Voltage-dependent anion channel 3

Overview
NameVoltage-dependent anion channel 3
Smed IDSMED30013075
Length (bp)1052
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage-dependent anion channel 3 (SMED30013075) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage-dependent anion channel 3 (SMED30013075) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage-dependent anion channel 3 (SMED30013075) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage-dependent anion channel 3 (SMED30013075) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013075

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013075SMESG000000196.1 dd_Smed_v4_738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013075SMESG000000196.1 dd_Smed_v4_738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30013075SMESG000000196.1 dd_Smed_v4_738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013075SMESG000000196.1 dd_Smed_v4_738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013075SMESG000000196.1 dd_Smed_v4_738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013075SMESG000000196.1 dd_Smed_v4_738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013075SMESG000000196.1 dd_Smed_v4_738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013075SMESG000000196.1 dd_Smed_v4_738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30013075SMESG000000196.1 dd_Smed_v4_738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30013075SMESG000000196.1 dd_Smed_v4_738_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013075SMESG000000196.1 dd_Smed_v6_738_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Human
Match: VDAC2 (voltage dependent anion channel 2 [Source:HGNC Symbol;Acc:HGNC:12672])

HSP 1 Score: 169.088 bits (427), Expect = 2.387e-49
Identity = 99/289 (34.26%), Postives = 156/289 (53.98%), Query Frame = 3
Query:   36 LSTMIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            ++  IPPS++DLGKAA+D+F+K F  G+  +++ TK       +     +  T  ++G  E K+   + GL  T KW T N +  EI+   +  +GLK     TF PNTG KS K K SYKRE +N+  +  F+   P I+ + V G    + +L G  +T D+   KL  + FA+GY+  DF     V + + F   +YQK+   +D  V+++        ++GIA +YQ   +  + I  K+N  ++IG+ Y  TL  GV+LTLS+ +DGK ++ G H  G+    E
Sbjct:   25 ITMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFG---YEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPT--ASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELE 308          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Human
Match: VDAC2 (voltage dependent anion channel 2 [Source:HGNC Symbol;Acc:HGNC:12672])

HSP 1 Score: 168.318 bits (425), Expect = 3.236e-49
Identity = 99/286 (34.62%), Postives = 154/286 (53.85%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
             IPPS++DLGKAA+D+F+K F  G+  +++ TK       +     +  T  ++G  E K+   + GL  T KW T N +  EI+   +  +GLK     TF PNTG KS K K SYKRE +N+  +  F+   P I+ + V G    + +L G  +T D+   KL  + FA+GY+  DF     V + + F   +YQK+   +D  V+++        ++GIA +YQ   +  + I  K+N  ++IG+ Y  TL  GV+LTLS+ +DGK ++ G H  G+    E
Sbjct:   13 CIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFG---YEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPT--ASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELE 293          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Human
Match: VDAC2 (voltage dependent anion channel 2 [Source:HGNC Symbol;Acc:HGNC:12672])

HSP 1 Score: 168.318 bits (425), Expect = 3.236e-49
Identity = 99/286 (34.62%), Postives = 154/286 (53.85%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
             IPPS++DLGKAA+D+F+K F  G+  +++ TK       +     +  T  ++G  E K+   + GL  T KW T N +  EI+   +  +GLK     TF PNTG KS K K SYKRE +N+  +  F+   P I+ + V G    + +L G  +T D+   KL  + FA+GY+  DF     V + + F   +YQK+   +D  V+++        ++GIA +YQ   +  + I  K+N  ++IG+ Y  TL  GV+LTLS+ +DGK ++ G H  G+    E
Sbjct:   13 CIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFG---YEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPT--ASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELE 293          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Human
Match: VDAC1 (voltage dependent anion channel 1 [Source:HGNC Symbol;Acc:HGNC:12669])

HSP 1 Score: 163.696 bits (413), Expect = 1.582e-47
Identity = 92/285 (32.28%), Postives = 159/285 (55.79%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITK-KDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+A+D+F K +  G+  +++ TK ++    T     + +T  ++G+ E K+   + GL  T KW T N +  EI+   +  +GLK     +F PNTG K+ K K  YKRE++N+  +  F+   P I   +VLG    + +L G  +  +T   ++    FA+GY+  +F     V + + F   +YQK++  ++  V+++    N   ++GIA +YQ  D D  F   K+N  ++IGL Y  TL  G++LTLS+ +DGK ++ G H  G+G  ++
Sbjct:    3 VPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGY---EGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQI-DPDACF-SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQ 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Human
Match: VDAC1 (voltage dependent anion channel 1 [Source:HGNC Symbol;Acc:HGNC:12669])

HSP 1 Score: 163.696 bits (413), Expect = 1.582e-47
Identity = 92/285 (32.28%), Postives = 159/285 (55.79%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITK-KDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+A+D+F K +  G+  +++ TK ++    T     + +T  ++G+ E K+   + GL  T KW T N +  EI+   +  +GLK     +F PNTG K+ K K  YKRE++N+  +  F+   P I   +VLG    + +L G  +  +T   ++    FA+GY+  +F     V + + F   +YQK++  ++  V+++    N   ++GIA +YQ  D D  F   K+N  ++IGL Y  TL  G++LTLS+ +DGK ++ G H  G+G  ++
Sbjct:    3 VPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGY---EGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQI-DPDACF-SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQ 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Celegans
Match: vdac-1 (Probable voltage-dependent anion-selective channel [Source:UniProtKB/Swiss-Prot;Acc:Q21752])

HSP 1 Score: 103.605 bits (257), Expect = 2.415e-25
Identity = 80/290 (27.59%), Postives = 139/290 (47.93%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHK--TKDLSGNFELKHSNIKAGLDMTLKWCTSNVV--VAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            M PP+F+DLGK+AKDLF+K +  G   ++  T+  D + +  KS   H   +  L GN ++K+   + G+ +T KW T N +  V E+++ + R  GLK      + P+ G +S K K  +      + ++    S  P IN     G      +L G   T D+   KL   + A G+    +     V N + F A +Y K++S V++G  +          Y +A +Y    S D  ++ K+N  + + +    +L+  ++LTLS++ +    D   H FG+G  ++
Sbjct:    1 MAPPTFADLGKSAKDLFNKGYNFGFLKIDSTTRAGDNKEVEFKSAASHNIGSGKLGGNLDVKYKIPQYGITLTEKWNTENQLGTVIEVNEQFGR--GLKVTLDSLYAPHAGKRSGKVKLDWALPTARVTADVGVTS-APVIN---AAGVFSRDGWLIGAAATFDSSSNKLAATSLAFGHSTPQYTLHSFVINSTDFGASLYHKVASNVEVGTQLGWKVGGNGADYALATKYA--PSRDLTVRAKVNSSSQVAVAATHSLSPALKLTLSTQFNLAANDA--HKFGLGLEFD 280          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Fly
Match: porin (gene:FBgn0004363 transcript:FBtr0100584)

HSP 1 Score: 156.377 bits (394), Expect = 4.247e-45
Identity = 96/286 (33.57%), Postives = 151/286 (52.80%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDARTLTVKSKH-DHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            M PPS+SDLGK A+D+F K +  G+  +++ TK  +      + H + ++  + G+ E K+     GL +T KW T N +  E++   + ++GLK      F P +G K+ KFK +Y  E +  +S+   + K P IN + VLG    + +L G     DT+  KL  + FALGY   DF     V +   F+  ++Q+ S  +D+GV +S        K+ I  +YQ    DD+ ++ K+N  + +GL Y   L +GV LTLS+ +DGK  + G H  GVG   E
Sbjct:    1 MAPPSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVKDYGLTLTEKWNTDNTLFTEVAVQDQLLEGLKLSLEGNFAPQSGNKNGKFKVAYGHENVKADSDVNIDLKGPLINASAVLGY---QGWLAGYQTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQEFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQL--DDDASVRAKVNNASQVGLGYQQKLRDGVTLTLSTLVDGKNFNAGGHKIGVGLELE 281          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Fly
Match: porin (gene:FBgn0004363 transcript:FBtr0080183)

HSP 1 Score: 156.377 bits (394), Expect = 4.247e-45
Identity = 96/286 (33.57%), Postives = 151/286 (52.80%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDARTLTVKSKH-DHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            M PPS+SDLGK A+D+F K +  G+  +++ TK  +      + H + ++  + G+ E K+     GL +T KW T N +  E++   + ++GLK      F P +G K+ KFK +Y  E +  +S+   + K P IN + VLG    + +L G     DT+  KL  + FALGY   DF     V +   F+  ++Q+ S  +D+GV +S        K+ I  +YQ    DD+ ++ K+N  + +GL Y   L +GV LTLS+ +DGK  + G H  GVG   E
Sbjct:    1 MAPPSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVKDYGLTLTEKWNTDNTLFTEVAVQDQLLEGLKLSLEGNFAPQSGNKNGKFKVAYGHENVKADSDVNIDLKGPLINASAVLGY---QGWLAGYQTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQEFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQL--DDDASVRAKVNNASQVGLGYQQKLRDGVTLTLSTLVDGKNFNAGGHKIGVGLELE 281          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Fly
Match: porin (gene:FBgn0004363 transcript:FBtr0305260)

HSP 1 Score: 156.377 bits (394), Expect = 4.247e-45
Identity = 96/286 (33.57%), Postives = 151/286 (52.80%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDARTLTVKSKH-DHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            M PPS+SDLGK A+D+F K +  G+  +++ TK  +      + H + ++  + G+ E K+     GL +T KW T N +  E++   + ++GLK      F P +G K+ KFK +Y  E +  +S+   + K P IN + VLG    + +L G     DT+  KL  + FALGY   DF     V +   F+  ++Q+ S  +D+GV +S        K+ I  +YQ    DD+ ++ K+N  + +GL Y   L +GV LTLS+ +DGK  + G H  GVG   E
Sbjct:    1 MAPPSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVKDYGLTLTEKWNTDNTLFTEVAVQDQLLEGLKLSLEGNFAPQSGNKNGKFKVAYGHENVKADSDVNIDLKGPLINASAVLGY---QGWLAGYQTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQEFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQL--DDDASVRAKVNNASQVGLGYQQKLRDGVTLTLSTLVDGKNFNAGGHKIGVGLELE 281          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Fly
Match: porin (gene:FBgn0004363 transcript:FBtr0332029)

HSP 1 Score: 156.377 bits (394), Expect = 4.247e-45
Identity = 96/286 (33.57%), Postives = 151/286 (52.80%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDARTLTVKSKH-DHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            M PPS+SDLGK A+D+F K +  G+  +++ TK  +      + H + ++  + G+ E K+     GL +T KW T N +  E++   + ++GLK      F P +G K+ KFK +Y  E +  +S+   + K P IN + VLG    + +L G     DT+  KL  + FALGY   DF     V +   F+  ++Q+ S  +D+GV +S        K+ I  +YQ    DD+ ++ K+N  + +GL Y   L +GV LTLS+ +DGK  + G H  GVG   E
Sbjct:    1 MAPPSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVKDYGLTLTEKWNTDNTLFTEVAVQDQLLEGLKLSLEGNFAPQSGNKNGKFKVAYGHENVKADSDVNIDLKGPLINASAVLGY---QGWLAGYQTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQEFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQL--DDDASVRAKVNNASQVGLGYQQKLRDGVTLTLSTLVDGKNFNAGGHKIGVGLELE 281          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Fly
Match: porin (gene:FBgn0004363 transcript:FBtr0080182)

HSP 1 Score: 156.377 bits (394), Expect = 4.247e-45
Identity = 96/286 (33.57%), Postives = 151/286 (52.80%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDARTLTVKSKH-DHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            M PPS+SDLGK A+D+F K +  G+  +++ TK  +      + H + ++  + G+ E K+     GL +T KW T N +  E++   + ++GLK      F P +G K+ KFK +Y  E +  +S+   + K P IN + VLG    + +L G     DT+  KL  + FALGY   DF     V +   F+  ++Q+ S  +D+GV +S        K+ I  +YQ    DD+ ++ K+N  + +GL Y   L +GV LTLS+ +DGK  + G H  GVG   E
Sbjct:    1 MAPPSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVKDYGLTLTEKWNTDNTLFTEVAVQDQLLEGLKLSLEGNFAPQSGNKNGKFKVAYGHENVKADSDVNIDLKGPLINASAVLGY---QGWLAGYQTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQEFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQL--DDDASVRAKVNNASQVGLGYQQKLRDGVTLTLSTLVDGKNFNAGGHKIGVGLELE 281          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Zebrafish
Match: vdac3 (voltage-dependent anion channel 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2380])

HSP 1 Score: 174.096 bits (440), Expect = 2.248e-51
Identity = 100/286 (34.97%), Postives = 158/286 (55.24%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILT-FEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+AKD+F K +  G   +++ TK  +    T     +  T   +GN E K+   + GL +  KW T NV+  E++   +  KGLK +G+ T F PNTG KS K K  YKREY+N+  +  F+   P ++   VLG    + +L G  +  DT   KL  + FALGY+  DF     V + + F   +YQK++  ++  V+++    +   ++GIA +YQ     DS +  K+N  +++G+ Y  +L  GV+LTLS+ ID K  + G H  G+GF  E
Sbjct:   38 VPPAYADLGKSAKDIFSKGYGFGTVKLDLKTKSQSGVEFTTGGSSNTDTGKAAGNLETKYKVKELGLSLNQKWNTDNVLTTEVTLEDQLTKGLK-LGLDTSFVPNTGKKSAKLKTGYKREYMNVGCDLDFDLAGPTVHAAAVLGY---EGWLAGYQMAFDTAKSKLAQNNFALGYKAGDFQLHTNVNDGTEFGGSIYQKVNGQLETAVNLAWTAGSNNTRFGIAAKYQL--DKDSSVSAKVNNASLVGVGYTQSLRPGVKLTLSALIDAKNFNAGGHKVGMGFELE 317          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Zebrafish
Match: vdac2 (voltage-dependent anion channel 2 [Source:ZFIN;Acc:ZDB-GENE-030131-845])

HSP 1 Score: 167.933 bits (424), Expect = 2.444e-49
Identity = 95/285 (33.33%), Postives = 159/285 (55.79%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+AKD+F+K +  G+  +++ TK  +          +  T  + G+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKRE++N+  +  F+   P I+   V+G    + +L G  ++ DT   K+  + FA+GY+  DF     V + S F   +YQK+S  ++  V+++    +   ++GIA +YQ     D+ I  K+N  +++G+ Y  +L  G++LTLS+ +DGK +++G H  G+G   E
Sbjct:    3 VPPAYADLGKSAKDIFNKGYGFGMVKLDVKTKSASGVEFKTSGSSNTDTSKVVGSLETKYKRSEYGLTFTEKWNTDNTLGTEINIEDQIAKGLKLTFDTTFSPNTGKKSGKVKTAYKREFVNLGCDVDFDFAGPTIHGAAVVGY---EGWLAGYQMSFDTAKSKMTQNNFAVGYKTGDFQLHTNVNDGSEFGGSIYQKVSDKLETAVNLAWTAGSNSTRFGIAAKYQL--DKDASISAKVNNTSLVGVGYTQSLRPGIKLTLSALVDGKSINSGGHKLGLGLELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Zebrafish
Match: vdac2 (voltage-dependent anion channel 2 [Source:ZFIN;Acc:ZDB-GENE-030131-845])

HSP 1 Score: 167.933 bits (424), Expect = 2.444e-49
Identity = 95/285 (33.33%), Postives = 159/285 (55.79%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+AKD+F+K +  G+  +++ TK  +          +  T  + G+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKRE++N+  +  F+   P I+   V+G    + +L G  ++ DT   K+  + FA+GY+  DF     V + S F   +YQK+S  ++  V+++    +   ++GIA +YQ     D+ I  K+N  +++G+ Y  +L  G++LTLS+ +DGK +++G H  G+G   E
Sbjct:    3 VPPAYADLGKSAKDIFNKGYGFGMVKLDVKTKSASGVEFKTSGSSNTDTSKVVGSLETKYKRSEYGLTFTEKWNTDNTLGTEINIEDQIAKGLKLTFDTTFSPNTGKKSGKVKTAYKREFVNLGCDVDFDFAGPTIHGAAVVGY---EGWLAGYQMSFDTAKSKMTQNNFAVGYKTGDFQLHTNVNDGSEFGGSIYQKVSDKLETAVNLAWTAGSNSTRFGIAAKYQL--DKDASISAKVNNTSLVGVGYTQSLRPGIKLTLSALVDGKSINSGGHKLGLGLELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Zebrafish
Match: zgc:56235 (zgc:56235 [Source:ZFIN;Acc:ZDB-GENE-040426-954])

HSP 1 Score: 163.696 bits (413), Expect = 8.849e-48
Identity = 98/285 (34.39%), Postives = 157/285 (55.09%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITK-KDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP++SDLGK+AKD+F K +  G+  +++ TK ++          +  T   +G+ E K+     GL    KW T N++  E+S   +  +GLK     +F PNTG KS K K SYKRE++N++ +  F  + P ++   VLG    + +L G  +  DT   KL  + FALGY+  DF     V + + F   VYQK+S  ++  V ++    +   ++G+A +YQ     D+ +  K+N  ++IG+ Y  +L  GV+LTLS+ +DGK  +TG H  G+GF  E
Sbjct:    3 VPPAYSDLGKSAKDIFSKGYGFGIVKLDLKTKSQNGVEFNTSGSTNTDTGKAAGSLETKYKLKDLGLSFNQKWNTDNMLTTEVSVEDQLAEGLKVALDTSFVPNTGKKSGKLKTSYKREFVNVSCDLDF--EGPVVHSAAVLGY---EGWLLGYLVAFDTAKSKLVQNNFALGYKTGDFQLHTNVNDGAEFGGSVYQKVSDQLETAVTLAWTAGSNNTRFGVAAKYQL--DKDASLSAKVNNASLIGIGYTQSLRPGVKLTLSALVDGKNFNTGGHKVGLGFELE 280          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Zebrafish
Match: vdac1 (voltage-dependent anion channel 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6514])

HSP 1 Score: 158.688 bits (400), Expect = 8.658e-46
Identity = 93/286 (32.52%), Postives = 160/286 (55.94%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDARTLTVKSK--HDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP++ DLGK+A+D+F K +  G+  +++ T+ +   L  KS    + +T  ++G  E K+   + GL  T KW T N +  EI+   +  KGLK     +F PNTG KS K K SY+RE++N+  +  ++     ++  +VLG      +L G  +T +    ++    FA+GY+  +F     V + + F   +YQK++  ++  V+++    N   ++GIA +YQ  DSD +F   K+N  +++GL Y  TL  G++LTLS+ +DGK ++ G H  G+G  +E
Sbjct:    3 VPPTYVDLGKSARDIFTKGYGFGLIKLDLKTRSE-NGLEFKSSGSANTETSKVAGTLETKYKWAEHGLTFTEKWNTDNTLGTEITLEDQLTKGLKLTFDSSFSPNTGKKSGKIKSSYQREHINLGCDVDYDINGTAVHGALVLGL---DGWLAGYQMTFEAGRNRITQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNDNLETAVNLAWTAGNSNTRFGIAAKYQI-DSDAAF-SAKVNNSSLVGLGYTQTLKPGIKLTLSALLDGKNINAGGHKMGLGLEFE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Xenopus
Match: vdac2 (voltage-dependent anion channel 2 [Source:NCBI gene;Acc:548947])

HSP 1 Score: 174.096 bits (440), Expect = 1.786e-51
Identity = 105/292 (35.96%), Postives = 164/292 (56.16%), Query Frame = 3
Query:   30 FSLSTM-IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
             SL TM +PPS++DLGK+A+D+F+K +  G+  +++ TK             +  +  ++G+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKREY+N+  +  F+   P I+ + V+G    + +L G  +T D+   KL  + FA+GY+  DF     V + S F   +YQK+S  ++  V+++    N   ++GIA +YQ  DS  S I  K+N  +++G+ Y  TL  GV+LTLS+ +DGK ++ G H  G+G   E
Sbjct:    8 MSLGTMAVPPSYADLGKSARDIFNKGYGFGLVKLDVKTKSATGVEFATSGSSNTDSGKVNGSLETKYKWGEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKREYVNLGCDVDFDFAGPAIHGSAVVGY---EGWLAGYQMTFDSAKSKLTKNNFAVGYKTGDFQLHTNVNDGSEFAGSIYQKVSDKMETAVNLAWTSGNNSTRFGIAAKYQL-DSHAS-ISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKNINAGGHKLGLGLELE 294          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Xenopus
Match: vdac2 (voltage-dependent anion channel 2 [Source:NCBI gene;Acc:548947])

HSP 1 Score: 174.096 bits (440), Expect = 3.397e-51
Identity = 105/292 (35.96%), Postives = 164/292 (56.16%), Query Frame = 3
Query:   30 FSLSTM-IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
             SL TM +PPS++DLGK+A+D+F+K +  G+  +++ TK             +  +  ++G+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKREY+N+  +  F+   P I+ + V+G    + +L G  +T D+   KL  + FA+GY+  DF     V + S F   +YQK+S  ++  V+++    N   ++GIA +YQ  DS  S I  K+N  +++G+ Y  TL  GV+LTLS+ +DGK ++ G H  G+G   E
Sbjct:   30 MSLGTMAVPPSYADLGKSARDIFNKGYGFGLVKLDVKTKSATGVEFATSGSSNTDSGKVNGSLETKYKWGEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKREYVNLGCDVDFDFAGPAIHGSAVVGY---EGWLAGYQMTFDSAKSKLTKNNFAVGYKTGDFQLHTNVNDGSEFAGSIYQKVSDKMETAVNLAWTSGNNSTRFGIAAKYQL-DSHAS-ISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKNINAGGHKLGLGLELE 316          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Xenopus
Match: vdac2 (voltage-dependent anion channel 2 [Source:NCBI gene;Acc:548947])

HSP 1 Score: 171.785 bits (434), Expect = 1.519e-50
Identity = 102/291 (35.05%), Postives = 162/291 (55.67%), Query Frame = 3
Query:   30 FSLSTMIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            F  +  +PPS++DLGK+A+D+F+K +  G+  +++ TK             +  +  ++G+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKREY+N+  +  F+   P I+ + V+G    + +L G  +T D+   KL  + FA+GY+  DF     V + S F   +YQK+S  ++  V+++    N   ++GIA +YQ  DS  S I  K+N  +++G+ Y  TL  GV+LTLS+ +DGK ++ G H  G+G   E
Sbjct:   16 FKGTMAVPPSYADLGKSARDIFNKGYGFGLVKLDVKTKSATGVEFATSGSSNTDSGKVNGSLETKYKWGEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKREYVNLGCDVDFDFAGPAIHGSAVVGY---EGWLAGYQMTFDSAKSKLTKNNFAVGYKTGDFQLHTNVNDGSEFAGSIYQKVSDKMETAVNLAWTSGNNSTRFGIAAKYQL-DSHAS-ISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKNINAGGHKLGLGLELE 301          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Xenopus
Match: vdac2 (voltage-dependent anion channel 2 [Source:NCBI gene;Acc:548947])

HSP 1 Score: 171.4 bits (433), Expect = 1.738e-50
Identity = 101/285 (35.44%), Postives = 160/285 (56.14%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PPS++DLGK+A+D+F+K +  G+  +++ TK             +  +  ++G+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKREY+N+  +  F+   P I+ + V+G    + +L G  +T D+   KL  + FA+GY+  DF     V + S F   +YQK+S  ++  V+++    N   ++GIA +YQ  DS  S I  K+N  +++G+ Y  TL  GV+LTLS+ +DGK ++ G H  G+G   E
Sbjct:    3 VPPSYADLGKSARDIFNKGYGFGLVKLDVKTKSATGVEFATSGSSNTDSGKVNGSLETKYKWGEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKREYVNLGCDVDFDFAGPAIHGSAVVGY---EGWLAGYQMTFDSAKSKLTKNNFAVGYKTGDFQLHTNVNDGSEFAGSIYQKVSDKMETAVNLAWTSGNNSTRFGIAAKYQL-DSHAS-ISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKNINAGGHKLGLGLELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Xenopus
Match: vdac2 (voltage-dependent anion channel 2 [Source:NCBI gene;Acc:548947])

HSP 1 Score: 171.014 bits (432), Expect = 2.171e-50
Identity = 101/285 (35.44%), Postives = 160/285 (56.14%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PPS++DLGK+A+D+F+K +  G+  +++ TK             +  +  ++G+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKREY+N+  +  F+   P I+ + V+G    + +L G  +T D+   KL  + FA+GY+  DF     V + S F   +YQK+S  ++  V+++    N   ++GIA +YQ  DS  S I  K+N  +++G+ Y  TL  GV+LTLS+ +DGK ++ G H  G+G   E
Sbjct:    8 VPPSYADLGKSARDIFNKGYGFGLVKLDVKTKSATGVEFATSGSSNTDSGKVNGSLETKYKWGEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKREYVNLGCDVDFDFAGPAIHGSAVVGY---EGWLAGYQMTFDSAKSKLTKNNFAVGYKTGDFQLHTNVNDGSEFAGSIYQKVSDKMETAVNLAWTSGNNSTRFGIAAKYQL-DSHAS-ISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKNINAGGHKLGLGLELE 287          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Mouse
Match: Vdac2 (voltage-dependent anion channel 2 [Source:MGI Symbol;Acc:MGI:106915])

HSP 1 Score: 167.162 bits (422), Expect = 5.162e-49
Identity = 99/286 (34.62%), Postives = 150/286 (52.45%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
             IPP ++DLGKAA+D+F+K F  G+  +++ TK       +     +  T  +SG  E K+   + GL  T KW T N +  EI+   +  +GLK     TF PNTG KS K K +YKRE +N+  +  F+   P I+ + V G    + +L G  +T D+   KL    FA+GY+  DF     V N + F   +YQK+    D  V+++        ++GIA +YQ   +  + I  K+N  ++IG+ Y  TL  GV+LTLS+ +DGK  + G H  G+    E
Sbjct:    2 CIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFG---YEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPT--ASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Mouse
Match: Vdac2 (voltage-dependent anion channel 2 [Source:MGI Symbol;Acc:MGI:106915])

HSP 1 Score: 167.162 bits (422), Expect = 5.162e-49
Identity = 99/286 (34.62%), Postives = 150/286 (52.45%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
             IPP ++DLGKAA+D+F+K F  G+  +++ TK       +     +  T  +SG  E K+   + GL  T KW T N +  EI+   +  +GLK     TF PNTG KS K K +YKRE +N+  +  F+   P I+ + V G    + +L G  +T D+   KL    FA+GY+  DF     V N + F   +YQK+    D  V+++        ++GIA +YQ   +  + I  K+N  ++IG+ Y  TL  GV+LTLS+ +DGK  + G H  G+    E
Sbjct:    2 CIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFG---YEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPT--ASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Mouse
Match: Vdac2 (voltage-dependent anion channel 2 [Source:MGI Symbol;Acc:MGI:106915])

HSP 1 Score: 167.162 bits (422), Expect = 7.208e-49
Identity = 99/286 (34.62%), Postives = 150/286 (52.45%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
             IPP ++DLGKAA+D+F+K F  G+  +++ TK       +     +  T  +SG  E K+   + GL  T KW T N +  EI+   +  +GLK     TF PNTG KS K K +YKRE +N+  +  F+   P I+ + V G    + +L G  +T D+   KL    FA+GY+  DF     V N + F   +YQK+    D  V+++        ++GIA +YQ   +  + I  K+N  ++IG+ Y  TL  GV+LTLS+ +DGK  + G H  G+    E
Sbjct:   14 CIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFG---YEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPT--ASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALELE 294          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Mouse
Match: Vdac1 (voltage-dependent anion channel 1 [Source:MGI Symbol;Acc:MGI:106919])

HSP 1 Score: 162.54 bits (410), Expect = 2.683e-47
Identity = 92/285 (32.28%), Postives = 159/285 (55.79%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITK-KDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+A+D+F K +  G+  +++ TK ++    T     + +T  ++G+ E K+   + GL  T KW T N +  EI+   +  +GLK     +F PNTG K+ K K  YKRE++N+  +  F+   P I   +VLG    + +L G  +  +T   ++    FA+GY+  +F     V + + F   +YQK++  ++  V+++    N   ++GIA +YQ  D D  F   K+N  ++IGL Y  TL  G++LTLS+ +DGK ++ G H  G+G  ++
Sbjct:    3 VPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGY---EGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQV-DPDACF-SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQ 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Mouse
Match: Vdac1 (voltage-dependent anion channel 1 [Source:MGI Symbol;Acc:MGI:106919])

HSP 1 Score: 162.155 bits (409), Expect = 5.377e-47
Identity = 92/285 (32.28%), Postives = 159/285 (55.79%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITK-KDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+A+D+F K +  G+  +++ TK ++    T     + +T  ++G+ E K+   + GL  T KW T N +  EI+   +  +GLK     +F PNTG K+ K K  YKRE++N+  +  F+   P I   +VLG    + +L G  +  +T   ++    FA+GY+  +F     V + + F   +YQK++  ++  V+++    N   ++GIA +YQ  D D  F   K+N  ++IGL Y  TL  G++LTLS+ +DGK ++ G H  G+G  ++
Sbjct:   16 VPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGY---EGWLAGYQMNFETSKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQV-DPDACF-SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQ 295          
BLAST of Voltage-dependent anion channel 3 vs. UniProt/SwissProt
Match: sp|P82013|VDAC2_MELGA (Voltage-dependent anion-selective channel protein 2 OS=Meleagris gallopavo OX=9103 GN=VDAC2 PE=1 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.062e-49
Identity = 102/286 (35.66%), Postives = 160/286 (55.94%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
             IPPS++DLGK+A+D+F+K +  G+  +++ TK  +    T     +  T  ++G+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKRE LN+  +  F+   P I+ + V G    + +L G  +T D+   KL  + F++GY+  DF     V + S F   +YQK+S  ++  V+++    +   ++GIA +Y+  DS  S I  K+N  +++G+ Y  TL  GV+LTLS+ IDGK ++ G H  G+G   E
Sbjct:    1 AIPPSYADLGKSARDIFNKGYGFGLVKLDVKTKSASGVEFTTSGSSNTDTGKVNGSLETKYKWAEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKIKSAYKRECLNLGCDVDFDFAGPAIHGSAVFGY---EGWLAGYQMTFDSAKSKLTRNNFSVGYKTGDFQLHTNVNDGSEFGGSIYQKVSDNLETAVNLAWTAGSNSTRFGIAAKYKL-DSTAS-ISAKVNNSSLVGVGYTQTLRPGVKLTLSALIDGKSINAGGHKLGLGLELE 281          
BLAST of Voltage-dependent anion channel 3 vs. UniProt/SwissProt
Match: sp|P81004|VDAC2_XENLA (Voltage-dependent anion-selective channel protein 2 OS=Xenopus laevis OX=8355 GN=vdac2 PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 3.783e-49
Identity = 100/285 (35.09%), Postives = 161/285 (56.49%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PPS++DLGK+A+D+F+K +  G+  +++ TK       T     +  +  ++G+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YK+EY+N+  +  F+   P I+ + V+G    + +L G  +T D+   KL  + FA+GY+  DF     V + S F   +YQK+S  ++  V+++    N   ++GIA +YQ  DS  + I  K+N  +++G+ Y  TL  GV+LTLS+ +DGK ++ G H  G+G   E
Sbjct:    2 VPPSYADLGKSARDIFNKGYGFGLVKLDVKTKSATGVEFTTSGTSNTDSGKVNGSLETKYKWGEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKQEYVNLGCDVDFDFAGPAIHGSAVVGY---EGWLAGYQMTFDSAKSKLTKNNFAVGYKTGDFQLHTNVNDGSEFAGSIYQKVSDKMETAVNLAWTSGNNSTRFGIAAKYQL-DSHAA-ISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKNINAGGHKLGLGLELE 281          
BLAST of Voltage-dependent anion channel 3 vs. UniProt/SwissProt
Match: sp|P68003|VDAC2_RABIT (Voltage-dependent anion-selective channel protein 2 OS=Oryctolagus cuniculus OX=9986 GN=VDAC2 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.048e-48
Identity = 99/286 (34.62%), Postives = 154/286 (53.85%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
             IPPS++DLGKAA+D+F+K F  G+  +++ TK       +     +  T  ++G  E K+   + GL  T KW T N +  EI+   +  +GLK     TF PNTG KS K K SYKRE +N+  +  F+   P I+ + V G    + +L G  +T D+   KL  + FA+GY+  DF     V + + F   +YQK+   +D  V+++        ++GIA +YQ   +  + I  K+N  ++IG+ Y  TL  GV+LTLS+ +DGK ++ G H  G+    E
Sbjct:   13 CIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFG---YEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPT--ASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLALELE 293          
BLAST of Voltage-dependent anion channel 3 vs. UniProt/SwissProt
Match: sp|P68002|VDAC2_BOVIN (Voltage-dependent anion-selective channel protein 2 OS=Bos taurus OX=9913 GN=VDAC2 PE=2 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 1.048e-48
Identity = 99/286 (34.62%), Postives = 154/286 (53.85%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
             IPPS++DLGKAA+D+F+K F  G+  +++ TK       +     +  T  ++G  E K+   + GL  T KW T N +  EI+   +  +GLK     TF PNTG KS K K SYKRE +N+  +  F+   P I+ + V G    + +L G  +T D+   KL  + FA+GY+  DF     V + + F   +YQK+   +D  V+++        ++GIA +YQ   +  + I  K+N  ++IG+ Y  TL  GV+LTLS+ +DGK ++ G H  G+    E
Sbjct:   13 CIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFG---YEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPT--ASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLALELE 293          
BLAST of Voltage-dependent anion channel 3 vs. UniProt/SwissProt
Match: sp|Q9MZ15|VDAC2_PIG (Voltage-dependent anion-selective channel protein 2 OS=Sus scrofa OX=9823 GN=VDAC2 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.283e-48
Identity = 99/286 (34.62%), Postives = 154/286 (53.85%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
             IPPS++DLGKAA+D+F+K F  G+  +++ TK       +     +  T  ++G  E K+   + GL  T KW T N +  EI+   +  +GLK     TF PNTG KS K K SYKRE +N+  +  F+   P I+ + V G    + +L G  +T D+   KL  + FA+GY+  DF     V + + F   +YQK+   +D  V+++        ++GIA +YQ   +  + I  K+N  ++IG+ Y  TL  GV+LTLS+ +DGK ++ G H  G+    E
Sbjct:   13 CIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECVNLGCDVDFDFAGPAIHGSAVFG---YEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPT--ASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLALELE 293          
BLAST of Voltage-dependent anion channel 3 vs. TrEMBL
Match: A0A3Q3B8T3 (Voltage-dependent anion channel 2 OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.090e-50
Identity = 102/285 (35.79%), Postives = 160/285 (56.14%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+AKD+F+K F  G+  +++ TK  +          +  T  +SG  E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKREY+N+  +  F+   P I+   V+G    + +LTG  ++ DT   ++  + FA+GY+  DF  L  V N S F   +YQK+S  ++  V+++    N   ++G+A +YQ     D+ I  K+N ++++G+ Y  TL  GV+LTLS  +DGK ++ G H  G+G   E
Sbjct:    3 VPPTYADLGKSAKDIFNKGFGFGMVKLDVKTKSANGVEFKTSGSSNTDTSKVSGTLETKYKRPEYGLTFTEKWNTDNSLGTEITVEDQIAKGLKLTFDTTFSPNTGKKSGKVKTAYKREYINVGCDVDFDFAGPTIHGAGVVGY---EGWLTGYQMSFDTAKSRMIQNNFAIGYKTGDFQLLTNVNNGSEFGGSIYQKVSDKLETAVNLAWTAGNNSTQFGMAAKYQL--DKDASISAKVNNNSLVGVGYTQTLRPGVKLTLSGLVDGKNINAGGHKLGLGLELE 282          
BLAST of Voltage-dependent anion channel 3 vs. TrEMBL
Match: A0A3P8WWK1 (Voltage-dependent anion channel 3 OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 7.949e-50
Identity = 103/285 (36.14%), Postives = 155/285 (54.39%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PPSF+DLGK+AKD+F+K F  GV  +++ TK  +    T     +  T    G+ E K+     GL    KW T N +  EI+   +  KGLK     +  PNTG KS K K +YKR+Y+N+  +  F+   P ++   VLG    + +L G  L  DT   KL  + FALGY+ +DF     V + + F   +YQK++S ++  VH++    +   ++GI  +YQ     DS +  K+N   ++GL Y  TL  GV+LTLS+ +DGK ++ G H  G+GF  E
Sbjct:   32 VPPSFADLGKSAKDIFNKGFGYGVLKLDVKTKSQSGVEFTTSGSSNTDTGRSGGHLETKYKLSDLGLSFNQKWNTDNTLTTEITMEDQLAKGLKLALDTSCVPNTGKKSAKLKTAYKRDYINMGCDLDFDMAGPTVSATAVLG---YEGWLAGYQLAFDTAKSKLTQNNFALGYKAADFQLHTNVNDSTEFGGSIYQKVNSNLETAVHLAWIAGSNNTRFGIGAKYQL--DKDSSLSAKVNNSCLVGLGYTQTLRPGVKLTLSALVDGKNVNGGGHKLGMGFELE 311          
BLAST of Voltage-dependent anion channel 3 vs. TrEMBL
Match: A0A401T5U1 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0016503 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 8.594e-50
Identity = 103/285 (36.14%), Postives = 161/285 (56.49%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PPS++DLGKAA+D+F+K +  G+  +E+ TK  +    T     + ++  +SG+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS + K +YKREY+N+  +  F+   P I+ + V G    + +L G  ++ DT   KL  + FA+GY+  DF     V + + F   +YQK+S  +D  V+++    N   ++GIA +YQ  DS  S I  K+N  ++IG+ Y   L  G++LTL + IDGK +++G H  G+G   E
Sbjct:   60 VPPSYADLGKAARDIFNKGYGFGLIKLEVKTKSQSGVEFTTSGSSNTESGKVSGSLETKYKWSEYGLTFTEKWNTDNTLGTEIAIEDQLAKGLKLTFDTTFSPNTGKKSGRVKTAYKREYINLGCDVDFDFAGPAIHASAVAGY---EGWLAGYQMSFDTAKSKLTQNNFAVGYKTGDFQLHTNVNDGAEFGGSIYQKVSDNLDTAVNLAWTAGNNSTRFGIAAKYQL-DSTAS-ISAKVNNSSLIGIGYSQILRPGIKLTLCTLIDGKSINSGGHKLGLGLELE 339          
BLAST of Voltage-dependent anion channel 3 vs. TrEMBL
Match: A0A2I4AYE8 (voltage-dependent anion-selective channel protein 2 OS=Austrofundulus limnaeus OX=52670 GN=vdac2 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.278e-49
Identity = 103/285 (36.14%), Postives = 157/285 (55.09%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+AKD+F K F  GV  +++ TK  +          +  T  +SG+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKREY+N+  +  F+   P I+   V+G    + +L G  ++ DT   ++  + FA+GY+  DF  L  V N S F   +YQK S  ++  V++S    N    +GIA ++Q     D+ I  K+N +++IG+ Y  +L  GV+LTLS  +DGK ++ G H  G+G   E
Sbjct:    3 VPPTYADLGKSAKDIFSKGFGFGVVKLDVKTKSANGVEFKTSGSSNTDTSKVSGSLETKYKRPEYGLTFTEKWNTDNTLGTEITVEDQIAKGLKLTFDTTFSPNTGKKSGKVKTAYKREYINVGCDVDFDFAGPTIHGAGVVGY---EGWLAGYQMSFDTAKSRMIQNNFAIGYRTGDFHLLTNVNNGSEFGGSIYQKCSDKLETAVNLSWTAGNNSTNFGIAAKFQL--DKDASISAKVNNNSLIGVGYTQSLRPGVKLTLSGLVDGKNINAGGHKLGLGLELE 282          
BLAST of Voltage-dependent anion channel 3 vs. TrEMBL
Match: A0A060X1M1 (Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023471001 PE=4 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 2.301e-49
Identity = 100/285 (35.09%), Postives = 160/285 (56.14%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PPS+ DLGK+AKD+F+K +  G+  +++ TK D+          +  T  ++G+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKRE++N+  +  F+   P I+   V+G    + +L G  +T DT   K+  + FA+GY+  DF     V + + F   +YQK+S  ++  V+++    +    +GIA +YQ   S  + I  K+N ++++G+ Y  TL  GV+LTLS+ +DGK ++TG H  G+G   E
Sbjct:    3 VPPSYGDLGKSAKDIFNKGYGFGLVKLDVKTKSDSGVEFKTAGSSNTDTSKVAGSLETKYKRSEYGLTFTEKWNTDNTLGTEITVEDQIAKGLKLTFDTTFSPNTGKKSGKVKTAYKREFVNLGCDVDFDFAGPTIHGAAVVGY---EGWLAGYQMTFDTAKSKMTQNNFAVGYKTGDFQLHTNVNDGAQFGGSIYQKVSPVLETAVNLAWTAGSNSTNFGIAAKYQLDKS--ASISAKVNNNSLVGVGYTQTLRPGVKLTLSALVDGKGINTGGHKLGLGLELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Cavefish
Match: VDAC2 (voltage-dependent anion-selective channel protein 2 [Source:NCBI gene;Acc:103040512])

HSP 1 Score: 176.022 bits (445), Expect = 1.586e-52
Identity = 100/282 (35.46%), Postives = 158/282 (56.03%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGF 890
            +PP+++DLGK+AKD+F+K +  G+  +++ TK  +          +  T  ++GN E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKRE+LN+  +  F+   P ++   VLG    + +L G  +T DT   K+  + FA+GY+  DF     V + S F   +YQK++  ++  V+++    N   ++GIA +YQ   S  S I  K+N  +++G+ Y  TL  GV+LTLS+ +DGK ++ G H  G+G 
Sbjct:    3 VPPAYADLGKSAKDIFNKGYGFGLVKLDVKTKSANGVEFKTSGSSNTDTNKVTGNLETKYKWDEYGLTFTEKWNTDNTLGTEITVEDQITKGLKLTFDTTFSPNTGKKSGKVKTAYKREFLNVGCDVDFDFAGPAVHGAAVLGF---EGWLAGYQMTFDTAKSKMTRNNFAIGYKTGDFQLHTNVNDGSEFGGSIYQKVNDELETAVNLAWTAGNNSTRFGIAAKYQLDSS--SSISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLGL 279          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Cavefish
Match: vdac3 (voltage dependent anion channel 3 [Source:NCBI gene;Acc:103039704])

HSP 1 Score: 172.94 bits (437), Expect = 2.269e-51
Identity = 101/286 (35.31%), Postives = 156/286 (54.55%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILT-FEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+AKD+F K +  G   +++ TK  +    +     +  T   SGN E K+     GL+   KW T N +  EIS   +  KGLK +G+ T F PNTG KS K K  YKREY+N+  +  F+   P ++   VLG    + +L G  +  DT   KL  + FALGY+  DF     V + + F   +YQK++S ++  V+++    +   ++GIA +YQ     D+ +  K+N  +++G+ Y   L  GV+LTLS+ ID K  + G H  G+GF  E
Sbjct:    3 VPPAYADLGKSAKDIFSKGYGFGTVKLDLKTKSQSGVEFSTGGSSNTDTGKASGNLETKYKVKDLGLNFNQKWNTDNTLTTEISMEDQLAKGLK-LGLDTSFVPNTGKKSAKLKTGYKREYMNVGCDIDFDLAGPTVHAAAVLGY---EGWLAGYQMAFDTAKSKLAQNNFALGYKAGDFQLHTNVNDGTEFGGSIYQKVNSELETAVNLAWTAGSNNTRFGIAAKYQL--DKDASVSAKVNNASLVGVGYTQALRPGVKLTLSALIDAKNFNAGGHKVGMGFELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Cavefish
Match: vdac2 (voltage-dependent anion-selective channel protein 2 [Source:NCBI gene;Acc:103037680])

HSP 1 Score: 169.474 bits (428), Expect = 4.909e-50
Identity = 97/285 (34.04%), Postives = 157/285 (55.09%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP ++DLGK+AKD+F+K +  G+  +++ TK  +          +  T  + G+ E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKRE++N+  +  F+   P I+   V+G    + +L G  ++ DT   K+  + FA+GY+  DF     V + S F   +YQK+S  ++  V+++    +   ++GIA +YQ     D+ I  K+N  +++G+ Y  TL  GV+LTLS+ +DGK ++ G H  G+G   E
Sbjct:    3 VPPCYADLGKSAKDIFNKGYGFGLVKLDVKTKSSSGVEFKTSGSSNTDTSKVVGSLETKYKRSEYGLTFTEKWNTDNTLGTEITIEDQIAKGLKLTFDTTFSPNTGKKSGKVKTAYKREFVNLGCDVDFDFAGPTIHGAAVVGY---EGWLAGYQMSFDTAKSKMTQNNFAVGYKTGDFQLHTNVNDGSEFGGSIYQKVSDNLETAVNLAWTAGSNSTRFGIAAKYQL--DKDASISAKVNNTSLVGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLGLELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Cavefish
Match: vdac1 (voltage dependent anion channel 1 [Source:NCBI gene;Acc:103024199])

HSP 1 Score: 156.377 bits (394), Expect = 4.413e-45
Identity = 95/286 (33.22%), Postives = 159/286 (55.59%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDARTLTVKS--KHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP++ DLGK+AKD+F K +  G+  +++ TK +   L  KS    + +T  +SG  E K+   + GL  T KW T N +  EI+   +  KGLK     +F PNTG KS K K  YKRE++N+  +  ++     ++  +V+G    + +L G  +T +    ++    FA+GY+  +F     V + + F   +YQK++  ++  V+++    N   ++GIA +YQ  D+D SF   K+N  +++GL Y  TL  G++LTLS+ +DGK ++ G H  G+G   E
Sbjct:    3 VPPTYVDLGKSAKDVFTKGYGFGLIKLDLKTKSE-NGLEFKSAGSANTETSKVSGALETKYKWAEHGLTFTEKWNTDNTLGTEITLEDQLAKGLKLTFDSSFSPNTGKKSGKIKSGYKREHINLGCDVDYDINGTAVHGAVVVGY---EGWLAGYQMTFEAGKNRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNDKLETAVNLAWTAGNSNTRFGIAAKYQI-DADASF-SAKVNNSSLVGLGYTQTLKPGIKLTLSALLDGKNINAGGHKLGLGLELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Cavefish
Match: vdac3 (voltage dependent anion channel 3 [Source:NCBI gene;Acc:103039704])

HSP 1 Score: 147.902 bits (372), Expect = 6.087e-41
Identity = 88/261 (33.72%), Postives = 139/261 (53.26%), Query Frame = 3
Query:   39 STMIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILT-FEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNG 815
            S  +PP+++DLGK+AKD+F K +  G   +++ TK  +    +     +  T   SGN E K+     GL+   KW T N +  EIS   +  KGLK +G+ T F PNTG KS K K  YKREY+N+  +  F+   P ++   VLG    + +L G  +  DT   KL  + FALGY+  DF     V + + F   +YQK++S ++  V+++    +   ++GIA +YQ     D+ +  K+N  +++G+ Y   L  G
Sbjct:   77 SMAVPPAYADLGKSAKDIFSKGYGFGTVKLDLKTKSQSGVEFSTGGSSNTDTGKASGNLETKYKVKDLGLNFNQKWNTDNTLTTEISMEDQLAKGLK-LGLDTSFVPNTGKKSAKLKTGYKREYMNVGCDIDFDLAGPTVHAAAVLG---YEGWLAGYQMAFDTAKSKLAQNNFALGYKAGDFQLHTNVNDGTEFGGSIYQKVNSELETAVNLAWTAGSNNTRFGIAAKYQL--DKDASVSAKVNNASLVGVGYTQALRPG 331          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Sea Lamprey
Match: vdac2 (voltage-dependent anion channel 2 [Source:ZFIN;Acc:ZDB-GENE-030131-845])

HSP 1 Score: 172.555 bits (436), Expect = 6.907e-52
Identity = 100/285 (35.09%), Postives = 158/285 (55.44%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+F DLGK+A+D+F K F  G+  +++ TK  +    +     + +T  ++ + E K+     GL++T KW T N +  EIS   +  KGLK     TF PNTG KS K K +YKREYLN+  +   +   P +N   V+G    + +L G  L  DT   KL    FA+GY+ +DF     V + + F   +YQK++  ++  V ++    +   ++GIA +YQ  DS+ + I  K+N  +++GL Y  TL  GV+L+LS+ +DGK ++ G H  G+G   E
Sbjct:    3 VPPTFVDLGKSARDVFSKGFGFGLVKLDLKTKTSSGVEFSTSGSSNSETGKVNASLETKYKWADYGLNLTEKWSTDNTLATEISVEDQLAKGLKLTLDTTFAPNTGKKSGKLKSTYKREYLNLGCDVDLDFAGPTVNGAAVVGY---EGWLAGYQLAFDTAKSKLTRSNFAIGYKTADFQLHTNVNDGTEFGGNIYQKVNDKLETAVDLAWTAGSNTTRFGIAAKYQL-DSNTT-INAKVNNSSLVGLGYTQTLRPGVKLSLSALLDGKNINAGGHKLGLGLELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005399.1 (pep scaffold:Pmarinus_7.0:GL479471:12985:19564:-1 gene:ENSPMAG00000004891.1 transcript:ENSPMAT00000005399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.316 bits (290), Expect = 1.382e-30
Identity = 73/284 (25.70%), Postives = 140/284 (49.30%), Query Frame = 3
Query:   51 PPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            PP F  LG+AA+++F K +  G+  ++  T+  +      +      +  +SG  E ++S  + GL +   W T N +   IS   +  KGL+ V   +F PNTG K+   K  Y R +++  ++   +   P +  ++VL     + +L G  + +D   +K+ ++  +LGY   DF  L  V +   F+   +Q++S  +D  V ++ +      ++ + G Y+     ++ +  K+N  +++GL Y   L  GV+L+L   +D K +++G H  G+G   E
Sbjct:    4 PPFFESLGEAAREVFTKGYGFGLVKLDFTTRAASGVEFNTRGASHTDSGRVSGALETRYSWPEHGLRLVECWSTDNCLGTRISVDDQLAKGLQLVFDTSFSPNTGKKTGLVKVLYARPFVSATTDVDVSLGGPIVASSVVLAA---RGWLAGYHMGLDVGKRKITSNRISLGYMTEDFQLLTNVVDGVEFSGSYFQRVSERLDTAVRLAWSAGAPHPRFTLGGTYKI--DQNASVSGKMNSASLLGLSYTQALRPGVKLSLCGLLDVKNINSGGHKLGLGLELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Yeast
Match: POR1 (Mitochondrial porin (voltage-dependent anion channel); outer membrane protein required for maintenance of mitochondrial osmotic stability and mitochondrial membrane permeability; couples the glutathione pools of the intermembrane space (IMS) and the cytosol; interacts with Om45 and Om14 in the outer membrane; phosphorylated; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000005000])

HSP 1 Score: 71.2478 bits (173), Expect = 1.423e-14
Identity = 68/290 (23.45%), Postives = 120/290 (41.38%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVS---NVEIITKKDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHN--KANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            M PP +SD+ +   DL +K F        +V+  T    +  ++K+K   K   LS N E K ++ + GL +T  W  +N +  ++ +      GLKN  I +  P    KS     ++ + +      F    K P    ++ +   H +  + G +   D     +  +  AL Y   D+    T+ N  +     +Q +++F+ +G   + N    N       A +Y  PD+  S +K K++   ++ L Y   L  GV L + S  D  KL    H  G    ++
Sbjct:    1 MSPPVYSDISRNINDLLNKDFYHATPAAFDVQTTTANGIK-FSLKAKQPVKDGPLSTNVEAKLNDKQTGLGLTQGWSNTNNLQTKL-EFANLTPGLKNELITSLTPGVA-KSAVLNTTFTQPFFTARGAFDLCLKSPTFVGDLTMA--H-EGIVGGAEFGYDISAGSISRYAMALSYFAKDYSLGATLNNEQITTVDFFQNVNAFLQVGAKATMNCKLPNSNVNIEFATRY-LPDA-SSQVKAKVSDSGIVTLAYKQLLRPGVTLGVGSSFDALKLSEPVHKLGWSLSFD 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Yeast
Match: POR2 (Putative mitochondrial porin (voltage-dependent anion channel); not required for mitochondrial membrane permeability or mitochondrial osmotic stability; POR2 has a paralog, POR1, that arose from the whole genome duplication [Source:SGD;Acc:S000001376])

HSP 1 Score: 46.595 bits (109), Expect = 2.434e-6
Identity = 60/279 (21.51%), Postives = 114/279 (40.86%), Query Frame = 3
Query:   60 FSDLGKAAKDLFDKKFL-VGVSNVEI-ITKKDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVV--VAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVS-HNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFG 881
            F+D+ +    LF++ F      ++ I  T ++    T+K+K       +  + E +  + K G+ ++  W   N +    E SK     KG  N     F     +K+ KF  SY ++     +       K D   ++ LG  H + ++ G D+  DT       +  ++GY   ++  +++  N     A  +Q ++ ++ +G   +  +K +         +Y  PDS  S +K KI    +  L Y   LN  + L +    +  +L    H FG
Sbjct:    6 FNDISRDVNGLFNRDFFHTNPLSLNISTTTENGVNFTLKAKQGVTEGPIQTSVEGRFYDRKEGVSLSQSWSNQNRLNTRIEFSKIAPGWKGDVNA----FLTPQSIKNAKFNLSYAQKSFAARTSIDILQPK-DFVGSVTLG--H-RGFVGGTDIAYDTAAGLCARYAMSIGYLAREYSFILSTNNRQCATASFFQNVNRYLQVGTKATLQSKTSSNMNIEFVTRY-VPDS-ISQVKAKIADSGLTTLSYKRNLNKDISLGVGMSFNALQLTEPVHKFG 274          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Nematostella
Match: EDO31835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWS9])

HSP 1 Score: 134.035 bits (336), Expect = 7.024e-37
Identity = 86/284 (30.28%), Postives = 142/284 (50.00%), Query Frame = 3
Query:   51 PPSFSDLGKAAKDLFDKKFLVGVSNVEI-ITKKDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            P  + DLGK A+D+F K +  G   V++  T K+           + T  + G+ E K+     G+ ++ KW T NV+ +EI+   +  KGLK     TF PNTG KS K K +YK++YL+   +  F+   P +  + V+G    + +  G  +  DT   KL  + F+LGY+  DF     V + S F   +Y +IS  +++   +  N A   +     G  ++    D+ ++ K+N ++ +GL Y   L +G++ T+SS ID K L+ G H  G+    E
Sbjct:    5 PVKYEDLGKEARDVFGKGYGFGCVKVDLKTTTKNGVEFKTAGSSMNDTGKVFGSLETKYKYSDYGISLSEKWTTDNVLSSEITVEDQIAKGLKLQFDTTFAPNTGKKSAKIKTAYKQDYLHATGDVDFDFAGPTVQGSAVVGY---EGWHAGYQVAYDTSKSKLIANNFSLGYRAKDFQIHSAVNDASKFTGSIYHQISKNLEVAAQL--NWATGSSNTSFQGGCKYDVDKDTTLRAKVNNNSHLGLAYTQRLRDGIKATVSSHIDTKNLNQGGHKLGLSLEME 283          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Medaka
Match: vdac2 (voltage-dependent anion-selective channel protein 2 [Source:NCBI gene;Acc:101173732])

HSP 1 Score: 176.022 bits (445), Expect = 1.343e-52
Identity = 100/285 (35.09%), Postives = 157/285 (55.09%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+AKD+FDK +  GV  +++ TK  +          +  T  +SG  E K+   + GL  T KW T N +  EI+   +  KGLK     TF PNTG KS K K +YKREY+N+  +  F+   P I+ N V+G    + +L G  ++ DT   K+  + FA+GY+  DF     V + S F   +YQK+S  ++  V ++    +   ++GI  +YQ     D+ I  K+N ++++G+ Y  TL  GV+LTL+  +DGK ++ G H  G+G   E
Sbjct:    3 VPPAYADLGKSAKDIFDKGYGFGVVKLDVKTKSASGVEFKTSGSSNTDTSKVSGTLETKYKRAEYGLTFTEKWNTDNTLGTEITIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKREYVNLGCDVDFDFAGPTIHGNGVVGY---EGWLAGYQMSFDTAKSKMIRNNFAIGYKTGDFQLHTNVNDGSEFGGSIYQKVSDKLETAVSLAWTAGSNSTRFGIGAKYQL--DKDASISAKVNNNSLVGVGYTQTLRPGVKLTLAGLVDGKSINAGGHKLGLGLELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Medaka
Match: vdac3 (voltage-dependent anion-selective channel protein 2 [Source:NCBI gene;Acc:101170932])

HSP 1 Score: 175.637 bits (444), Expect = 6.800e-52
Identity = 102/285 (35.79%), Postives = 155/285 (54.39%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP++SDLGK+AKD+F+K F  GV  ++I TK  +         ++  T    G+ E K+   + GL    KW T N +  EI+   +  KGLK     +F PNTG KS K K  YKREY+N+  +  F+   P ++   VLG    + +L G  L  DT   KL  + FALGY+  DF     V + + F   +YQK+++ ++  VH++    +   ++GI  +YQ     D+ +  K+N   ++G+ Y  TL  GV+LTLS+ IDGK ++ G H  G+GF  E
Sbjct:   42 VPPAYSDLGKSAKDIFNKGFGYGVLKLDIKTKSQSGVEFATSGSNNTDTGKSGGHLETKYKLNELGLSFNQKWNTDNTLTTEITMEDQLAKGLKLGLDSSFVPNTGKKSAKLKTGYKREYMNLGCDLDFDMAGPTVHAAAVLGY---EGWLAGYQLAFDTAKSKLAQNNFALGYKAGDFQLHTHVNDGTEFGGSIYQKVNNSLETAVHLAWTAGSNNTRFGIGAKYQL--DKDASLSTKVNNACLVGVGYTHTLRPGVKLTLSAMIDGKNVNGGGHKVGLGFELE 321          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Medaka
Match: vdac1 (voltage dependent anion channel 1 [Source:NCBI gene;Acc:101173964])

HSP 1 Score: 153.68 bits (387), Expect = 5.188e-44
Identity = 90/285 (31.58%), Postives = 158/285 (55.44%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITK-KDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+A+D+F K +  G+  +++ TK ++    T     + +T  ++G+ E K+   + GL  T KW T N +  EI+   +  KGLK     +F PNTG K  K K +YK +++N+  +  ++     I+   V+G    + +L G  +T +    K+    FA+GY+  +F     V + + F   +YQK++  ++  V++S    N   ++GIA +YQ  D D SF   K+N  +++GL Y  TL  G++LTLS+ +DGK ++ G H  G+G  ++
Sbjct:    3 VPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSTGSANTETSKVAGSLETKYKWAEHGLTFTEKWNTDNTLGTEITVEDQLAKGLKLTLDSSFSPNTGKKGGKVKTAYKCDHVNVGCDVNYDINGTAIHGAAVVGY---EGWLAGYQMTFEAGRNKVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNEQLETAVNLSWTAGNSNTRFGIAAKYQI-DPDASF-SAKVNNSSLVGLGYTQTLKPGIKLTLSALLDGKNINAGGHKLGLGLEFQ 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Medaka
Match: VDAC2 (voltage-dependent anion-selective channel protein 2 [Source:NCBI gene;Acc:101154906])

HSP 1 Score: 151.369 bits (381), Expect = 4.847e-43
Identity = 90/285 (31.58%), Postives = 150/285 (52.63%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDART-LTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYE 899
            +PP+++DLGK+AKD+F K +  G+  +++ TK  +          +  T  ++G  E K+   + GL  T KW T N +  E+    +  KGLK     TF PNTG KS K K +YK+E++N   +   +   P I+   V G    + +L G  +T D+   ++    FA+GY   DF     V + + F   +YQK++  ++  V+++    +    +GIA +YQ   S  + I  K+N  +++G+ Y  TL  G++LTLS+ +DGK ++ G H  G+G   E
Sbjct:    3 VPPAYADLGKSAKDIFSKGYGFGLVKLDVKTKSSSGVEFKTSGSSNTDTSKVTGTLETKYKLPEYGLTFTEKWSTENTLGTEVCVEDQITKGLKLNFDTTFSPNTGKKSGKIKAAYKKEHVNAGVDVDLDFAGPTIHAAAVGGY---EGWLAGYQMTFDSAKSRMTRSNFAVGYTTGDFQLHTNVNDGAEFGGSIYQKVNDKLETAVNLAWTVGSNGTLFGIAAKYQLDPS--ASISAKVNNASLVGIGYTQTLRPGMKLTLSAMVDGKNINAGGHKLGLGLELE 282          
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Medaka
Match: vdac1 (voltage dependent anion channel 1 [Source:NCBI gene;Acc:101173964])

HSP 1 Score: 149.828 bits (377), Expect = 2.372e-42
Identity = 89/280 (31.79%), Postives = 155/280 (55.36%), Query Frame = 3
Query:   48 IPPSFSDLGKAAKDLFDKKFLVGVSNVEIITK-KDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGV 884
            +PP+++DLGK+A+D+F K +  G+  +++ TK ++    T     + +T  ++G+ E K+   + GL  T KW T N +  EI+   +  KGLK     +F PNTG K  K K +YK +++N+  +  ++     I+   V+G    + +L G  +T +    K+    FA+GY+  +F     V + + F   +YQK++  ++  V++S    N   ++GIA +YQ  D D SF   K+N  +++GL Y  TL  G++LTLS+ +DGK ++ G H  G+
Sbjct:    3 VPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSTGSANTETSKVAGSLETKYKWAEHGLTFTEKWNTDNTLGTEITVEDQLAKGLKLTLDSSFSPNTGKKGGKVKTAYKCDHVNVGCDVNYDINGTAIHGAAVVGY---EGWLAGYQMTFEAGRNKVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNEQLETAVNLSWTAGNSNTRFGIAAKYQI-DPDASF-SAKVNNSSLVGLGYTQTLKPGIKLTLSALLDGKNINAGGHKLGL 277          
BLAST of Voltage-dependent anion channel 3 vs. Planmine SMEST
Match: SMESG000000196.1 (SMESG000000196.1)

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 284/286 (99.30%), Postives = 285/286 (99.65%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYEQ 902
            MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYER+KGLKNVGILTFEPNTGLKSL FKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYEQ
Sbjct:    1 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERIKGLKNVGILTFEPNTGLKSLNFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYEQ 286          
BLAST of Voltage-dependent anion channel 3 vs. Planmine SMEST
Match: SMESG000013661.1 (SMESG000013661.1)

HSP 1 Score: 351.673 bits (901), Expect = 2.253e-121
Identity = 164/286 (57.34%), Postives = 219/286 (76.57%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYEQ 902
            MIPPSFSDLG+AAKDLFDKK+  G+ NVE+ +K D  ++ +K  H+ K+  LSG FE  H+    G+D+   W T NV+  E+SK  + +KGLK VGI++FEP+TG KSL  K+SYKR+YLNINSE +F + KPD+NLN+VLGC++PKPYL G+DL  D   + L+NHTFA+GY+KSDFG   ++K+LS+FN Y+YQKI+   DIG+HV++NK +K +KY IA QY  P SD S++K KINQD ++G VYGC +N+GVQL+LSSEID KKL++GP+NFG+  VYE 
Sbjct:    1 MIPPSFSDLGRAAKDLFDKKYKFGLYNVEVCSKNDTASVAIKGNHNIKSSSLSGTFETTHT-TNYGIDIKNTWSTKNVLTTELSKVVKSIKGLKCVGIMSFEPDTGKKSLNAKNSYKRDYLNINSELVFKNLKPDVNLNLVLGCSYPKPYLAGLDLNFDINNQHLKNHTFAIGYEKSDFGISTSMKDLSLFNTYIYQKINKNTDIGIHVTYNKNSKISKYEIAAQYMIPHSDRSYVKGKINQDLIMGFVYGCNINDGVQLSLSSEIDAKKLESGPYNFGLAIVYES 285          
BLAST of Voltage-dependent anion channel 3 vs. Planmine SMEST
Match: SMESG000053095.1 (SMESG000053095.1)

HSP 1 Score: 183.726 bits (465), Expect = 1.104e-55
Identity = 106/285 (37.19%), Postives = 164/285 (57.54%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKK-DARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVY 896
            MIPPSF DLGK  KDLF+K F  G+ +VE ++K      LT+K  +  K   L+G+ E K+   + GL  ++KW T N +    S       G K    L F P++G K +K + S+KR+YLN   +  F + KP +  ++V+GCT  K YL G ++T D     L  H F++GY K D   + ++ N +    ++YQ+I+  V++GV +  N  ++  ++G+AG+YQF +S  S  K KI+  +++GL Y     + V +TL++EIDGK L+ G H FG+G  Y
Sbjct:    1 MIPPSFCDLGKTTKDLFNKNFHFGLLSVEYLSKSAQGVELTIKGDNSLKAGKLNGSLEWKYK-FENGLKNSVKWDTKNELGVNFSIENFIKTGSKLSADLGFNPDSGNKKMKMQTSFKRKYLNCGLDMCFTNLKPILIPSLVIGCTESKGYLLGAEITYDLNRMDLTRHKFSIGYHKDDLSLIGSLINKTDIETHIYQRINPNVEVGVQIKWNWNSRNTEFGVAGKYQFDNS--SIFKGKIDNKSILGLGYIFRARDNVDITLNAEIDGKDLEKGGHRFGMGLSY 282          
BLAST of Voltage-dependent anion channel 3 vs. Planmine SMEST
Match: SMESG000081676.1 (SMESG000081676.1)

HSP 1 Score: 106.301 bits (264), Expect = 2.763e-26
Identity = 76/285 (26.67%), Postives = 146/285 (51.23%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEI-ITKKDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLD--MTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGY--QKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGV 884
            M+ P+F+D+GK  KDLFDK F  G   +     K +  +L +    +  +  L  +F+ K +   A  D  +T KW T+N V + +  T   ++ +K+   L +EP++G KS+KFK++Y  E +N + +      +P + L+ +       P+  G  +T DT  ++    ++ + Y  + ++   L+T  N  +F   +++K+ S  ++GV  S     K    G+A + +F  + DS +K KI+ +  +   Y     +G++LT  +++D + ++ G H FG+
Sbjct:    1 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLISSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTV--IENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGVQYSNETTNLTGLLTNHNEILFQ--IFKKLFSNTEVGVESSWKHDTKTPGIGLAMKREF--TKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGL 279          
BLAST of Voltage-dependent anion channel 3 vs. Planmine SMEST
Match: SMESG000071615.1 (SMESG000071615.1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.559e-21
Identity = 75/252 (29.76%), Postives = 113/252 (44.84%), Query Frame = 3
Query:   45 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEI-ITKKDARTLTVKSKHDHKTKDLSGNFELKHS-NIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILTFEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVY 794
            M  PSFSDLGK  KDLF+K+F  G   +     +     +      +  T   S N ELK   +   G+ +  KW   N  ++ I    +    L N   +T EP  G  S+K K+SYK + +  + +  F + KP+I+L+++       P   G  +T D    K++   + L   K D   L ++ N   F A +  KIS  VDIGV    N+  K   +G   Q +  DS  S +K K+     + L Y
Sbjct:    1 MSQPSFSDLGKKFKDLFNKQFPAGFFKLSAKFPETKGLAVNFNGSLNMDTGQFSPNLELKIPISSYGGITLIEKWTAKNEFLSSIE--MKPTSSLTNALEVTLEPTNGQTSIKTKNSYKSDSITTSGDIKFKTLKPEISLSIMTNLIQSIPLHGGGSVTYDFNKNKIKEINYGLQIDKGDI-CLSSLGNNKEFMAQICMKISDQVDIGVESGWNQELKTTTFGTVSQLRL-DS-GSLVKAKVESTGFLSLGY 247          
The following BLAST results are available for this feature:
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VDAC22.387e-4934.26voltage dependent anion channel 2 [Source:HGNC Sym... [more]
VDAC23.236e-4934.62voltage dependent anion channel 2 [Source:HGNC Sym... [more]
VDAC23.236e-4934.62voltage dependent anion channel 2 [Source:HGNC Sym... [more]
VDAC11.582e-4732.28voltage dependent anion channel 1 [Source:HGNC Sym... [more]
VDAC11.582e-4732.28voltage dependent anion channel 1 [Source:HGNC Sym... [more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vdac-12.415e-2527.59Probable voltage-dependent anion-selective channel... [more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
porin4.247e-4533.57gene:FBgn0004363 transcript:FBtr0100584[more]
porin4.247e-4533.57gene:FBgn0004363 transcript:FBtr0080183[more]
porin4.247e-4533.57gene:FBgn0004363 transcript:FBtr0305260[more]
porin4.247e-4533.57gene:FBgn0004363 transcript:FBtr0332029[more]
porin4.247e-4533.57gene:FBgn0004363 transcript:FBtr0080182[more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vdac32.248e-5134.97voltage-dependent anion channel 3 [Source:ZFIN;Acc... [more]
vdac22.444e-4933.33voltage-dependent anion channel 2 [Source:ZFIN;Acc... [more]
vdac22.444e-4933.33voltage-dependent anion channel 2 [Source:ZFIN;Acc... [more]
zgc:562358.849e-4834.39zgc:56235 [Source:ZFIN;Acc:ZDB-GENE-040426-954][more]
vdac18.658e-4632.52voltage-dependent anion channel 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vdac21.786e-5135.96voltage-dependent anion channel 2 [Source:NCBI gen... [more]
vdac23.397e-5135.96voltage-dependent anion channel 2 [Source:NCBI gen... [more]
vdac21.519e-5035.05voltage-dependent anion channel 2 [Source:NCBI gen... [more]
vdac21.738e-5035.44voltage-dependent anion channel 2 [Source:NCBI gen... [more]
vdac22.171e-5035.44voltage-dependent anion channel 2 [Source:NCBI gen... [more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vdac25.162e-4934.62voltage-dependent anion channel 2 [Source:MGI Symb... [more]
Vdac25.162e-4934.62voltage-dependent anion channel 2 [Source:MGI Symb... [more]
Vdac27.208e-4934.62voltage-dependent anion channel 2 [Source:MGI Symb... [more]
Vdac12.683e-4732.28voltage-dependent anion channel 1 [Source:MGI Symb... [more]
Vdac15.377e-4732.28voltage-dependent anion channel 1 [Source:MGI Symb... [more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P82013|VDAC2_MELGA1.062e-4935.66Voltage-dependent anion-selective channel protein ... [more]
sp|P81004|VDAC2_XENLA3.783e-4935.09Voltage-dependent anion-selective channel protein ... [more]
sp|P68003|VDAC2_RABIT1.048e-4834.62Voltage-dependent anion-selective channel protein ... [more]
sp|P68002|VDAC2_BOVIN1.048e-4834.62Voltage-dependent anion-selective channel protein ... [more]
sp|Q9MZ15|VDAC2_PIG1.283e-4834.62Voltage-dependent anion-selective channel protein ... [more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q3B8T31.090e-5035.79Voltage-dependent anion channel 2 OS=Kryptolebias ... [more]
A0A3P8WWK17.949e-5036.14Voltage-dependent anion channel 3 OS=Cynoglossus s... [more]
A0A401T5U18.594e-5036.14Uncharacterized protein OS=Chiloscyllium punctatum... [more]
A0A2I4AYE81.278e-4936.14voltage-dependent anion-selective channel protein ... [more]
A0A060X1M12.301e-4935.09Uncharacterized protein OS=Oncorhynchus mykiss OX=... [more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VDAC21.586e-5235.46voltage-dependent anion-selective channel protein ... [more]
vdac32.269e-5135.31voltage dependent anion channel 3 [Source:NCBI gen... [more]
vdac24.909e-5034.04voltage-dependent anion-selective channel protein ... [more]
vdac14.413e-4533.22voltage dependent anion channel 1 [Source:NCBI gen... [more]
vdac36.087e-4133.72voltage dependent anion channel 3 [Source:NCBI gen... [more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vdac26.907e-5235.09voltage-dependent anion channel 2 [Source:ZFIN;Acc... [more]
ENSPMAT00000005399.11.382e-3025.70pep scaffold:Pmarinus_7.0:GL479471:12985:19564:-1 ... [more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
POR11.423e-1423.45Mitochondrial porin (voltage-dependent anion chann... [more]
POR22.434e-621.51Putative mitochondrial porin (voltage-dependent an... [more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO318357.024e-3730.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vdac21.343e-5235.09voltage-dependent anion-selective channel protein ... [more]
vdac36.800e-5235.79voltage-dependent anion-selective channel protein ... [more]
vdac15.188e-4431.58voltage dependent anion channel 1 [Source:NCBI gen... [more]
VDAC24.847e-4331.58voltage-dependent anion-selective channel protein ... [more]
vdac12.372e-4231.79voltage dependent anion channel 1 [Source:NCBI gen... [more]
back to top
BLAST of Voltage-dependent anion channel 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000196.10.000e+099.30SMESG000000196.1[more]
SMESG000013661.12.253e-12157.34SMESG000013661.1[more]
SMESG000053095.11.104e-5537.19SMESG000053095.1[more]
SMESG000081676.12.763e-2626.67SMESG000081676.1[more]
SMESG000071615.17.559e-2129.76SMESG000071615.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013075 ID=SMED30013075|Name=Voltage-dependent anion channel 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1052bp
CATTTAAGTTGATAATTTGATTTCATTAATTTAGTTTATCAACTATGATT
CCACCATCATTTTCCGATTTAGGTAAAGCTGCTAAAGATCTTTTTGATAA
AAAATTTCTGGTTGGTGTCAGTAATGTTGAAATTATTACGAAGAAAGATG
CTCGAACTTTGACTGTGAAATCAAAACATGATCATAAAACAAAAGACCTA
TCTGGAAACTTTGAACTTAAACATTCTAACATCAAGGCCGGACTTGATAT
GACATTAAAATGGTGCACTTCAAACGTTGTTGTTGCAGAAATTTCCAAAA
CTTATGAGCGTGTTAAAGGACTTAAAAATGTTGGAATATTGACATTTGAA
CCGAATACTGGTTTGAAATCCTTAAAGTTTAAAGATTCATACAAACGAGA
GTATTTAAACATCAATTCAGAATTTCTCTTCAATTCCAAAAAGCCAGATA
TTAATTTAAATATGGTATTGGGCTGCACGCATCCGAAACCGTATTTAACG
GGAGTTGATCTGACAATTGATACCGAAGGAAAGAAATTACGGAATCATAC
ATTTGCTTTGGGATATCAAAAATCAGATTTTGGAGCGTTAATTACGGTAA
AAAACCTGTCCATGTTCAATGCATATGTCTATCAGAAAATTAGCAGCTTC
GTAGATATCGGAGTCCATGTCTCACACAATAAGGCAAACAAGGAGAACAA
ATATGGGATTGCCGGTCAATATCAGTTTCCAGATTCAGATGATTCGTTTA
TTAAATTGAAAATTAATCAAGACACAATGATTGGGCTGGTTTATGGTTGC
ACTTTGAATAATGGAGTTCAGCTGACATTGTCATCGGAAATCGACGGGAA
GAAATTGGATACAGGGCCTCACAATTTTGGGGTTGGATTTGTCTATGAGC
AATGAATAAGAAACGGTTTAGTTATAGGCATTTTATATTACAATTGCGAC
TGATTAGTACCTTTTGAAATAGATTTTTAGTCTTTAATATAAAATGAATT
GGATTGATATTTCATTTTTATTGTAGTAATAAATTTCGTTTTTCTAAAAA
AA
back to top

protein sequence of SMED30013075-orf-1

>SMED30013075-orf-1 ID=SMED30013075-orf-1|Name=SMED30013075-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=287bp
MIPPSFSDLGKAAKDLFDKKFLVGVSNVEIITKKDARTLTVKSKHDHKTK
DLSGNFELKHSNIKAGLDMTLKWCTSNVVVAEISKTYERVKGLKNVGILT
FEPNTGLKSLKFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPY
LTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKIS
SFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVY
GCTLNNGVQLTLSSEIDGKKLDTGPHNFGVGFVYEQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0015698inorganic anion transport
GO:0098656anion transmembrane transport
GO:1902017regulation of cilium assembly
GO:0044070regulation of anion transport
GO:0055085transmembrane transport
GO:0006820anion transport
GO:0006810transport
GO:0006811ion transport
GO:1903959regulation of anion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001925Porin_Euk
IPR027246Porin_Euk/Tom40
IPR023614Porin_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005741mitochondrial outer membrane
GO:0005739mitochondrion
GO:0016020membrane
GO:0016021integral component of membrane
GO:0046930pore complex
Vocabulary: molecular function
TermDefinition
GO:0008308voltage-gated anion channel activity
GO:0000166nucleotide binding
GO:0015288porin activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001925Porin, eukaryotic typePRINTSPR00185EUKARYTPORINcoord: 148..159
score: 25.64
coord: 250..267
score: 48.72
coord: 4..19
score: 61.06
coord: 66..81
score: 41.83
IPR001925Porin, eukaryotic typePANTHERPTHR11743VOLTAGE-DEPENDENT ANION-SELECTIVE CHANNELcoord: 3..283
IPR023614Porin domain superfamilyGENE3DG3DSA:2.40.160.10coord: 1..286
e-value: 8.2E-70
score: 237.3
IPR027246Eukaryotic porin/Tom40PFAMPF01459Porin_3coord: 3..279
e-value: 3.6E-43
score: 148.0
NoneNo IPR availablePANTHERPTHR11743:SF23GH26960P-RELATEDcoord: 3..283
NoneNo IPR availableCDDcd07306Porin3_VDACcoord: 3..285
e-value: 1.45327E-66
score: 207.061