+GN+D     + +   IN A+     ALH A ++G+  +V  LL +G V   +   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L++    N +    + F+P+  AL  G   +  LLI+                 F S  GFT            VA +L++R  + E        P+  A+ N +  I+ +L+ N   I++       PIH+A Q   ++ V+ L+  +  I+      + P+H+A+  G   + K+LL+ GA  N       TPL++A +K H  V  +L+ +  +IE  +     P+H A   G   I ++L+    S    N  V
Sbjct:   14 AARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIV---LETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELT------PLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKV 375          

HSP 6 Score: 79.337 bits (194), Expect = 1.790e-14
Identity = 56/245 (22.86%), Postives = 112/245 (45.71%), Query Frame = 1
Query:  937 NAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNC-----------ICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +A+  +  L A  SG ++ A   I N  DIN + +     +H AS  G  ++   L+     +E  T      + IA+     +++  L+    N+ + + +   P+++A Q+  +EVV+ L++N  N +   +    P+ +A + G   +V +L+ +G                +     TPL++A    + +V+++L++ G N E        P+H A +NG   I ++L+D+   I  +  N
Sbjct:    4 SADAGNSFLRAARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELT------PLHCAARNGHFRIIEILLDNGAPIQAKTKN 242          

HSP 7 Score: 53.5286 bits (127), Expect = 1.612e-6
Identity = 24/94 (25.53%), Postives = 45/94 (47.87%), Query Frame = 1
Query:  235 DSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQ 516
            +S  G+  LH + + G  D V  LI  + ++   +  G  P+H   Q G+  I   L++ G  +       + P+H AC  G++ + + L+ +Q
Sbjct:  569 ESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQ 662          

HSP 8 Score: 51.9878 bits (123), Expect = 4.013e-6
Identity = 24/83 (28.92%), Postives = 43/83 (51.81%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            P+H+AC   +L ++ LL+ H +++E    S   P+H A   G+L+++K L+    +    N    TPL +    G+ +   FL
Sbjct:  312 PLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFL 394          
BLAST of SMED30013077 vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 189.504 bits (480), Expect = 3.079e-48
Identity = 123/513 (23.98%), Postives = 234/513 (45.61%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNI-KAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID---VPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLID--------------------RQCDIECETILKR-------------RPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLI 1659
            + SKSG   LH +   GN++    L++    ++    +G  P+H A + GN ++V+ L++ G  ++        P+H A  +GH A   +L+ +    + +  +   P+H A +  +V+ VK LL  K  ++    +  TALH A   G++ + +LL+  +     N    +    +H AC     +++E+L+     I    +  + P+H A   G+  I  LL+     PD +    N    + +  A  +GQ E+ + L+ N   ++   R  + P+H AS LG TE+  +L+                     R+  +E  ++L                P+ + S   ++++ +LL+       S       P+HVA      +V  LL+D   + +        P+HIA++  +++I  +LL++GA+TN +     TPL+LA+++GH D++ +L+  G  I   +      +H A Q     +A++LV +  ++D +   + Y  LI
Sbjct:  221 VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKR--ANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVS----NIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQT-KLGYTPLI 726          

HSP 2 Score: 186.037 bits (471), Expect = 3.637e-47
Identity = 110/468 (23.50%), Postives = 224/468 (47.86%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            ++ GL  LHC+ ++G+   V+ L++    +     +G  P+H A QG + + VK+L++    ++ +       +H A   GH  V ++L+ ++   N +A +   P+H AC+   V +++LL+    +I        T +H A   G+ +IV LL+       +++       ++H A  +   E+V  L+     ++ +  E+  PLH A   G   I QLL+     + +      ++P+  +   GQ+E A +L+      + +T+    P+H  S  G  +VA +L+ RQ   +        P+ +A+  +N ++  LL+    +  +T      P+H+A +K  +++  +L+      N    + + P+H+AS+ G  ++  +L+  GA  N       T L+LA ++    V+++L+ NG N++ Q+   + P+  AC  G  ++   L+ +  S++ +  N
Sbjct:  289 TRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNI--RGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQ-HMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKN 753          

HSP 3 Score: 185.267 bits (469), Expect = 6.427e-47
Identity = 136/562 (24.20%), Postives = 235/562 (41.81%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLID---------------------------------HKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            ++GLNALH + K G++D V+ L+D                                    DI     +G+ P++ A Q  + D+V+YL+E+G   +   E  F P+  A   GH  V  IL+   ++  V + A       DD++                     P+H A   GNV++  LLL    A++       T LH A ++GN ++VRLL+    Q  I+  T+     +H A  S  E  VE+L+ K   +  +    + PLH A                                    G+  + +LL+D    N N +    F+P+  A    ++++ +LL+     I   T +   PIH A+ +G   +  +L+      +   I     + +A+     E++R L+ N   + +   E++ P+H+A + G  E+VQLL+ +  + + A      P+HI++  G++E   +LLE GA  +       TPL++ ++ G  DV+K+L+      +        P+H A      ++A LL+D   S  T   N
Sbjct:   63 QNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQ--IDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD-KRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKN 621          

HSP 4 Score: 176.407 bits (446), Expect = 3.391e-44
Identity = 107/420 (25.48%), Postives = 194/420 (46.19%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVAR-ILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK   +  ++ L+ +   I+ V   G  PIH A   G+ +IV  L+++G   +    +    +H A   G   V R +L +  +V+ +A +D  P+H A R G  ++V+LLL      + A +  +T LH + ++G  +   +L+       +  ATK     +H      S ++ ++L+ ++   +      + PLH A    N+ +A LL+D     +   KN   ++P+  A    Q++IA +L+    + N  T+    P+H AS  G  ++A +L+ +   I   T      + +A+  + V +  +L+ N  N+         P+ VAC  G  ++V  L+ N  ++N        P+H A++ G   I+ +LL+HGA  N +     T L +A   G+  V   L
Sbjct:  391 GFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSL--ATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNG--YTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          

HSP 5 Score: 171.4 bits (433), Expect = 1.099e-42
Identity = 111/458 (24.24%), Postives = 217/458 (47.38%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLV 1602
            +K+GL+ LH + +  +++ VK L+ HK  ++ V       +H A   G+  + K L++     N      F P+H AC    + V  +L+ +   +I+A  +S   PIH A   G++++V LLL +  + +V++    T+LH A + G  ++VR LL +G +   ++   +     +H A      EIV++L+      +        PLH +   G    A +L++    + +    + F+P+      G +++AKLL+      + + +    P+H A+     +VA +L+D+             P+ IA+  N ++I  +L+       +   +   P+H+A Q+G  ++  LL+     IN      +  +H+A++  RV + +IL+ +GA+ +       TPL +A   G+  +   L+ NG ++  ++   + P+H A Q G   I  +L+
Sbjct:  322 TKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLV-KYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAM---VDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEA-GASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLL 774          

HSP 6 Score: 163.31 bits (412), Expect = 3.231e-40
Identity = 105/453 (23.18%), Postives = 215/453 (47.46%), Query Frame = 1
Query:  268 SCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            + + GN+D V   +    DI   + +G   +H A + G+ D+V+ L++ G  ++   +K    +H + + G   V + L+ R   +N ++ +   P++ A +  ++D+V+ LL +    + A  + FT L  A QQG++ +V +L+    + K+         A+H A   +  +   +L+      + ++     PLH A   GN  +A LL++     V+       +P+  A   G   + +LL+     I+  TR    P+H A+  G      +L+++   +   T     P+ +A+  ++VE ++ L+ +   +     +    +HVA   G   V +LL+D   N N        P+HIA +  RV+++++L+++GA    +     TP+++A   GH ++  +L+ NG + +  +I+    +H A + G  E+ + L+ +   +D
Sbjct:   39 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLP------ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNR-GAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVD 484          

HSP 7 Score: 145.976 bits (367), Expect = 7.180e-35
Identity = 97/394 (24.62%), Postives = 182/394 (46.19%), Query Frame = 1
Query:  529 KAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEI-----------------------------AKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSI 1620
            K  D +     A R GN+D V   L     I+  +     ALH A ++G+ D+V+ LL  G     ++ +TK  N A+H + ++   E+V+ L+ +  +IN ++     PL+ A    +  + + L++    N +    + F+P+  AL  G  ++                             A LL+ N+ + +  +++   P+H A+  G   VA +L++R   ++        P+ +AS   N  ++RLL+     I +   +   P+H A + G    V++L++    +       + P+H+A++   VE VK LL+H A  + +     T L++A   GHY V+K+L+D   N   +++  + P+H AC+    ++ +LLV    SI
Sbjct:   28 KKSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRG---APVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLE-NGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASI 417          

HSP 8 Score: 103.219 bits (256), Expect = 9.198e-22
Identity = 61/274 (22.26%), Postives = 126/274 (45.99%), Query Frame = 1
Query:  904 IDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHC-----------------------------NINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +D+  CN N  NA     +  A   G +++ + L+     ++ ST+     +H +S  G  EV   L+ R  DI  ++     P+++A+  N+++++R L+ N  N  +  ++   P+ +A Q+G  +VV +L++N                               N +  +     P+HIA+  G V +  +LL  GA  +       TPL++A+++G+ ++ ++L+D G  I+ ++     P+H A ++G     ++L++    +     N
Sbjct:   56 VDISTCNQNGLNA-----LHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKN 324          

HSP 9 Score: 85.1149 bits (209), Expect = 3.907e-16
Identity = 56/231 (24.24%), Postives = 108/231 (46.75%), Query Frame = 1
Query:  934 KNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            K ++  +  L A  +G I+     +    DI+   +     +H A+  G  ++   L+DR   ++  T      + I+S     E+++ L+    +I + +     P+++A Q+  ++VV+ L++N  N + A +    P+ IA + G  ++V ILLE     N      R P L++A  K     + +L+ N  N + QS   + P+H A   G   +A LL++   ++D
Sbjct:   28 KKSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVD 253          
BLAST of SMED30013077 vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 189.119 bits (479), Expect = 3.777e-48
Identity = 121/510 (23.73%), Postives = 233/510 (45.69%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNI-KAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLID--------------------RQCDIECETILKR-------------RPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNVNYFSLI 1659
            + SKSG   LH +   GN++    L++    ++    +G  P+H A + GN ++V+ L++ G  ++        P+H A  +GH A   +L+ +    + +  +   P+H A +  +V+ VK LL  K  ++    +  TALH A   G++ + +LL+  +     N    +    +H AC     +++E+L+     I    +  + P+H A   G+  I  LL+     + +  N    + +  A  +GQ E+ + L+ N   ++   R  + P+H AS LG TE+  +L+                     R+  +E  ++L                P+ + S   ++++ +LL+       S       P+HVA      +V  LL+D   + +        P+HIA++  +++I  +LL++GA+TN +     TPL+LA+++GH D++ +L+  G  I   +      +H A Q     +A++LV +  ++D +   + Y  LI
Sbjct:  236 VQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKR--ANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQ-NGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQT-KLGYTPLI 741          

HSP 2 Score: 185.652 bits (470), Expect = 4.272e-47
Identity = 110/468 (23.50%), Postives = 224/468 (47.86%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            ++ GL  LHC+ ++G+   V+ L++    +     +G  P+H A QG + + VK+L++    ++ +       +H A   GH  V ++L+ ++   N +A +   P+H AC+   V +++LL+    +I        T +H A   G+ +IV LL+       +++       ++H A  +   E+V  L+     ++ +  E+  PLH A   G   I QLL+     + +      ++P+  +   GQ+E A +L+      + +T+    P+H  S  G  +VA +L+ RQ   +        P+ +A+  +N ++  LL+    +  +T      P+H+A +K  +++  +L+      N    + + P+H+AS+ G  ++  +L+  GA  N       T L+LA ++    V+++L+ NG N++ Q+   + P+  AC  G  ++   L+ +  S++ +  N
Sbjct:  304 TRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNI--RGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQ-HMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKN 768          

HSP 3 Score: 184.496 bits (467), Expect = 9.527e-47
Identity = 136/562 (24.20%), Postives = 235/562 (41.81%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLID---------------------------------HKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILI---SRQLVNIKA------PDDSR---------------------PIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            ++GLNALH + K G++D V+ L+D                                    DI     +G+ P++ A Q  + D+V+YL+E+G   +   E  F P+  A   GH  V  IL+   ++  V + A       DD++                     P+H A   GNV++  LLL    A++       T LH A ++GN ++VRLL+    Q  I+  T+     +H A  S  E  VE+L+ K   +  +    + PLH A                                    G+  + +LL+D    N N +    F+P+  A    ++++ +LL+     I   T +   PIH A+ +G   +  +L+      +   I     + +A+     E++R L+ N   + +   E++ P+H+A + G  E+VQLL+ +  + + A      P+HI++  G++E   +LLE GA  +       TPL++ ++ G  DV+K+L+      +        P+H A      ++A LL+D   S  T   N
Sbjct:   78 QNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQ--IDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD-KRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKN 636          

HSP 4 Score: 176.022 bits (445), Expect = 3.878e-44
Identity = 107/420 (25.48%), Postives = 194/420 (46.19%), Query Frame = 1
Query:  247 GLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVAR-ILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDV-PDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVL 1500
            G   LH +CK   +  ++ L+ +   I+ V   G  PIH A   G+ +IV  L+++G   +    +    +H A   G   V R +L +  +V+ +A +D  P+H A R G  ++V+LLL      + A +  +T LH + ++G  +   +L+       +  ATK     +H      S ++ ++L+ ++   +      + PLH A    N+ +A LL+D     +   KN   ++P+  A    Q++IA +L+    + N  T+    P+H AS  G  ++A +L+ +   I   T      + +A+  + V +  +L+ N  N+         P+ VAC  G  ++V  L+ N  ++N        P+H A++ G   I+ +LL+HGA  N +     T L +A   G+  V   L
Sbjct:  406 GFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSL--ATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNG--YTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 5 Score: 171.4 bits (433), Expect = 1.193e-42
Identity = 111/458 (24.24%), Postives = 217/458 (47.38%), Query Frame = 1
Query:  238 SKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLV 1602
            +K+GL+ LH + +  +++ VK L+ HK  ++ V       +H A   G+  + K L++     N      F P+H AC    + V  +L+ +   +I+A  +S   PIH A   G++++V LLL +  + +V++    T+LH A + G  ++VR LL +G +   ++   +     +H A      EIV++L+      +        PLH +   G    A +L++    + +    + F+P+      G +++AKLL+      + + +    P+H A+     +VA +L+D+             P+ IA+  N ++I  +L+       +   +   P+H+A Q+G  ++  LL+     IN      +  +H+A++  RV + +IL+ +GA+ +       TPL +A   G+  +   L+ NG ++  ++   + P+H A Q G   I  +L+
Sbjct:  337 TKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLV-KYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAM---VDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEA-GASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLL 789          

HSP 6 Score: 163.31 bits (412), Expect = 3.659e-40
Identity = 105/453 (23.18%), Postives = 215/453 (47.46%), Query Frame = 1
Query:  268 SCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
            + + GN+D V   +    DI   + +G   +H A + G+ D+V+ L++ G  ++   +K    +H + + G   V + L+ R   +N ++ +   P++ A +  ++D+V+ LL +    + A  + FT L  A QQG++ +V +L+    + K+         A+H A   +  +   +L+      + ++     PLH A   GN  +A LL++     V+       +P+  A   G   + +LL+     I+  TR    P+H A+  G      +L+++   +   T     P+ +A+  ++VE ++ L+ +   +     +    +HVA   G   V +LL+D   N N        P+HIA +  RV+++++L+++GA    +     TP+++A   GH ++  +L+ NG + +  +I+    +H A + G  E+ + L+ +   +D
Sbjct:   54 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLP------ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNR-GAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVD 499          

HSP 7 Score: 103.219 bits (256), Expect = 1.004e-21
Identity = 61/274 (22.26%), Postives = 126/274 (45.99%), Query Frame = 1
Query:  904 IDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHC-----------------------------NINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +D+  CN N  NA     +  A   G +++ + L+     ++ ST+     +H +S  G  EV   L+ R  DI  ++     P+++A+  N+++++R L+ N  N  +  ++   P+ +A Q+G  +VV +L++N                               N +  +     P+HIA+  G V +  +LL  GA  +       TPL++A+++G+ ++ ++L+D G  I+ ++     P+H A ++G     ++L++    +     N
Sbjct:   71 VDISTCNQNGLNA-----LHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKN 339          

HSP 8 Score: 83.5741 bits (205), Expect = 9.680e-16
Identity = 55/223 (24.66%), Postives = 104/223 (46.64%), Query Frame = 1
Query:  958 ILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSID 1623
             L A  +G I+     +    DI+   +     +H A+  G  ++   L+DR   ++  T      + I+S     E+++ L+    +I + +     P+++A Q+  ++VV+ L++N  N + A +    P+ IA + G  ++V ILLE     N      R P L++A  K     + +L+ N  N + QS   + P+H A   G   +A LL++   ++D
Sbjct:   51 FLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVD 268          
BLAST of SMED30013077 vs. Ensembl Medaka
Match: ENSORLT00000040233.1 (pep primary_assembly:ASM223467v1:19:16412534:16434057:1 gene:ENSORLG00000021910.1 transcript:ENSORLT00000040233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.999 bits (406), Expect = 6.037e-42
Identity = 105/426 (24.65%), Postives = 196/426 (46.01%), Query Frame = 1
Query:  241 KSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCN 1518
            ++GLNALH + K G+++ V  LI    +++     G   +H A   G  ++VK L+ +G  +N   +  F P++ A    HL                                D+V+LLL +  + ++A  + FT L  A QQG+  +V LL+    + K+         A+H A   +  +   +L+      + ++     PLH A   GN  +A LL++     V+ K   + +P+  A   G   + +LL+     I+  T+    P+H A+  G  +V  ML++R   I  +T     P+ +A+  +++  ++LL+ +   +    ++    +HVA   G  +V ++++D   N N        P+HIA +  RV+++++LL+HGA    +     TP+++A   GH ++   LI+ G +
Sbjct:   48 QNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHL--------------------------------DVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLP------ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLN-RGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLINYGAS 434          

HSP 2 Score: 148.288 bits (373), Expect = 1.271e-37
Identity = 105/456 (23.03%), Postives = 206/456 (45.18%), Query Frame = 1
Query:  268 SCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            + + GNL+     + +  DI   + +G   +H A + G+ ++V  LI+ G  ++   +K    +H A + G   V + L+S    VN ++ +   P++ A +  ++D+V+LLL +  + ++A  + FT L  A QQG+  +V LL+    + K+                                        +  LH A    +   A LL+   D N + ++   F+P+  A + G I +A LL+     ++   R    P+H AS  G + +  +L++R   I+  T     P+  A+ + + +++ +L+     I S       P+H+A Q   +  VQLL+ +   ++   +  +  +H+A+  G  ++ K++++  A+ N       TPL++A +K    V ++L+ +G +I+  +     PIH A   G   I   L++   S +T N
Sbjct:   24 AARAGNLEKALDYLQNGVDINICNQNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKV---------------------------------------RLPALHIAARKDDTKAAALLLQ-NDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLINYGASPNTSN 439          

HSP 3 Score: 93.2041 bits (230), Expect = 2.333e-19
Identity = 58/229 (25.33%), Postives = 113/229 (49.34%), Query Frame = 1
Query:  232 LDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN--RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID 909
            ++SKSG   LH +   GN++    L++    ++    +   P+H A + GN ++V+ L+E G  ++   +    P+H A  +GH  V  +L++R   +  K  +   P+H A +  +++ V+LLL     ++   ++  TALH A   G++ + +++V  K     N   K+ N    +H AC     +++E+L+     I    +  + P+H A   G++ I   LI+
Sbjct:  206 VESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKA----NPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVHQLIN 430          
BLAST of SMED30013077 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 993.416 bits (2567), Expect = 0.000e+0
Identity = 497/537 (92.55%), Postives = 502/537 (93.48%), Query Frame = 1
Query:  127 IMMSKRLDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAE---------------------------------EFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            +M ++RLDELIGHLRKQLEIGNSDDTINNIIIETILDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACR+GNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAE                                 EFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEI+RLLITNHCNIK TNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN
Sbjct:    1 MMSNRRLDELIGHLRKQLEIGNSDDTINNIIIETILDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 537          

HSP 2 Score: 467.618 bits (1202), Expect = 3.572e-140
Identity = 226/229 (98.69%), Postives = 228/229 (99.56%), Query Frame = 2
Query: 2543 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLH 3229
            ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVA+ TRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSIC+NDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLH
Sbjct:  941 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAVRTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICENDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLH 1169          

HSP 3 Score: 294.278 bits (752), Expect = 7.860e-82
Identity = 166/462 (35.93%), Postives = 263/462 (56.93%), Query Frame = 1
Query:  259 LHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESG--CMMNFLQEKAFHPIHYACMNGHLAVARILISRQ-LVNIKAPDDSRPIHYACRTGNVDLVKLLL-ASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            +H +C++GN+D VK L+  KC I   D   +  +HYACQ GN DIV+ L+     C +N   + A   IH+ACM+    +  ILI ++  +N K  ++  P+HYAC  GN  + +LL+    C +N  ++E+   +H ACQ G+ +I +LL+     C++N   K     I +A  S   EI ++LI   C+INC    +  P+H+A T G   +A +LID   C++ C+   +  PI  A ++  +EI +LLITN+C+I C+    E+PIH A   GF EV  +LID  C+I C      +PI IAS N  VEI+++L+ +  +          P+++A +KG  +V ++LIDN CNI C + K  +PIH A +NG  EI ++L++     +      + P++LA   G+ ++ K+L+D G N+EC      RPIH AC+NG  ++ + LV ++C+I  +N
Sbjct:  143 IHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEK--NCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLID-RQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKN 601          

HSP 4 Score: 155.992 bits (393), Expect = 5.110e-38
Identity = 119/415 (28.67%), Postives = 191/415 (46.02%), Query Frame = 1
Query:  259 LHCSCKNGNLDYVKFLID-HKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTG---------------------------------NVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEIL---------------------------------IGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCN--IKSTNDENEQPIHVACQKGFVEVV 1293
            LH +C NGN    + LID   C++ C +    +PIH ACQ G+ +I K LIE  C MN + ++ F PI YA  +G + +A++LI+    +N       RPIH+A   G                                 NV++V+LL+ + C I   + E    +H ACQ+G  ++V+LL+     C IN A     + IH A  +   EIV+IL                                 I   C I C++ ++  P+H AC NG   IAQLL+D   C+++ +N  +  PI  A +SG + I KLL+    ++ C  R+ +RPIH+A   G  ++   L+   C I C+  +K        +    E LRL+  ++ +  +K+ +  NE  I ++C +  ++ +
Sbjct:  244 LHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDN--HCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD-SHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKTENNRKNRATVTKEKLRLIHKDNISKEMKNKDIANEVDISISCARSLMKKI 655          

HSP 5 Score: 140.198 bits (352), Expect = 3.483e-33
Identity = 65/71 (91.55%), Postives = 66/71 (92.96%), Query Frame = 2
Query: 2339 NS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS 2551
            N  KQKPIHLACSSGNLNIVKLLVD GSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNH  +
Sbjct:  535 NDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKT 605          

HSP 6 Score: 64.3142 bits (155), Expect = 5.377e-10
Identity = 29/86 (33.72%), Postives = 54/86 (62.79%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            K++PI +A S+ N+ IV+LL+ +  N++C +  N++PIH AC+ G +++++ L+ N+C I+C N     P+ +    G  + V  L
Sbjct:  373 KRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKIL 458          

HSP 7 Score: 63.929 bits (154), Expect = 7.731e-10
Identity = 25/57 (43.86%), Postives = 40/57 (70.18%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIH 2530
            +H +C +GNL+ VK L+DH  ++EC D    +PIHYAC+ GN D++K L+ + C ++
Sbjct:   45 LHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMN 101          

HSP 8 Score: 62.3882 bits (150), Expect = 2.076e-9
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 2
Query: 2339 NS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            N+ + +PIHLAC  G+  I KLL++    +   ++    PI YA  +G +++ K L+ NNC I+C       P+    T G+ +    L
Sbjct:  271 NAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHML 359          

HSP 9 Score: 62.003 bits (149), Expect = 3.167e-9
Identity = 34/84 (40.48%), Postives = 49/84 (58.33%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHG-SNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            PIH AC +G+L + ++L+     N++ PD S  RPIHYAC +GN+DL+K L+ + CAI+  +    T L      G  D V  L
Sbjct:  110 PIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLL 191          

HSP 10 Score: 61.6178 bits (148), Expect = 4.328e-9
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 2
Query: 2336 SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVL 2617
            +N   ++PIH+AC  G + +V+LL+D+  N+ C +    +PIH A ENG ++++K L+ +    +C    + TPL L    G+ D    +SKVL
Sbjct:  402 TNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYD----VSKVL 491          

HSP 11 Score: 56.6102 bits (135), Expect = 1.185e-7
Identity = 25/86 (29.07%), Postives = 47/86 (54.65%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +++PIH A + G   +  +L+D   ++EC     +RPI  A  N N+++++ L+ N+C I C N  +  P+ +    G+ + V  L
Sbjct:  340 QERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLL 425          

HSP 12 Score: 55.8398 bits (133), Expect = 2.212e-7
Identity = 24/69 (34.78%), Postives = 42/69 (60.87%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVD-HGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 2560
            P+H AC++GN  I +LL+D    N+ C +    +PIH AC++G+ ++ K L+  NC ++  N    +P+
Sbjct:  243 PLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPI 311          

HSP 13 Score: 52.373 bits (124), Expect = 2.645e-6
Identity = 27/85 (31.76%), Postives = 44/85 (51.76%), Query Frame = 2
Query: 2354 KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVH-NNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            + IH AC S +  IV++L+     + C +     P+HYAC NGN  + + L+   +C ++CKN   S P+ L    G+ +    L
Sbjct:  209 RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLL 293          

HSP 14 Score: 51.6026 bits (122), Expect = 4.656e-6
Identity = 24/61 (39.34%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 2354 KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCK 2536
            +PIH AC SGN+++VKLL+     +   D      +HYAC+ GN D+++ LV     + CK
Sbjct:  141 RPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSG--KVQCK 199          

HSP 15 Score: 51.2174 bits (121), Expect = 5.420e-6
Identity = 33/99 (33.33%), Postives = 49/99 (49.49%), Query Frame = 2
Query: 2336 SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPD--RSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDAN 2626
            ++S K   +H AC  GN +IV+LLV      +  D  +S  R IH+AC + + ++++ L+   C I+CKN     PL    T G       L  V D N
Sbjct:  168 ADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCN 266          
BLAST of SMED30013077 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 500/536 (93.28%), Postives = 502/536 (93.66%), Query Frame = 1
Query:  130 MMSKRLDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAE---------------------------------EFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            MMSKRLDELIGHLRKQLEIGNSDDTINNIIIETILDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACR+GNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAE                                 EFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEI+RLLITNHCNIK TNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN
Sbjct:    1 MMSKRLDELIGHLRKQLEIGNSDDTINNIIIETILDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 536          

HSP 2 Score: 468.774 bits (1205), Expect = 9.909e-147
Identity = 228/231 (98.70%), Postives = 230/231 (99.57%), Query Frame = 2
Query: 2543 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 3235
            ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVA+ TRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSIC+NDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL
Sbjct:  888 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAVRTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICENDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 1118          

HSP 3 Score: 295.819 bits (756), Expect = 8.717e-84
Identity = 166/462 (35.93%), Postives = 263/462 (56.93%), Query Frame = 1
Query:  259 LHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESG--CMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLL-ASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            +H +C++GN+D VK L+  KC I   D   +  +HYACQ GN DIV+ L+     C +N   + A   IH+ACM+    +  ILI ++  +N K  ++  P+HYAC  GN  + +LL+    C +N  ++E+   +H ACQ G+ +I +LL+     C++N   K     I +A  S   EI ++LI   C+INC    +  P+H+A T G   +A +LID   C++ C+   +  PI  A ++  +EI +LLITN+C+I C+    E+PIH A   GF EV  +LID  C+I C      +PI IAS N  VEI+++L+ +  +          P+++A +KG  +V ++LIDN CNI C + K  +PIH A +NG  EI ++L++     +      + P++LA   G+ ++ K+L+D G N+EC      RPIH AC+NG  ++ + LV ++C+I  +N
Sbjct:  142 IHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEK--NCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLID-RQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKN 600          

HSP 4 Score: 158.303 bits (399), Expect = 6.153e-39
Identity = 119/416 (28.61%), Postives = 191/416 (45.91%), Query Frame = 1
Query:  259 LHCSCKNGNLDYVKFLID-HKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTG---------------------------------NVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEIL---------------------------------IGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCN--IKSTNDENEQPIHVACQKGFVEVVQ 1296
            LH +C NGN    + LID   C++ C +    +PIH ACQ G+ +I K LIE  C MN + ++ F PI YA  +G + +A++LI+    +N       RPIH+A   G                                 NV++V+LL+ + C I   + E    +H ACQ+G  ++V+LL+     C IN A     + IH A  +   EIV+IL                                 I   C I C++ ++  P+H AC NG   IAQLL+D   C+++ +N  +  PI  A +SG + I KLL+    ++ C  R+ +RPIH+A   G  ++   L+   C I C+  +K        +    E LRL+  ++ +  +K+ +  NE  I ++C +  ++ + 
Sbjct:  243 LHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDN--HCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD-SHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKTENNRKNRATVTKEKLRLIHKDNISKEMKNKDIANEVDISISCARSLMKKIH 655          

HSP 5 Score: 137.887 bits (346), Expect = 1.203e-32
Identity = 65/71 (91.55%), Postives = 66/71 (92.96%), Query Frame = 2
Query: 2339 NS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS 2551
            N  KQKPIHLACSSGNLNIVKLLVD GSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNH  +
Sbjct:  534 NDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKT 604          

HSP 6 Score: 63.5438 bits (153), Expect = 9.658e-10
Identity = 29/86 (33.72%), Postives = 54/86 (62.79%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            K++PI +A S+ N+ IV+LL+ +  N++C +  N++PIH AC+ G +++++ L+ N+C I+C N     P+ +    G  + V  L
Sbjct:  372 KRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKIL 457          

HSP 7 Score: 62.7734 bits (151), Expect = 1.367e-9
Identity = 25/56 (44.64%), Postives = 39/56 (69.64%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 2527
            +H +C +GNL+ VK L+DH  ++EC D    +PIHYAC+ GN D++K L+ + C +
Sbjct:   44 LHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMM 99          

HSP 8 Score: 61.2326 bits (147), Expect = 4.677e-9
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 2
Query: 2339 NS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            N+ + +PIHLAC  G+  I KLL++    +   ++    PI YA  +G +++ K L+ NNC I+C       P+    T G+ +    L
Sbjct:  270 NAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHML 358          

HSP 9 Score: 60.8474 bits (146), Expect = 6.679e-9
Identity = 34/84 (40.48%), Postives = 49/84 (58.33%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHG-SNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            PIH AC +G+L + ++L+     N++ PD S  RPIHYAC +GN+DL+K L+ + CAI+  +    T L      G  D V  L
Sbjct:  109 PIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLL 190          

HSP 10 Score: 60.4622 bits (145), Expect = 7.087e-9
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 2
Query: 2336 SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVL 2617
            +N   ++PIH+AC  G + +V+LL+D+  N+ C +    +PIH A ENG ++++K L+ +    +C    + TPL L    G+ D    +SKVL
Sbjct:  401 TNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYD----VSKVL 490          

HSP 11 Score: 55.4546 bits (132), Expect = 2.371e-7
Identity = 25/86 (29.07%), Postives = 47/86 (54.65%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +++PIH A + G   +  +L+D   ++EC     +RPI  A  N N+++++ L+ N+C I C N  +  P+ +    G+ + V  L
Sbjct:  339 QERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLL 424          

HSP 12 Score: 54.6842 bits (130), Expect = 4.998e-7
Identity = 24/69 (34.78%), Postives = 42/69 (60.87%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVD-HGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 2560
            P+H AC++GN  I +LL+D    N+ C +    +PIH AC++G+ ++ K L+  NC ++  N    +P+
Sbjct:  242 PLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPI 310          

HSP 13 Score: 51.6026 bits (122), Expect = 3.788e-6
Identity = 27/85 (31.76%), Postives = 44/85 (51.76%), Query Frame = 2
Query: 2354 KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVH-NNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            + IH AC S +  IV++L+     + C +     P+HYAC NGN  + + L+   +C ++CKN   S P+ L    G+ +    L
Sbjct:  208 RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLL 292          

HSP 14 Score: 50.8322 bits (120), Expect = 7.275e-6
Identity = 33/99 (33.33%), Postives = 49/99 (49.49%), Query Frame = 2
Query: 2336 SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPD--RSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDAN 2626
            ++S K   +H AC  GN +IV+LLV      +  D  +S  R IH+AC + + ++++ L+   C I+CKN     PL    T G       L  V D N
Sbjct:  167 ADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCN 265          

HSP 15 Score: 50.447 bits (119), Expect = 9.622e-6
Identity = 24/61 (39.34%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 2354 KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCK 2536
            +PIH AC SGN+++VKLL+     +   D      +HYAC+ GN D+++ LV     + CK
Sbjct:  140 RPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSG--KVQCK 198          
BLAST of SMED30013077 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 984.171 bits (2543), Expect = 0.000e+0
Identity = 500/536 (93.28%), Postives = 502/536 (93.66%), Query Frame = 1
Query:  130 MMSKRLDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAE---------------------------------EFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            MMSKRLDELIGHLRKQLEIGNSDDTINNIIIETILDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACR+GNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAE                                 EFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEI+RLLITNHCNIK TNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN
Sbjct:    1 MMSKRLDELIGHLRKQLEIGNSDDTINNIIIETILDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 536          

HSP 2 Score: 468.389 bits (1204), Expect = 3.317e-147
Identity = 228/231 (98.70%), Postives = 230/231 (99.57%), Query Frame = 2
Query: 2543 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 3235
            ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVA+ TRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSIC+NDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL
Sbjct:  826 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAVRTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICENDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 1056          

HSP 3 Score: 296.204 bits (757), Expect = 3.006e-84
Identity = 166/462 (35.93%), Postives = 263/462 (56.93%), Query Frame = 1
Query:  259 LHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESG--CMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLL-ASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            +H +C++GN+D VK L+  KC I   D   +  +HYACQ GN DIV+ L+     C +N   + A   IH+ACM+    +  ILI ++  +N K  ++  P+HYAC  GN  + +LL+    C +N  ++E+   +H ACQ G+ +I +LL+     C++N   K     I +A  S   EI ++LI   C+INC    +  P+H+A T G   +A +LID   C++ C+   +  PI  A ++  +EI +LLITN+C+I C+    E+PIH A   GF EV  +LID  C+I C      +PI IAS N  VEI+++L+ +  +          P+++A +KG  +V ++LIDN CNI C + K  +PIH A +NG  EI ++L++     +      + P++LA   G+ ++ K+L+D G N+EC      RPIH AC+NG  ++ + LV ++C+I  +N
Sbjct:  142 IHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEK--NCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLID-RQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKN 600          

HSP 4 Score: 158.303 bits (399), Expect = 4.737e-39
Identity = 119/416 (28.61%), Postives = 191/416 (45.91%), Query Frame = 1
Query:  259 LHCSCKNGNLDYVKFLID-HKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTG---------------------------------NVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEIL---------------------------------IGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCN--IKSTNDENEQPIHVACQKGFVEVVQ 1296
            LH +C NGN    + LID   C++ C +    +PIH ACQ G+ +I K LIE  C MN + ++ F PI YA  +G + +A++LI+    +N       RPIH+A   G                                 NV++V+LL+ + C I   + E    +H ACQ+G  ++V+LL+     C IN A     + IH A  +   EIV+IL                                 I   C I C++ ++  P+H AC NG   IAQLL+D   C+++ +N  +  PI  A +SG + I KLL+    ++ C  R+ +RPIH+A   G  ++   L+   C I C+  +K        +    E LRL+  ++ +  +K+ +  NE  I ++C +  ++ + 
Sbjct:  243 LHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDN--HCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD-SHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKTENNRKNRATVTKEKLRLIHKDNISKEMKNKDIANEVDISISCARSLMKKIH 655          

HSP 5 Score: 137.887 bits (346), Expect = 1.191e-32
Identity = 65/71 (91.55%), Postives = 66/71 (92.96%), Query Frame = 2
Query: 2339 NS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS 2551
            N  KQKPIHLACSSGNLNIVKLLVD GSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNH  +
Sbjct:  534 NDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKT 604          

HSP 6 Score: 63.1586 bits (152), Expect = 1.042e-9
Identity = 29/86 (33.72%), Postives = 54/86 (62.79%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            K++PI +A S+ N+ IV+LL+ +  N++C +  N++PIH AC+ G +++++ L+ N+C I+C N     P+ +    G  + V  L
Sbjct:  372 KRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKIL 457          

HSP 7 Score: 62.7734 bits (151), Expect = 1.321e-9
Identity = 25/56 (44.64%), Postives = 39/56 (69.64%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 2527
            +H +C +GNL+ VK L+DH  ++EC D    +PIHYAC+ GN D++K L+ + C +
Sbjct:   44 LHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMM 99          

HSP 8 Score: 61.2326 bits (147), Expect = 4.799e-9
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 2
Query: 2339 NS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            N+ + +PIHLAC  G+  I KLL++    +   ++    PI YA  +G +++ K L+ NNC I+C       P+    T G+ +    L
Sbjct:  270 NAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHML 358          

HSP 9 Score: 60.4622 bits (145), Expect = 6.972e-9
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 2
Query: 2336 SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVL 2617
            +N   ++PIH+AC  G + +V+LL+D+  N+ C +    +PIH A ENG ++++K L+ +    +C    + TPL L    G+ D    +SKVL
Sbjct:  401 TNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYD----VSKVL 490          

HSP 10 Score: 60.4622 bits (145), Expect = 7.212e-9
Identity = 34/84 (40.48%), Postives = 49/84 (58.33%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHG-SNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            PIH AC +G+L + ++L+     N++ PD S  RPIHYAC +GN+DL+K L+ + CAI+  +    T L      G  D V  L
Sbjct:  109 PIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLL 190          

HSP 11 Score: 55.4546 bits (132), Expect = 2.417e-7
Identity = 25/86 (29.07%), Postives = 47/86 (54.65%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +++PIH A + G   +  +L+D   ++EC     +RPI  A  N N+++++ L+ N+C I C N  +  P+ +    G+ + V  L
Sbjct:  339 QERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLL 424          

HSP 12 Score: 54.299 bits (129), Expect = 5.142e-7
Identity = 24/69 (34.78%), Postives = 42/69 (60.87%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVD-HGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 2560
            P+H AC++GN  I +LL+D    N+ C +    +PIH AC++G+ ++ K L+  NC ++  N    +P+
Sbjct:  242 PLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPI 310          

HSP 13 Score: 51.6026 bits (122), Expect = 3.740e-6
Identity = 27/85 (31.76%), Postives = 44/85 (51.76%), Query Frame = 2
Query: 2354 KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVH-NNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            + IH AC S +  IV++L+     + C +     P+HYAC NGN  + + L+   +C ++CKN   S P+ L    G+ +    L
Sbjct:  208 RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLL 292          

HSP 14 Score: 50.8322 bits (120), Expect = 7.307e-6
Identity = 33/99 (33.33%), Postives = 49/99 (49.49%), Query Frame = 2
Query: 2336 SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPD--RSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDAN 2626
            ++S K   +H AC  GN +IV+LLV      +  D  +S  R IH+AC + + ++++ L+   C I+CKN     PL    T G       L  V D N
Sbjct:  167 ADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCN 265          

HSP 15 Score: 50.447 bits (119), Expect = 9.665e-6
Identity = 24/61 (39.34%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 2354 KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCK 2536
            +PIH AC SGN+++VKLL+     +   D      +HYAC+ GN D+++ LV     + CK
Sbjct:  140 RPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSG--KVQCK 198          
BLAST of SMED30013077 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 983.015 bits (2540), Expect = 0.000e+0
Identity = 499/535 (93.27%), Postives = 501/535 (93.64%), Query Frame = 1
Query:  133 MSKRLDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAE---------------------------------EFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            MSKRLDELIGHLRKQLEIGNSDDTINNIIIETILDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACR+GNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAE                                 EFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEI+RLLITNHCNIK TNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN
Sbjct:    1 MSKRLDELIGHLRKQLEIGNSDDTINNIIIETILDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 535          

HSP 2 Score: 468.774 bits (1205), Expect = 9.687e-147
Identity = 228/231 (98.70%), Postives = 230/231 (99.57%), Query Frame = 2
Query: 2543 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 3235
            ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVA+ TRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSIC+NDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL
Sbjct:  887 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAVRTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICENDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 1117          

HSP 3 Score: 296.204 bits (757), Expect = 7.464e-84
Identity = 166/462 (35.93%), Postives = 263/462 (56.93%), Query Frame = 1
Query:  259 LHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESG--CMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLL-ASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            +H +C++GN+D VK L+  KC I   D   +  +HYACQ GN DIV+ L+     C +N   + A   IH+ACM+    +  ILI ++  +N K  ++  P+HYAC  GN  + +LL+    C +N  ++E+   +H ACQ G+ +I +LL+     C++N   K     I +A  S   EI ++LI   C+INC    +  P+H+A T G   +A +LID   C++ C+   +  PI  A ++  +EI +LLITN+C+I C+    E+PIH A   GF EV  +LID  C+I C      +PI IAS N  VEI+++L+ +  +          P+++A +KG  +V ++LIDN CNI C + K  +PIH A +NG  EI ++L++     +      + P++LA   G+ ++ K+L+D G N+EC      RPIH AC+NG  ++ + LV ++C+I  +N
Sbjct:  141 IHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEK--NCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLID-RQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKN 599          

HSP 4 Score: 158.303 bits (399), Expect = 5.353e-39
Identity = 119/416 (28.61%), Postives = 191/416 (45.91%), Query Frame = 1
Query:  259 LHCSCKNGNLDYVKFLID-HKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTG---------------------------------NVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEIL---------------------------------IGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCN--IKSTNDENEQPIHVACQKGFVEVVQ 1296
            LH +C NGN    + LID   C++ C +    +PIH ACQ G+ +I K LIE  C MN + ++ F PI YA  +G + +A++LI+    +N       RPIH+A   G                                 NV++V+LL+ + C I   + E    +H ACQ+G  ++V+LL+     C IN A     + IH A  +   EIV+IL                                 I   C I C++ ++  P+H AC NG   IAQLL+D   C+++ +N  +  PI  A +SG + I KLL+    ++ C  R+ +RPIH+A   G  ++   L+   C I C+  +K        +    E LRL+  ++ +  +K+ +  NE  I ++C +  ++ + 
Sbjct:  242 LHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDN--HCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD-SHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKTENNRKNRATVTKEKLRLIHKDNISKEMKNKDIANEVDISISCARSLMKKIH 654          

HSP 5 Score: 137.887 bits (346), Expect = 1.212e-32
Identity = 65/71 (91.55%), Postives = 66/71 (92.96%), Query Frame = 2
Query: 2339 NS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS 2551
            N  KQKPIHLACSSGNLNIVKLLVD GSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNH  +
Sbjct:  533 NDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKT 603          

HSP 6 Score: 63.5438 bits (153), Expect = 9.655e-10
Identity = 29/86 (33.72%), Postives = 54/86 (62.79%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            K++PI +A S+ N+ IV+LL+ +  N++C +  N++PIH AC+ G +++++ L+ N+C I+C N     P+ +    G  + V  L
Sbjct:  371 KRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKIL 456          

HSP 7 Score: 62.7734 bits (151), Expect = 1.367e-9
Identity = 25/56 (44.64%), Postives = 39/56 (69.64%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 2527
            +H +C +GNL+ VK L+DH  ++EC D    +PIHYAC+ GN D++K L+ + C +
Sbjct:   43 LHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMM 98          

HSP 8 Score: 61.2326 bits (147), Expect = 4.756e-9
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 2
Query: 2339 NS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            N+ + +PIHLAC  G+  I KLL++    +   ++    PI YA  +G +++ K L+ NNC I+C       P+    T G+ +    L
Sbjct:  269 NAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHML 357          

HSP 9 Score: 60.4622 bits (145), Expect = 6.734e-9
Identity = 34/84 (40.48%), Postives = 49/84 (58.33%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHG-SNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            PIH AC +G+L + ++L+     N++ PD S  RPIHYAC +GN+DL+K L+ + CAI+  +    T L      G  D V  L
Sbjct:  108 PIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLL 189          

HSP 10 Score: 60.4622 bits (145), Expect = 7.085e-9
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 2
Query: 2336 SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVL 2617
            +N   ++PIH+AC  G + +V+LL+D+  N+ C +    +PIH A ENG ++++K L+ +    +C    + TPL L    G+ D    +SKVL
Sbjct:  400 TNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYD----VSKVL 489          

HSP 11 Score: 55.4546 bits (132), Expect = 2.390e-7
Identity = 25/86 (29.07%), Postives = 47/86 (54.65%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +++PIH A + G   +  +L+D   ++EC     +RPI  A  N N+++++ L+ N+C I C N  +  P+ +    G+ + V  L
Sbjct:  338 QERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLL 423          

HSP 12 Score: 54.6842 bits (130), Expect = 4.997e-7
Identity = 24/69 (34.78%), Postives = 42/69 (60.87%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVD-HGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 2560
            P+H AC++GN  I +LL+D    N+ C +    +PIH AC++G+ ++ K L+  NC ++  N    +P+
Sbjct:  241 PLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPI 309          

HSP 13 Score: 51.6026 bits (122), Expect = 3.788e-6
Identity = 27/85 (31.76%), Postives = 44/85 (51.76%), Query Frame = 2
Query: 2354 KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVH-NNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            + IH AC S +  IV++L+     + C +     P+HYAC NGN  + + L+   +C ++CKN   S P+ L    G+ +    L
Sbjct:  207 RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLL 291          

HSP 14 Score: 50.8322 bits (120), Expect = 7.273e-6
Identity = 33/99 (33.33%), Postives = 49/99 (49.49%), Query Frame = 2
Query: 2336 SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPD--RSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDAN 2626
            ++S K   +H AC  GN +IV+LLV      +  D  +S  R IH+AC + + ++++ L+   C I+CKN     PL    T G       L  V D N
Sbjct:  166 ADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCN 264          

HSP 15 Score: 50.447 bits (119), Expect = 9.784e-6
Identity = 24/61 (39.34%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 2354 KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCK 2536
            +PIH AC SGN+++VKLL+     +   D      +HYAC+ GN D+++ LV     + CK
Sbjct:  139 RPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSG--KVQCK 197          
BLAST of SMED30013077 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 982.63 bits (2539), Expect = 0.000e+0
Identity = 499/535 (93.27%), Postives = 501/535 (93.64%), Query Frame = 1
Query:  133 MSKRLDELIGHLRKQLEIGNSXXXXXXXXXXXXLDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAE---------------------------------EFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 1638
            MSKRLDELIGHLRKQLEIGNSDDTINNIIIETILDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACR+GNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAE                                 EFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEI+RLLITNHCNIK TNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN
Sbjct:    1 MSKRLDELIGHLRKQLEIGNSDDTINNIIIETILDSKSGLNALHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDN 535          

HSP 2 Score: 469.159 bits (1206), Expect = 5.085e-147
Identity = 228/231 (98.70%), Postives = 230/231 (99.57%), Query Frame = 2
Query: 2543 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 3235
            ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVA+ TRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSIC+NDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL
Sbjct:  877 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAVRTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICENDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 1107          

HSP 3 Score: 295.434 bits (755), Expect = 9.524e-84
Identity = 166/462 (35.93%), Postives = 263/462 (56.93%), Query Frame = 1
Query:  259 LHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESG--CMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTGNVDLVKLLL-ASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN 1632
            +H +C++GN+D VK L+  KC I   D   +  +HYACQ GN DIV+ L+     C +N   + A   IH+ACM+    +  ILI ++  +N K  ++  P+HYAC  GN  + +LL+    C +N  ++E+   +H ACQ G+ +I +LL+     C++N   K     I +A  S   EI ++LI   C+INC    +  P+H+A T G   +A +LID   C++ C+   +  PI  A ++  +EI +LLITN+C+I C+    E+PIH A   GF EV  +LID  C+I C      +PI IAS N  VEI+++L+ +  +          P+++A +KG  +V ++LIDN CNI C + K  +PIH A +NG  EI ++L++     +      + P++LA   G+ ++ K+L+D G N+EC      RPIH AC+NG  ++ + LV ++C+I  +N
Sbjct:  141 IHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEK--NCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLID-RQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKN 599          

HSP 4 Score: 157.918 bits (398), Expect = 7.845e-39
Identity = 119/416 (28.61%), Postives = 191/416 (45.91%), Query Frame = 1
Query:  259 LHCSCKNGNLDYVKFLID-HKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL-VNIKAPDDSRPIHYACRTG---------------------------------NVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEIL---------------------------------IGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEILRLLITNHCN--IKSTNDENEQPIHVACQKGFVEVVQ 1296
            LH +C NGN    + LID   C++ C +    +PIH ACQ G+ +I K LIE  C MN + ++ F PI YA  +G + +A++LI+    +N       RPIH+A   G                                 NV++V+LL+ + C I   + E    +H ACQ+G  ++V+LL+     C IN A     + IH A  +   EIV+IL                                 I   C I C++ ++  P+H AC NG   IAQLL+D   C+++ +N  +  PI  A +SG + I KLL+    ++ C  R+ +RPIH+A   G  ++   L+   C I C+  +K        +    E LRL+  ++ +  +K+ +  NE  I ++C +  ++ + 
Sbjct:  242 LHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDN--HCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD-SHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKTENNRKNRATVTKEKLRLIHKDNISKEMKNKDIANEVDISISCARSLMKKIH 654          

HSP 5 Score: 138.272 bits (347), Expect = 1.028e-32
Identity = 65/71 (91.55%), Postives = 66/71 (92.96%), Query Frame = 2
Query: 2339 NS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS 2551
            N  KQKPIHLACSSGNLNIVKLLVD GSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNH  +
Sbjct:  533 NDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKT 603          

HSP 6 Score: 63.1586 bits (152), Expect = 1.022e-9
Identity = 29/86 (33.72%), Postives = 54/86 (62.79%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            K++PI +A S+ N+ IV+LL+ +  N++C +  N++PIH AC+ G +++++ L+ N+C I+C N     P+ +    G  + V  L
Sbjct:  371 KRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKIL 456          

HSP 7 Score: 62.7734 bits (151), Expect = 1.341e-9
Identity = 25/56 (44.64%), Postives = 39/56 (69.64%), Query Frame = 2
Query: 2360 IHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 2527
            +H +C +GNL+ VK L+DH  ++EC D    +PIHYAC+ GN D++K L+ + C +
Sbjct:   43 LHCSCKNGNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMM 98          

HSP 8 Score: 61.2326 bits (147), Expect = 4.704e-9
Identity = 28/89 (31.46%), Postives = 46/89 (51.69%), Query Frame = 2
Query: 2339 NS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            N+ + +PIHLAC  G+  I KLL++    +   ++    PI YA  +G +++ K L+ NNC I+C       P+    T G+ +    L
Sbjct:  269 NAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHML 357          

HSP 9 Score: 60.4622 bits (145), Expect = 7.008e-9
Identity = 34/84 (40.48%), Postives = 49/84 (58.33%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVDHG-SNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            PIH AC +G+L + ++L+     N++ PD S  RPIHYAC +GN+DL+K L+ + CAI+  +    T L      G  D V  L
Sbjct:  108 PIHYACMNGHLAVARILISRQLVNIKAPDDS--RPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLL 189          

HSP 10 Score: 60.4622 bits (145), Expect = 7.250e-9
Identity = 33/94 (35.11%), Postives = 55/94 (58.51%), Query Frame = 2
Query: 2336 SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVL 2617
            +N   ++PIH+AC  G + +V+LL+D+  N+ C +    +PIH A ENG ++++K L+ +    +C    + TPL L    G+ D    +SKVL
Sbjct:  400 TNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYD----VSKVL 489          

HSP 11 Score: 55.4546 bits (132), Expect = 2.426e-7
Identity = 25/86 (29.07%), Postives = 47/86 (54.65%), Query Frame = 2
Query: 2348 KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            +++PIH A + G   +  +L+D   ++EC     +RPI  A  N N+++++ L+ N+C I C N  +  P+ +    G+ + V  L
Sbjct:  338 QERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLL 423          

HSP 12 Score: 54.299 bits (129), Expect = 5.202e-7
Identity = 24/69 (34.78%), Postives = 42/69 (60.87%), Query Frame = 2
Query: 2357 PIHLACSSGNLNIVKLLVD-HGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 2560
            P+H AC++GN  I +LL+D    N+ C +    +PIH AC++G+ ++ K L+  NC ++  N    +P+
Sbjct:  241 PLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPI 309          

HSP 13 Score: 51.6026 bits (122), Expect = 3.845e-6
Identity = 27/85 (31.76%), Postives = 44/85 (51.76%), Query Frame = 2
Query: 2354 KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVH-NNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 2605
            + IH AC S +  IV++L+     + C +     P+HYAC NGN  + + L+   +C ++CKN   S P+ L    G+ +    L
Sbjct:  207 RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLL 291          

HSP 14 Score: 50.8322 bits (120), Expect = 7.446e-6
Identity = 33/99 (33.33%), Postives = 49/99 (49.49%), Query Frame = 2
Query: 2336 SNS*KQKPIHLACSSGNLNIVKLLVDHGSNLECPD--RSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDAN 2626
            ++S K   +H AC  GN +IV+LLV      +  D  +S  R IH+AC + + ++++ L+   C I+CKN     PL    T G       L  V D N
Sbjct:  166 ADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCN 264          

HSP 15 Score: 50.447 bits (119), Expect = 9.440e-6
Identity = 24/61 (39.34%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 2354 KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCK 2536
            +PIH AC SGN+++VKLL+     +   D      +HYAC+ GN D+++ LV     + CK
Sbjct:  139 RPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSG--KVQCK 197          
The following BLAST results are available for this feature:
BLAST of SMED30013077 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK22.098e-5225.99ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK22.098e-5225.99ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK22.569e-5225.99ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK28.690e-5226.92ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK12.124e-5125.65ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
back to top
BLAST of SMED30013077 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-442.421e-5426.79AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.421e-5426.79AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.650e-5426.79AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.650e-5426.79AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.750e-5426.79AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30013077 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank22.232e-5124.89gene:FBgn0261788 transcript:FBtr0303119[more]
Ank24.212e-5124.89gene:FBgn0261788 transcript:FBtr0334061[more]
Ank24.120e-5025.05gene:FBgn0261788 transcript:FBtr0303117[more]
Ank24.128e-5025.05gene:FBgn0261788 transcript:FBtr0303124[more]
Ank24.128e-5025.05gene:FBgn0261788 transcript:FBtr0303121[more]
back to top
BLAST of SMED30013077 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b6.224e-5325.00ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b9.251e-5325.00ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b1.833e-5225.00ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b4.688e-5225.05ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b5.933e-5225.05ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30013077 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pan34.561e-5327.39poly(A) specific ribonuclease subunit PAN3 [Source... [more]
ANK11.487e-4924.68ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK13.595e-4924.68ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK13.652e-4924.68ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK13.723e-4926.13ankyrin 1 [Source:NCBI gene;Acc:613080][more]
back to top
BLAST of SMED30013077 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank31.309e-5126.52ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank31.776e-5126.52ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank32.594e-5126.52ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank22.697e-5126.22ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank33.127e-5126.52ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of SMED30013077 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16157|ANK1_HUMAN1.204e-5025.65Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|G5E8K5|ANK3_MOUSE2.320e-5026.52Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q4UMH6|Y381_RICFE8.141e-5028.05Putative ankyrin repeat protein RF_0381 OS=Rickett... [more]
sp|Q12955|ANK3_HUMAN1.325e-4826.52Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|O70511|ANK3_RAT6.550e-4825.70Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
back to top
BLAST of SMED30013077 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q16FI92.276e-9232.71AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
Q16FR12.694e-8833.94AAEL014668-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
A0A1X7T5X65.580e-8235.39Uncharacterized protein OS=Amphimedon queenslandic... [more]
A0A1X7TD772.289e-7935.22ANK_REP_REGION domain-containing protein OS=Amphim... [more]
A0A1X7T2L11.354e-7535.00ANK_REP_REGION domain-containing protein OS=Amphim... [more]
back to top
BLAST of SMED30013077 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3a7.286e-5324.83ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.257e-5226.11ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3b2.989e-5226.92ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a6.791e-5126.04ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank1b8.674e-5124.46ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30013077 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000095.11.157e-6227.65pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.15.446e-6227.52pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000007446.11.763e-4924.33pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.19.736e-4726.67pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000003991.11.655e-3925.52pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
back to top
BLAST of SMED30013077 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NAS62.246e-1525.65Evolutionarily conserved 19S regulatory particle a... [more]
AKR18.795e-1125.61Palmitoyl transferase involved in protein palmitoy... [more]
HOS41.990e-935.71Subunit of the Set3 complex; complex is a meiotic-... [more]
GDE13.791e-723.68Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
AKR26.111e-728.04Ankyrin repeat-containing protein; member of a fam... [more]
back to top
BLAST of SMED30013077 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387021.089e-2425.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436906.060e-1524.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478204.095e-1324.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433814.248e-1334.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308897.007e-1329.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30013077 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b2.358e-5225.27ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ank1a1.729e-5125.32ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ENSORLT00000039458.13.079e-4823.98ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000031565.13.777e-4823.73ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000040233.16.037e-4224.65pep primary_assembly:ASM223467v1:19:16412534:16434... [more]
back to top
BLAST of SMED30013077 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076350.13.572e-14092.55SMESG000076350.1[more]
SMESG000076350.19.909e-14793.28SMESG000076350.1[more]
SMESG000076350.13.317e-14793.28SMESG000076350.1[more]
SMESG000076350.19.687e-14793.27SMESG000076350.1[more]
SMESG000076350.15.085e-14793.27SMESG000076350.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013077 ID=SMED30013077|Name=SMED30013077|organism=Schmidtea mediterranea sexual|type=transcript|length=3259bp
GTTTCGATTATTTAATTTTATAATCTGCAATTTATTAACTAATTAAAGCT
TCCAATTTTTTTGTCATGTTGTGCGTTGCTTAATAATTTTCTTATTAATT
TATTTCTGTGAATCTAAACGCTCTGAATAATGATGTCAAAAAGACTTGAT
GAGTTGATTGGACATTTGAGAAAACAATTAGAAATTGGAAACTCAGACGA
CACAATTAACAATATAATTATCGAAACCATACTTGATTCTAAATCTGGAC
TCAATGCATTGCACTGTTCATGTAAAAACGGAAATTTGGATTATGTAAAG
TTCTTAATCGATCATAAATGCGATATAGAATGTGTGGATTTCCATGGATA
CAAACCGATTCATTATGCCTGCCAAGGAGGAAATCCGGATATCGTGAAAT
ATCTGATTGAAAGCGGATGCATGATGAATTTCCTGCAGGAAAAAGCGTTT
CACCCGATCCATTACGCGTGCATGAATGGACATCTGGCTGTCGCTAGGAT
ACTGATCAGCCGCCAGCTGGTTAATATCAAGGCTCCCGATGATTCAAGGC
CGATACATTATGCTTGTCGGACCGGCAATGTTGACTTGGTGAAATTACTG
CTTGCCAGTAAATGTGCCATTAATGTTGCCGATTCGGAGAAATTCACTGC
ACTCCATTACGCCTGCCAGCAAGGAAACCACGATATTGTACGGCTGTTGG
TTTCAGGGAAAGTCCAATGCAAAATCAACGATGCTACGAAATCAGCAAAT
CGAGCGATTCATTTTGCTTGCATGAGTGAAAGTGAGGAAATTGTTGAAAT
ATTGATCGGGAAGAAATGTGAAATTAATTGCAAAAATGATGAAGAAATGT
TTCCACTTCATTATGCCTGCACAAATGGAAATAAGGCAATCGCACAATTA
CTGATTGATGTTCCAGACTGCAATGTCAACTGCAAAAACGCTGAGGAATT
TTCTCCTATTCTTTATGCGCTGAATAGCGGTCAAATAGAAATCGCGAAAT
TGCTCATCACTAATAATTGTGACATAAATTGTTCGACTCGAACCCAAGAG
AGGCCCATCCATTTCGCCAGCACCCTCGGATTTACCGAGGTGGCCCATAT
GCTCATCGATAGACAATGCGATATTGAATGTGAAACGATTTTAAAAAGGA
GGCCCATCTTTATCGCAAGCTCGAATAATAATGTGGAAATTCTGAGATTA
TTAATTACCAATCACTGCAACATCAAGTCTACCAATGATGAGAATGAGCA
ACCGATTCATGTGGCATGTCAGAAAGGGTTTGTAGAGGTCGTCCAATTAT
TGATTGACAACCACTGCAATATCAACTGTGCAAATGATAAGCTGATGAAG
CCTATTCATATTGCAAGCGAAAACGGCAGGGTAGAAATAGTAAAAATATT
ATTGGAACATGGAGCCGATACAAATTGCATATGTACATATGCTAGGACTC
CTCTTTATCTAGCAACAGAAAAAGGCCATTACGATGTCTCGAAGGTGCTG
ATTGACAATGGGTGTAATATTGAATGCCAATCAATAAAGAAATGGAGGCC
AATTCATAATGCTTGTCAAAACGGTTTCTGTGAGATAGCTCAACTGCTTG
TCGACAGTCACTGCTCTATTGATACCGAGAATGACAATGTTAATTATTTT
TCTCTAATTAATATTTATGTTTATTTCGTCAATTCATTTAAACAAAATAA
TTAAAATCATTTATATCTTTAAATAACCATCCAAAACTCTAAATGTATTG
CCACCGAATTTAATGTTTCTAGTCATCACTCCATTTAAACAAAAAACTAT
TAAAAGCACTTCATTAATCAATTTGATGAAATAATCCGCAAAAATGTTAT
TTCACAGACTTGATGCTACTAAATAGTAGTTATATGATTTTCAACCAAAA
TATAAAAGACCAAACATTCGCAGATGAACGCGTCGGATTTTTAAAGTATT
CCGCGAATTTTGAGCGATGATGCAAATGAATTAATGCAACATTCAGTCGG
GTTGTCTGGCAAATATTAATTTTTAAAGAATACTTTTAATTTCTCTTTTA
TTCAAATATTCAGGTAAAAAAATCCCGAGGCGTAGAGTTAAGATTTTTTG
AGTCCATGGAAATATTAGGATGTCTGCGCATGCCTGATCAAATATTTTAT
TGTCTTCTGCGACAACATATCTTTCCGAAGTCGGGTTTTCTTTAGAATAT
TAATTATCTTAATTTCATTTATTCCTCTGTAAAATAGTAAAACTTAAATT
TGATGCTCAGTACTTGAGAAAGTTTCTGTTTAGATATATAAGTTATTTAT
TTGTAGAAAAATAAAAATATGTAAATTTATAATAAAGTAATTCCTAGAAG
CAAAAGCCGATTCATCTGGCTTGTAGCAGTGGGAATCTAAACATTGTCAA
ATTACTGGTTGACCACGGCTCGAATTTAGAATGTCCAGACCGCTCGAACA
AGCGCCCAATCCATTATGCTTGTGAGAATGGAAACCTTGATTTAATAAAA
GCTTTAGTCCATAACAATTGTGCTATTCATTGTAAGAATCACGCTTCAAG
TACTCCTCTGGATCTACTGAAGACATTTGGATATGACGACTGCGTTTCAT
TCCTCAGTAAAGTATTGGACGCAAATCGCGAAATATTTCATAGGGTTAGA
CATGACGACATCGTGAAATTCAATGAACTATATGATGCGCATACGCTGTT
TGTGCTGGAATATGACACAGGCCTGTCTGTATTGGAAGTAGCCATAGGGA
CCCGTTCCTCCCGAATCATCAACTATATTCTTGATCAACCAATTAATTAT
CAAGAAATCCGGTTTCTGAAAAATGCGTTAAATGATTTTGAAATCAAAGA
AAGAGTTCTTTTAATTCAGGAGTGCTTTCTTCATCGATCGATCTGCGATA
ATGATTCTACAAGTTTTGCCAGGTTTTGCTTGAGAAGTGTTGTCAACCGA
AACGTTCTCCTGGCCGGCACGACATTTTTGGAATTGGCAACTATTCATGG
CAATGACGATTTTGCACAGAAAATAAGAGAAAGGATTTGTTTTCCTAACG
AGAATCCATATTTCAATTTGATGATGGCAATCAAGGACAATGATCCATTT
TCGGTGCAATATTTATTGGCCAAGTTTACCTTCGGTGCAAATCCACGGCA
ATGTTTAAGCACGGCGCTCGGCATTGCGATGTCATTGGATCACCGAATAT
GTTGCGAAGCTATCGTGAGATTCCTTCATTGTCTCTGAGAGTGCTCAAAT
CAAATTCAG
back to top

protein sequence of SMED30013077-orf-1

>SMED30013077-orf-1 ID=SMED30013077-orf-1|Name=SMED30013077-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=525bp
MMSKRLDELIGHLRKQLEIGNSDDTINNIIIETILDSKSGLNALHCSCKN
GNLDYVKFLIDHKCDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMN
FLQEKAFHPIHYACMNGHLAVARILISRQLVNIKAPDDSRPIHYACRTGN
VDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKIN
DATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNG
NKAIAQLLIDVPDCNVNCKNAEEFSPILYALNSGQIEIAKLLITNNCDIN
CSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNN
NVEILRLLITNHCNIKSTNDENEQPIHVACQKGFVEVVQLLIDNHCNINC
ANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGH
YDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE
NDNVNYFSLINIYVYFVNSFKQNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005198structural molecule activity
GO:0005200structural constituent of cytoskeleton
GO:0008093cytoskeletal adaptor activity
GO:0019899enzyme binding
GO:0030507spectrin binding
GO:0051117ATPase binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0014731spectrin-associated cytoskeleton
GO:0016020membrane
GO:0016323basolateral plasma membrane
GO:0016529sarcoplasmic reticulum
GO:0030018Z disc
GO:0030673axolemma
GO:0031430M band
GO:0031672A band
GO:0042383sarcolemma
GO:0043005neuron projection
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
GO:0006888ER to Golgi vesicle-mediated transport
GO:0007010cytoskeleton organization
GO:0007165signal transduction
GO:0010638positive regulation of organelle organization
GO:0045199maintenance of epithelial cell apical/basal polarity
GO:0072661protein targeting to plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 73..88
score: 30.11
coord: 420..434
score: 43.2
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 470..499
e-value: 110.0
score: 11.6
coord: 404..433
e-value: 1.4E-4
score: 31.2
coord: 338..367
e-value: 3.6
score: 16.6
coord: 137..166
e-value: 0.0029
score: 26.9
coord: 238..268
e-value: 1.9
score: 17.5
coord: 371..400
e-value: 0.002
score: 27.4
coord: 72..101
e-value: 2.8E-4
score: 30.2
coord: 39..68
e-value: 7.6E-5
score: 32.1
coord: 272..301
e-value: 0.024
score: 23.8
coord: 205..234
e-value: 5.3
score: 16.0
coord: 437..466
e-value: 0.001
score: 28.3
coord: 170..201
e-value: 3.4E-4
score: 29.9
coord: 305..334
e-value: 250.0
score: 9.5
coord: 105..135
e-value: 0.077
score: 22.1
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 170..202
score: 9.431
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 39..71
score: 9.644
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 371..403
score: 10.713
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 437..469
score: 10.9
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 137..169
score: 11.007
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 272..304
score: 8.95
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 404..432
score: 11.541
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 72..104
score: 11.381
NoneNo IPR availablePFAMPF13637Ank_4coord: 140..191
e-value: 7.1E-13
score: 48.8
coord: 439..491
e-value: 6.8E-7
score: 29.7
NoneNo IPR availablePANTHERPTHR24178FAMILY NOT NAMEDcoord: 108..327
NoneNo IPR availablePANTHERPTHR24178FAMILY NOT NAMEDcoord: 39..226
coord: 339..493
NoneNo IPR availablePANTHERPTHR24178:SF9ANKYRIN REPEAT AND SOCS BOX PROTEIN 3coord: 108..327
NoneNo IPR availablePANTHERPTHR24178:SF9ANKYRIN REPEAT AND SOCS BOX PROTEIN 3coord: 39..226
coord: 339..493
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 429..507
e-value: 4.8E-18
score: 67.2
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 20..340
e-value: 7.3E-82
score: 277.2
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 341..428
e-value: 5.1E-27
score: 96.3
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 36..196
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 141..503
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 35..100
e-value: 7.9E-14
score: 52.0
coord: 344..432
e-value: 1.6E-17
score: 63.9
coord: 210..301
e-value: 1.8E-15
score: 57.3
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 39..502
score: 101.262