Transcription factor IIIB 90 kDa subunit

Overview
NameTranscription factor IIIB 90 kDa subunit
Smed IDSMED30013060
Length (bp)1834
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription factor IIIB 90 kDa subunit (SMED30013060) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription factor IIIB 90 kDa subunit (SMED30013060) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription factor IIIB 90 kDa subunit (SMED30013060) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription factor IIIB 90 kDa subunit (SMED30013060) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013060

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013060h1SMcG0009273 dd_Smed_v4_1437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013060h1SMcG0009273 dd_Smed_v4_1437_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30013060h1SMcG0009273 dd_Smed_v6_1437_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013060h1SMcG0009273 dd_Smed_v4_1437_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Human
Match: BRF1 (BRF1 RNA polymerase III transcription initiation factor subunit [Source:HGNC Symbol;Acc:HGNC:11551])

HSP 1 Score: 211.846 bits (538), Expect = 2.381e-59
Identity = 158/517 (30.56%), Postives = 235/517 (45.45%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLIL-----------TGFPA-----AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEING-------RRNMIKECINSKVVRNLFTNFSKSEVCITNP---------VCKLDQLPLVLPISDCDGLV---------PIDS--NAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEK 1454
             T   C+ C   ++  +    + VC  CG   E +    E++F E+S G    VG  +             GF       ++  T+   +  I+ L N+L L  +    A   +K A  R LT+GR    V  ACLYL  R +    MLLD+SD + VNVYVLGKT+ ++          IDPCL+I RFA  +E G+K   VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT+ LT+ EF  ID EEE DPP++T    K ++  + ++  K+   ++ +I   +  IE E   +    +   ++L                       D    D    + G               +N  + R L      S     +P            LD LP    +   D +          P D+  + E D++ IDD E I  YIL+  E+  K   + + N +Y R ++  + R A++
Sbjct:    1 MTGRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAK---------------------DGSTEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAASLGISDSIRECISSQSSDPKDASGDGELDLSGIDDLE-IDRYILNESEARVKAELWMRENAEYLREQREKEARIAKE 495          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Human
Match: BRF1 (BRF1 RNA polymerase III transcription initiation factor subunit [Source:HGNC Symbol;Acc:HGNC:11551])

HSP 1 Score: 209.92 bits (533), Expect = 6.479e-59
Identity = 156/501 (31.14%), Postives = 229/501 (45.71%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEING-------RRNMIKECINSKVVRNLFTNFSKSEVCITNP---------VCKLDQLPLVLPISDCDGLV---------PIDS--NAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEK 1454
             T   C+ C   ++  +    + VC  CG   E +    E++F E+S G    VG           Q      +  I+ L N+L L  +    A   +K A  R LT+GR    V  ACLYL  R +    MLLD+SD + VNVYVLGKT+ ++          IDPCL+I RFA  +E G+K   VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT+ LT+ EF  ID EEE DPP++T    K ++  + ++  K+   ++ +I   +  IE E   +    +   ++L                       D    D    + G               +N  + R L      S     +P            LD LP    +   D +          P D+  + E D++ IDD E I  YIL+  E+  K   + + N +Y R ++  + R A++
Sbjct:    1 MTGRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVG-----------QFVSLDGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAK---------------------DGSTEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAASLGISDSIRECISSQSSDPKDASGDGELDLSGIDDLE-IDRYILNESEARVKAELWMRENAEYLREQREKEARIAKE 468          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Human
Match: BRF1 (BRF1 RNA polymerase III transcription initiation factor subunit [Source:HGNC Symbol;Acc:HGNC:11551])

HSP 1 Score: 188.734 bits (478), Expect = 7.719e-52
Identity = 133/401 (33.17%), Postives = 192/401 (47.88%), Query Frame = 3
Query:  336 AFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEING-------RRNMIKECINSKVVRNLFTNFSKSEVCITNP---------VCKLDQLPLVLPISDCDGLV---------PIDS--NAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEK 1454
            A  R LT+GR    V  ACLYL  R +    MLLD+SD + VNVYVLGKT+ ++          IDPCL+I RFA  +E G+K   VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT+ LT+ EF  ID EEE DPP++T    K ++  + ++  K+   ++ +I   +  IE E   +    +   ++L                       D    D    + G               +N  + R L      S     +P            LD LP    +   D +          P D+  + E D++ IDD E I  YIL+  E+  K   + + N +Y R ++  + R A++
Sbjct:    2 AVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAK---------------------DGSTEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAASLGISDSIRECISSQSSDPKDASGDGELDLSGIDDLE-IDRYILNESEARVKAELWMRENAEYLREQREKEARIAKE 380          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Human
Match: BRF1 (BRF1 RNA polymerase III transcription initiation factor subunit [Source:HGNC Symbol;Acc:HGNC:11551])

HSP 1 Score: 182.185 bits (461), Expect = 2.936e-49
Identity = 132/422 (31.28%), Postives = 194/422 (45.97%), Query Frame = 3
Query:  336 AFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEING-------RRNMIKECINSKVVRNLFTNFSKSEVCITNP---------VCKLDQLPLVLPISDCDGLV---------PIDS--NAEFDMTDIDDAEL---------------------ISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEK 1454
            A  R LT+GR    V  ACLYL  R +    MLLD+SD + VNVYVLGKT+ ++          IDPCL+I RFA  +E G+K   VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT+ LT+ EF  ID EEE DPP++T    K ++  + ++  K+   ++ +I   +  IE E   +    +   ++L                       D    D    + G               +N  + R L      S     +P            LD LP    +   D +          P D+  + E D++ IDD E+                     ++ YIL+  E+  K   + + N +Y R ++  + R A++
Sbjct:    2 AVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAK---------------------DGSTEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAASLGISDSIRECISSQSSDPKDASGDGELDLSGIDDLEIDRRDLSMPRCAKAKSQPHFPVLAQYILNESEARVKAELWMRENAEYLREQREKEARIAKE 402          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Human
Match: BRF1 (BRF1 RNA polymerase III transcription initiation factor subunit [Source:HGNC Symbol;Acc:HGNC:11551])

HSP 1 Score: 133.65 bits (335), Expect = 1.464e-35
Identity = 80/172 (46.51%), Postives = 110/172 (63.95%), Query Frame = 3
Query:  471 VLGKTYSV--IKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEE 977
             LG  + V   KES  Q LQ+ DPCL+I RFA  +E G+K   VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT+ LT+ EF  ID EEE DPP++T    K ++  + ++  K+   ++ +I   +  IE E
Sbjct:   15 TLGGGFHVNLGKESRAQTLQN-DPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIE 185          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Celegans
Match: brf-1 (BRF (Transcription factor) homolog [Source:UniProtKB/TrEMBL;Acc:A0A131MCT5])

HSP 1 Score: 186.422 bits (472), Expect = 2.257e-50
Identity = 139/474 (29.32%), Postives = 227/474 (47.89%), Query Frame = 3
Query:   51 CKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGS-KVPVGCLILTGFPAA-----------KQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVPIDS-----------NAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTN 1403
            C +C S  + E+    +  C  CG   E      E +F E + GS    VG  + +   AA           ++ T  K +  I+ L ++L +  +  + A   YK    R LT+GR    V   C+Y+  RL++ + +LLD SD   +NV+ LG+  + +  S    L   DPCL+I RFA  ++ GDK   V   A +L+QRMK+DW+STGRRP G+  AALL+AA+  +F+R   D+ R+  +SE   RKRL+E+++TP+ +LT+ EF T+D E   DPPA+     K +        +Q   +K+ + EM+  +E      D   +  FS          + P   ++ +          + V E +G      E + ++++  +F N ++ + C +N + K D+     P  +  G+                NA+ +  DI D+E I +YIL+  E   K  ++ K N
Sbjct:    5 CSNCGSSEIDEDAARGDATCTACGTVLEESIVVTENQFQERAGGSGHTLVGQFVSSERAAANNFNGMGSQESREMTYAKGRKVIDELGSQLRINSHCMNTAFNFYKMCVSRNLTRGRNRSSVVAVCMYITCRLENTAHLLLDFSDVTQINVFDLGRNLNYLSRSLRINLPSTDPCLYIMRFACVLDFGDKQKEVVNLATRLVQRMKRDWMSTGRRPTGICGAALLIAARSLNFNRSINDIVRVVHISEGVIRKRLDEFSQTPSGSLTIDEFSTVDLEHSEDPPAYRESRRKAREDQLRKEAEQAESMKEQLGEMEAHVEAAL---DKKRKEKFS----------KSPYARMISE----------NLVVESSGLEKGADEMVRNEIINTVF-NAAEEDPCTSNSLEKYDKY---RPSLESLGIKRTSEPEPEPVPHPIVNADLE-EDISDSE-IDSYILTESEVAIKTDYWMKAN 449          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Celegans
Match: brf-1 (BRF (Transcription factor) homolog [Source:UniProtKB/TrEMBL;Acc:A0A131MCT5])

HSP 1 Score: 182.185 bits (461), Expect = 6.114e-49
Identity = 109/319 (34.17%), Postives = 169/319 (52.98%), Query Frame = 3
Query:   51 CKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGS-KVPVGCLILTGFPAA-----------KQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIE 971
            C +C S  + E+    +  C  CG   E      E +F E + GS    VG  + +   AA           ++ T  K +  I+ L ++L +  +  + A   YK    R LT+GR    V   C+Y+  RL++ + +LLD SD   +NV+ LG+  + +  S    L   DPCL+I RFA  ++ GDK   V   A +L+QRMK+DW+STGRRP G+  AALL+AA+  +F+R   D+ R+  +SE   RKRL+E+++TP+ +LT+ EF T+D E   DPPA+     K +        +Q   +K+ + EM+  +E
Sbjct:    5 CSNCGSSEIDEDAARGDATCTACGTVLEESIVVTENQFQERAGGSGHTLVGQFVSSERAAANNFNGMGSQESREMTYAKGRKVIDELGSQLRINSHCMNTAFNFYKMCVSRNLTRGRNRSSVVAVCMYITCRLENTAHLLLDFSDVTQINVFDLGRNLNYLSRSLRINLPSTDPCLYIMRFACVLDFGDKQKEVVNLATRLVQRMKRDWMSTGRRPTGICGAALLIAARSLNFNRSINDIVRVVHISEGVIRKRLDEFSQTPSGSLTIDEFSTVDLEHSEDPPAYRESRRKAREDQLRKEAEQAESMKEQLGEMEAHVE 323          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Fly
Match: Brf (gene:FBgn0038499 transcript:FBtr0302317)

HSP 1 Score: 200.675 bits (509), Expect = 1.012e-55
Identity = 156/508 (30.71%), Postives = 249/508 (49.02%), Query Frame = 3
Query:   39 TSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKV----------------PVGCLILTGFPAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENN---FSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVP-IDSNAEFDMTDIDDA---------ELIS---------TYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKA 1448
            T ++C++C S  + E++   + VC +CG   E      E++F E  +G+                    G   +     +++ TI KAK  I +LC +L L  +    AL  +K A  R LT+GR +  +  AC+Y+  R +  S +L+DISD   +  Y LG+TY  +  +    +  +DPCL+I RFA R++LG KT  VSMTAL+++QRMKKD + +GRRP G+  AALL+AA++H F R   DV  +  + E T RKRL E+A TP+  LTL EF T+D E E DPP+F     K +  + ++ E +   ++++I              D  +E +   +SN +      G+    L      ++   +D++  E     R  I++  N++V++ L        +     V K +   LV  I   +GL P I++      +D++D          ELI+          Y+L+ EESV KL  +   N +Y + +K    R A
Sbjct:    3 TGLKCRNCGSNEIEEDNARGDRVCMNCGSVLEDSLIVSEVQFEEVGHGAAAIGQFVSAESSGGATNYGYGKFQVGSGTESREVTIKKAKKDITLLCQQLQLSQHYADTALNFFKMALGRHLTRGRKSTHIYAACVYMTCRTEGTSHLLIDISDVQQICSYELGRTYLKLSHALCINIPSLDPCLYIMRFANRLQLGAKTHEVSMTALRIVQRMKKDCMHSGRRPTGLCGAALLIAARMHDFSRTMLDVIGVVKIHESTLRKRLSEFAETPSGGLTLEEFMTVDLEREQDPPSFKAARKKDRERIKDMGEHELTELQKEI--------------DAHLEKDLGKYSNSVYRQLTKGKGLSPLSSPSTPNSSSEKDIELEES----RQFIEQS-NAEVIKEL--------IAKNEDVKKSEPGGLVAGI---EGLRPDIEAICRVTQSDLEDVEKAKQPQEQELITDDLNDDELDQYVLTEEESVAKLEMWKNLNAEYLQEQKERDERLA 480          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Fly
Match: Brf (gene:FBgn0038499 transcript:FBtr0083452)

HSP 1 Score: 200.675 bits (509), Expect = 1.012e-55
Identity = 156/508 (30.71%), Postives = 249/508 (49.02%), Query Frame = 3
Query:   39 TSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKV----------------PVGCLILTGFPAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENN---FSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVP-IDSNAEFDMTDIDDA---------ELIS---------TYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKA 1448
            T ++C++C S  + E++   + VC +CG   E      E++F E  +G+                    G   +     +++ TI KAK  I +LC +L L  +    AL  +K A  R LT+GR +  +  AC+Y+  R +  S +L+DISD   +  Y LG+TY  +  +    +  +DPCL+I RFA R++LG KT  VSMTAL+++QRMKKD + +GRRP G+  AALL+AA++H F R   DV  +  + E T RKRL E+A TP+  LTL EF T+D E E DPP+F     K +  + ++ E +   ++++I              D  +E +   +SN +      G+    L      ++   +D++  E     R  I++  N++V++ L        +     V K +   LV  I   +GL P I++      +D++D          ELI+          Y+L+ EESV KL  +   N +Y + +K    R A
Sbjct:    3 TGLKCRNCGSNEIEEDNARGDRVCMNCGSVLEDSLIVSEVQFEEVGHGAAAIGQFVSAESSGGATNYGYGKFQVGSGTESREVTIKKAKKDITLLCQQLQLSQHYADTALNFFKMALGRHLTRGRKSTHIYAACVYMTCRTEGTSHLLIDISDVQQICSYELGRTYLKLSHALCINIPSLDPCLYIMRFANRLQLGAKTHEVSMTALRIVQRMKKDCMHSGRRPTGLCGAALLIAARMHDFSRTMLDVIGVVKIHESTLRKRLSEFAETPSGGLTLEEFMTVDLEREQDPPSFKAARKKDRERIKDMGEHELTELQKEI--------------DAHLEKDLGKYSNSVYRQLTKGKGLSPLSSPSTPNSSSEKDIELEES----RQFIEQS-NAEVIKEL--------IAKNEDVKKSEPGGLVAGI---EGLRPDIEAICRVTQSDLEDVEKAKQPQEQELITDDLNDDELDQYVLTEEESVAKLEMWKNLNAEYLQEQKERDERLA 480          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Zebrafish
Match: brf1a (BRF1 RNA polymerase III transcription initiation factor subunit a [Source:ZFIN;Acc:ZDB-GENE-030131-6334])

HSP 1 Score: 214.157 bits (544), Expect = 1.653e-60
Identity = 173/528 (32.77%), Postives = 262/528 (49.62%), Query Frame = 3
Query:   51 CKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILT----GFPA------------AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEETNQ---------NDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRR-NMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVPIDSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREI 1553
            CK+C   ++  +      VC  CG   E +    E+ F E+  G    VG  +        P+            ++  T+  AK +IN L ++L +  +    A   YK A  + LTKGR +  V  ACLYL  R +    MLLD+SD + VNVYVLGKT+ V+          IDPCL+I RFA  +E G+K+  VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT+ LT+ EF   D E+E DPP+FT    K KL  + +   K+   I+ +I   + +IE E               S E++  +L SS   DGE   +L         +NE+    +E +G R ++ K    S ++  L T+ S   + ++  + K+ +       +D +         E D++ ID+ E I  YIL+ +E   K   +   N DY + +K  + R A++ +      +KPR   ++R      T DE + ++
Sbjct:    4 CKTCGGTDIDVDQARGVAVCMGCGSVLEDNIIVSEVTFVESGGGGSSAVGQFVAGDASGNVPSLGGNFQTSVGRESRAATLQNAKRQINHLGHQLQMNQHCLDTAFNFYKMALSKHLTKGRKSTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLVLARELCINAPAIDPCLYIPRFAQLLEFGEKSHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHEFRRTIKEVISVVKVCEATLRKRLYEFEDTPTSELTIEEFMKTDLEQECDPPSFTAGLRKQKLKQIEQELAKKVDDIEGEICGYQDEIEVELESCRPKARGIYASCSREDDVVSLASSSHLDGEDD-ELRAAASHLCGENEE----QEQDGERVSLTKRPSLSLLLGALPTSAS---LGLSESITKMGEEKE----NDVEA-----EGGELDLSGIDEDE-IDRYILNDKEVKVKTELWMIQNADYLKEQKEKEERIAKEKEEGTYKERKPRKSTRRREPINANTADEAIEKM 513          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Zebrafish
Match: brf1a (BRF1 RNA polymerase III transcription initiation factor subunit a [Source:ZFIN;Acc:ZDB-GENE-030131-6334])

HSP 1 Score: 214.157 bits (544), Expect = 1.653e-60
Identity = 173/528 (32.77%), Postives = 262/528 (49.62%), Query Frame = 3
Query:   51 CKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILT----GFPA------------AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEETNQ---------NDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRR-NMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVPIDSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREI 1553
            CK+C   ++  +      VC  CG   E +    E+ F E+  G    VG  +        P+            ++  T+  AK +IN L ++L +  +    A   YK A  + LTKGR +  V  ACLYL  R +    MLLD+SD + VNVYVLGKT+ V+          IDPCL+I RFA  +E G+K+  VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT+ LT+ EF   D E+E DPP+FT    K KL  + +   K+   I+ +I   + +IE E               S E++  +L SS   DGE   +L         +NE+    +E +G R ++ K    S ++  L T+ S   + ++  + K+ +       +D +         E D++ ID+ E I  YIL+ +E   K   +   N DY + +K  + R A++ +      +KPR   ++R      T DE + ++
Sbjct:    4 CKTCGGTDIDVDQARGVAVCMGCGSVLEDNIIVSEVTFVESGGGGSSAVGQFVAGDASGNVPSLGGNFQTSVGRESRAATLQNAKRQINHLGHQLQMNQHCLDTAFNFYKMALSKHLTKGRKSTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLVLARELCINAPAIDPCLYIPRFAQLLEFGEKSHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHEFRRTIKEVISVVKVCEATLRKRLYEFEDTPTSELTIEEFMKTDLEQECDPPSFTAGLRKQKLKQIEQELAKKVDDIEGEICGYQDEIEVELESCRPKARGIYASCSREDDVVSLASSSHLDGEDD-ELRAAASHLCGENEE----QEQDGERVSLTKRPSLSLLLGALPTSAS---LGLSESITKMGEEKE----NDVEA-----EGGELDLSGIDEDE-IDRYILNDKEVKVKTELWMIQNADYLKEQKEKEERIAKEKEEGTYKERKPRKSTRRREPINANTADEAIEKM 513          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Zebrafish
Match: brf1b (BRF1 RNA polymerase III transcription initiation factor subunit b [Source:ZFIN;Acc:ZDB-GENE-030131-6248])

HSP 1 Score: 209.92 bits (533), Expect = 9.460e-59
Identity = 155/504 (30.75%), Postives = 248/504 (49.21%), Query Frame = 3
Query:   42 SMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLIL-----------TGFPAA-----KQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLG----------DIDSNPDNEDLDFVEEINGRRNM-IKECINSKVVRNLFTNFSKSE--VCITNPVCKLDQLPLVLPISDC----DGLVPIDSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEK 1454
            S +CK+C   ++  +      VC  CG   E +    E++F E S G    VG  +            +GF  +     +  T+   K +I+ L ++L L  +    A   +K    + LT+GR    V  ACLYL  R +    MLLD+SD + VNVY+LGKT+ ++          +DPCL+I RFA  +E G+KT  VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT++LT+ EF  +D E+E DPP+F     K K+   ++ ++   ++++   E+    +E   Q   S       + +S   + +  L L  G          ++++   + + +F+ ++  RR+   K+ ++ +       N SK      +  P+     L L   I  C      +     + E D+  ID+ E I  YIL+  E   K   + K N++Y R +K  + R A++
Sbjct:    2 SRQCKNCGGSDIDTDPARGSAVCTACGSVLEDNIIVSEVQFVENSGGVSSAVGQFVSADGTSKAPVLGSGFHTSLGKESRAQTLQNGKRQIHNLGSQLQLNQHCLDTAFNFFKMVVSKHLTRGRKMTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYILGKTFLLLARELCINAPAVDPCLYIPRFAHMLEFGEKTHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHEFRRTVKEVISVVKVCEATLRKRLTEFEETPTSSLTIDEFMRVDLEKECDPPSFVAGQKKVKMQ--QLEQELVKKLEEYQGEIDSYRDEIETQLAGSSRTKMKGIYASYAREDDDSLSLASGLAGDEDAEDEEMEAAAKHLNQEFISQVLNRRDQGGKKDLDGRKNTVPLPNQSKHVPLTALLGPLPSAASLGLTDSIRQCITETTNVEEKSDSGELDLDGIDEDE-IEKYILNEIEVEAKTELWMKQNEEYLREQKEKEERIAKE 502          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Zebrafish
Match: brf1b (BRF1 RNA polymerase III transcription initiation factor subunit b [Source:ZFIN;Acc:ZDB-GENE-030131-6248])

HSP 1 Score: 209.92 bits (533), Expect = 9.460e-59
Identity = 155/504 (30.75%), Postives = 248/504 (49.21%), Query Frame = 3
Query:   42 SMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLIL-----------TGFPAA-----KQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLG----------DIDSNPDNEDLDFVEEINGRRNM-IKECINSKVVRNLFTNFSKSE--VCITNPVCKLDQLPLVLPISDC----DGLVPIDSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEK 1454
            S +CK+C   ++  +      VC  CG   E +    E++F E S G    VG  +            +GF  +     +  T+   K +I+ L ++L L  +    A   +K    + LT+GR    V  ACLYL  R +    MLLD+SD + VNVY+LGKT+ ++          +DPCL+I RFA  +E G+KT  VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT++LT+ EF  +D E+E DPP+F     K K+   ++ ++   ++++   E+    +E   Q   S       + +S   + +  L L  G          ++++   + + +F+ ++  RR+   K+ ++ +       N SK      +  P+     L L   I  C      +     + E D+  ID+ E I  YIL+  E   K   + K N++Y R +K  + R A++
Sbjct:    2 SRQCKNCGGSDIDTDPARGSAVCTACGSVLEDNIIVSEVQFVENSGGVSSAVGQFVSADGTSKAPVLGSGFHTSLGKESRAQTLQNGKRQIHNLGSQLQLNQHCLDTAFNFFKMVVSKHLTRGRKMTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYILGKTFLLLARELCINAPAVDPCLYIPRFAHMLEFGEKTHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHEFRRTVKEVISVVKVCEATLRKRLTEFEETPTSSLTIDEFMRVDLEKECDPPSFVAGQKKVKMQ--QLEQELVKKLEEYQGEIDSYRDEIETQLAGSSRTKMKGIYASYAREDDDSLSLASGLAGDEDAEDEEMEAAAKHLNQEFISQVLNRRDQGGKKDLDGRKNTVPLPNQSKHVPLTALLGPLPSAASLGLTDSIRQCITETTNVEEKSDSGELDLDGIDEDE-IEKYILNEIEVEAKTELWMKQNEEYLREQKEKEERIAKE 502          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Zebrafish
Match: brf1b (BRF1 RNA polymerase III transcription initiation factor subunit b [Source:ZFIN;Acc:ZDB-GENE-030131-6248])

HSP 1 Score: 185.652 bits (470), Expect = 3.121e-50
Identity = 147/504 (29.17%), Postives = 238/504 (47.22%), Query Frame = 3
Query:   42 SMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLIL-----------TGFPAA-----KQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLG----------DIDSNPDNEDLDFVEEINGRRNM-IKECINSKVVRNLFTNFSKSE--VCITNPVCKLDQLPLVLPISDC----DGLVPIDSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEK 1454
            S +CK+C   ++  +      VC  CG   E +    E++F E S G    VG  +            +GF  +     +  T+   K +I+ L ++L L  +    A   +K    + LT+GR    V  ACLYL                   VNVY+LGKT+ ++          +DPCL+I RFA  +E G+KT  VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT++LT+ EF  +D E+E DPP+F     K K+   ++ ++   ++++   E+    +E   Q   S       + +   ++ +  L L  G          ++++   + + +F+ ++  RR+   K+ ++ +       N SK      +  P+     L L   I  C      +     + E D+  ID+ E I  YIL+  E   K   + K N++Y R +K  + R A++
Sbjct:    2 SRQCKNCGGSDIDTDPARGSAVCTACGSVLEDNIIVSEVQFVENSGGVSSAVGQFVSADGTSKAPVLGSGFHTSLGKESRAQTLQNGKRQIHNLGSQLQLNQHCLDTAFNFFKMVVSKHLTRGRKMTHVIAACLYL-------------------VNVYILGKTFLLLARELCINAPAVDPCLYIPRFAHMLEFGEKTHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHEFRRTVKEVISVVKVCEATLRKRLTEFEETPTSSLTIDEFMRVDLEKECDPPSFVAGQKKVKMQ--QLEQELVKKLEEYQGEIDSYRDEIETQLAGSSRTKMKRIYACYAKEDDDSLSLASGLAGDEDAEDEEMEAAAQHLNQEFISQVLNRRDQGGKKDLDGRKNTVPLPNQSKHVPLTALLGPLPSAASLGLTDSIRQCITETTNVEEKSDSGELDLDGIDEDE-IEKYILNEIEVEAKTELWMKQNEEYLREQKEKEERIAKE 483          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Xenopus
Match: npas3 (neuronal PAS domain protein 3 [Source:Xenbase;Acc:XB-GENE-999791])

HSP 1 Score: 220.705 bits (561), Expect = 8.180e-63
Identity = 168/541 (31.05%), Postives = 258/541 (47.69%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILT-----------GF-----PAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVPIDS-----------------NAEFDMTDIDDAELISTYILSHEES-VKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREI 1553
             +S  CK+C   ++  +    + VC  CG   E +    E++F E + G    VG  + +           GF       ++  T+   K +I+ L  +L L  +    A   +K A  + LT+GR    V  ACLYL  R +    MLLD+SD + VNVYVLGKT+ ++          IDPCL+I RFA  +E GDK   VSMTAL+L+QRMK+DW+ TGRRP G+  AALL+A+++H F R  ++V R+  V E T RKRL E+  TPT+ LT+ EF  ID E+E DPP+FT    K K+  + +   K+   ++ +I   + +IE E   +    +  +++   +  ED                +   +   E+ +         +N      L  + SK  +C  + V  L    L+ P+     L   DS                 + E D+  IDD E I  YIL+ +E+ +KK  W  K N+DY R +K  + R A++ +      +KPR   ++R      T  E + ++
Sbjct:    1 MSSRVCKNCGCTDIDVDAARGDAVCTGCGSVLEDNIIVSEVQFVEGAGGISSAVGQFVSSECSGKTPSLGEGFYTSVGKESRAQTLQNGKRQIHNLGVQLQLNKHCLDTAFNFFKMAVSKHLTRGRKMTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGDKNHEVSMTALRLVQRMKRDWMHTGRRPSGLCGAALLVASRMHDFRRTIKEVIRVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEQECDPPSFTAGQRKVKIQQLEQELAKKLDEVEGEISSYQDEIENELESSRPKPKGIYASYAKNGSED----------------NTSSILAEEDDDEDLEAAANHLNKDFYSELANDTSKG-ICYEHTVKPLPIESLLGPLPTAASLGITDSIKECIAINEQEKSDNAGDGELDLNGIDDNE-IDRYILNEKEAEIKKEMWM-KENEDYLREQKEKEARIAKEKELGIYKEQKPRKPSKRRAPIQASTAGEAIEKM 522          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Xenopus
Match: npas3 (neuronal PAS domain protein 3 [Source:Xenbase;Acc:XB-GENE-999791])

HSP 1 Score: 219.935 bits (559), Expect = 4.200e-62
Identity = 168/541 (31.05%), Postives = 258/541 (47.69%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILT-----------GF-----PAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVPIDS-----------------NAEFDMTDIDDAELISTYILSHEES-VKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREI 1553
             +S  CK+C   ++  +    + VC  CG   E +    E++F E + G    VG  + +           GF       ++  T+   K +I+ L  +L L  +    A   +K A  + LT+GR    V  ACLYL  R +    MLLD+SD + VNVYVLGKT+ ++          IDPCL+I RFA  +E GDK   VSMTAL+L+QRMK+DW+ TGRRP G+  AALL+A+++H F R  ++V R+  V E T RKRL E+  TPT+ LT+ EF  ID E+E DPP+FT    K K+  + +   K+   ++ +I   + +IE E   +    +  +++   +  ED                +   +   E+ +         +N      L  + SK  +C  + V  L    L+ P+     L   DS                 + E D+  IDD E I  YIL+ +E+ +KK  W  K N+DY R +K  + R A++ +      +KPR   ++R      T  E + ++
Sbjct:    1 MSSRVCKNCGCTDIDVDAARGDAVCTGCGSVLEDNIIVSEVQFVEGAGGISSAVGQFVSSECSGKTPSLGEGFYTSVGKESRAQTLQNGKRQIHNLGVQLQLNKHCLDTAFNFFKMAVSKHLTRGRKMTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGDKNHEVSMTALRLVQRMKRDWMHTGRRPSGLCGAALLVASRMHDFRRTIKEVIRVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEQECDPPSFTAGQRKVKIQQLEQELAKKLDEVEGEISSYQDEIENELESSRPKPKGIYASYAKNGSED----------------NTSSILAEEDDDEDLEAAANHLNKDFYSELANDTSKG-ICYEHTVKPLPIESLLGPLPTAASLGITDSIKECIAINEQEKSDNAGDGELDLNGIDDNE-IDRYILNEKEAEIKKEMWM-KENEDYLREQKEKEARIAKEKELGIYKEQKPRKPSKRRAPIQASTAGEAIEKM 522          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Xenopus
Match: npas3 (neuronal PAS domain protein 3 [Source:Xenbase;Acc:XB-GENE-999791])

HSP 1 Score: 214.927 bits (546), Expect = 2.270e-61
Identity = 170/527 (32.26%), Postives = 252/527 (47.82%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILT-----------GF-----PAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNED----LDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVPIDSNAEFDMTDIDDAELISTYILSHEES-VKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREI 1553
             +S  CK+C   ++  +    + VC  CG   E +    E++F E + G    VG  + +           GF       ++  T+   K +I+ L  +L L  +    A   +K A  + LT+GR    V  ACLYL  R +    MLLD+SD + VNVYVLGKT+ ++          IDPCL+I RFA  +E GDK   VSMTAL+L+QRMK+DW+ TGRRP G+  AALL+A+++H F R  ++V R+  V E T RKRL E+  TPT+ LT+ EF  ID E+E DPP+FT    K K+                     Q++E+E  +    +E   S+    +E + E       G   S   NED    +   E+ +         +N      L  + SK  +C  + V         LPI    G  P+ + A   +TD    E I  YIL+ +E+ +KK  W  K N+DY R +K  + R A++ +      +KPR   ++R      T  E + ++
Sbjct:    1 MSSRVCKNCGCTDIDVDAARGDAVCTGCGSVLEDNIIVSEVQFVEGAGGISSAVGQFVSSECSGKTPSLGEGFYTSVGKESRAQTLQNGKRQIHNLGVQLQLNKHCLDTAFNFFKMAVSKHLTRGRKMTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGDKNHEVSMTALRLVQRMKRDWMHTGRRPSGLCGAALLVASRMHDFRRTIKEVIRVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEQECDPPSFTAGQRKVKI---------------------QQLEQELAKKLDEVEGEISSYQDEIENELESSRPKPKGIYASYAKNEDNTSSILAEEDDDEDLEAAANHLNKDFYSELANDTSKG-ICYEHTVKP-------LPIESLLG--PLPTAASLGITD-SIKECI--YILNEKEAEIKKEMWM-KENEDYLREQKEKEARIAKEKELGIYKEQKPRKPSKRRAPIQASTAGEAIEKM 492          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Xenopus
Match: npas3 (neuronal PAS domain protein 3 [Source:Xenbase;Acc:XB-GENE-999791])

HSP 1 Score: 201.06 bits (510), Expect = 2.843e-56
Identity = 166/540 (30.74%), Postives = 246/540 (45.56%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILT-----------GF-----PAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNED----LDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVPIDS-------------NAEFDMTDIDDAELISTYILSHEES-VKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREI 1553
             +S  CK+C   ++  +    + VC  CG   E +    E++F E + G    VG  + +           GF       ++  T+   K +I+ L  +L L  +    A   +K A  + LT+GR    V  ACLYL                   VNVYVLGKT+ ++          IDPCL+I RFA  +E GDK   VSMTAL+L+QRMK+DW+ TGRRP G+  AALL+A+++H F R  ++V R+  V E T RKRL E+  TPT+ LT+ EF  ID E+E DPP+FT    K K+                     Q++E+E  +    +E   S+    +E + E       G   S   NED    +   E+ +         +N      L  + SK  +C  + V  L    L+ P+     L   DS             + E D+  IDD E I  YIL+ +E+ +KK  W  K N+DY R +K  + R A++ +      +KPR   ++R      T  E + ++
Sbjct:    1 MSSRVCKNCGCTDIDVDAARGDAVCTGCGSVLEDNIIVSEVQFVEGAGGISSAVGQFVSSECSGKTPSLGEGFYTSVGKESRAQTLQNGKRQIHNLGVQLQLNKHCLDTAFNFFKMAVSKHLTRGRKMTHVIAACLYL-------------------VNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGDKNHEVSMTALRLVQRMKRDWMHTGRRPSGLCGAALLVASRMHDFRRTIKEVIRVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEQECDPPSFTAGQRKVKI---------------------QQLEQELAKKLDEVEGEISSYQDEIENELESSRPKPKGIYASYAKNEDNTSSILAEEDDDEDLEAAANHLNKDFYSELANDTSKG-ICYEHTVKPLPIESLLGPLPTAASLGITDSIKECIAINEQEKRDGELDLNGIDDNE-IDRYILNEKEAEIKKEMWM-KENEDYLREQKEKEARIAKEKELGIYKEQKPRKPSKRRAPIQASTAGEAIEKM 497          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Xenopus
Match: npas3 (neuronal PAS domain protein 3 [Source:Xenbase;Acc:XB-GENE-999791])

HSP 1 Score: 198.364 bits (503), Expect = 8.619e-55
Identity = 161/541 (29.76%), Postives = 248/541 (45.84%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILT-----------GF-----PAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVPIDS-----------------NAEFDMTDIDDAELISTYILSHEES-VKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREI 1553
             +S  CK+C   ++  +    + VC  CG   E +    E++F E + G    VG  + +           GF       ++  T+   K +I+ L  +L L  +    A   +K A  + LT+GR    V  ACLYL                   VNVYVLGKT+ ++          IDPCL+I RFA  +E GDK   VSMTAL+L+QRMK+DW+ TGRRP G+  AALL+A+++H F R  ++V R+  V E T RKRL E+  TPT+ LT+ EF  ID E+E DPP+FT    K K+  + +   K+   ++ +I   + +IE E   +    +  +++   +  ED                +   +   E+ +         +N      L  + SK  +C  + V  L    L+ P+     L   DS                 + E D+  IDD E I  YIL+ +E+ +KK  W  K N+DY R +K  + R A++ +      +KPR   ++R      T  E + ++
Sbjct:    1 MSSRVCKNCGCTDIDVDAARGDAVCTGCGSVLEDNIIVSEVQFVEGAGGISSAVGQFVSSECSGKTPSLGEGFYTSVGKESRAQTLQNGKRQIHNLGVQLQLNKHCLDTAFNFFKMAVSKHLTRGRKMTHVIAACLYL-------------------VNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGDKNHEVSMTALRLVQRMKRDWMHTGRRPSGLCGAALLVASRMHDFRRTIKEVIRVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEQECDPPSFTAGQRKVKIQQLEQELAKKLDEVEGEISSYQDEIENELESSRPKPKGIYASYAKNGSED----------------NTSSILAEEDDDEDLEAAANHLNKDFYSELANDTSKG-ICYEHTVKPLPIESLLGPLPTAASLGITDSIKECIAINEQEKSDNAGDGELDLNGIDDNE-IDRYILNEKEAEIKKEMWM-KENEDYLREQKEKEARIAKEKELGIYKEQKPRKPSKRRAPIQASTAGEAIEKM 503          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Mouse
Match: Brf1 (BRF1, RNA polymerase III transcription initiation factor 90 kDa subunit [Source:MGI Symbol;Acc:MGI:1919558])

HSP 1 Score: 219.55 bits (558), Expect = 2.445e-62
Identity = 169/550 (30.73%), Postives = 252/550 (45.82%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLIL-----------TGFPA-----AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLI--SSVEEDGEIP----------------------LDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKS-EVCITNPVCKLDQLPLVLPISDCDGLVPIDS--NAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREI 1553
             T   C+ C   ++  +    + VC  CG   E +    E++F E S G    VG  +             GF       ++  T+   +  I+ L ++L L  +    A   +K A  + LT+GR    V  ACLYL  R +    MLLD+SD + VNVYVLGKT+ ++          IDPCL+I RFA  +E G+K   VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT+ LT+ EF  ID EEE DPP++T    K ++  + ++  K+   ++ +I   +  IE E   +    +   +NL    S E+    P                         LLGD D +    D D      G R +  E +   +        S S   CI++P                    P DS  + E D++ IDD E I  YIL+  E+  K   + + N +Y R +K  + R A++ +       KP+   ++R      T  E + ++
Sbjct:    1 MTGRVCRGCGGTDIELDAARGDAVCTGCGSVLEDNIIVSEVQFVENSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGSQLQLNQHCLDTAFNFFKMAVSKHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGALANLSKDGSGEDATSSPRCEEDTEDEELEAAASHMNKDFYRELLGDDDGSEAAGDPD-----GGSRPLALESLLGPLPTAASLGISDSIRECISSPSGD-----------------PKDSSGDGELDLSGIDDLE-IDRYILNESEARVKAELWMRENAEYLREQKEKEARIAKEKELGIYKEHKPKKSCKRREPILASTAGEAIEKM 527          
BLAST of Transcription factor IIIB 90 kDa subunit vs. UniProt/SwissProt
Match: sp|Q8CFK2|TF3B_MOUSE (Transcription factor IIIB 90 kDa subunit OS=Mus musculus OX=10090 GN=Brf1 PE=1 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.781e-61
Identity = 169/550 (30.73%), Postives = 252/550 (45.82%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLIL-----------TGFPA-----AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLI--SSVEEDGEIP----------------------LDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKS-EVCITNPVCKLDQLPLVLPISDCDGLVPIDS--NAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREI 1553
             T   C+ C   ++  +    + VC  CG   E +    E++F E S G    VG  +             GF       ++  T+   +  I+ L ++L L  +    A   +K A  + LT+GR    V  ACLYL  R +    MLLD+SD + VNVYVLGKT+ ++          IDPCL+I RFA  +E G+K   VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT+ LT+ EF  ID EEE DPP++T    K ++  + ++  K+   ++ +I   +  IE E   +    +   +NL    S E+    P                         LLGD D +    D D      G R +  E +   +        S S   CI++P                    P DS  + E D++ IDD E I  YIL+  E+  K   + + N +Y R +K  + R A++ +       KP+   ++R      T  E + ++
Sbjct:    1 MTGRVCRGCGGTDIELDAARGDAVCTGCGSVLEDNIIVSEVQFVENSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGSQLQLNQHCLDTAFNFFKMAVSKHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGALANLSKDGSGEDATSSPRCEEDTEDEELEAAASHMNKDFYRELLGDDDGSEAAGDPD-----GGSRPLALESLLGPLPTAASLGISDSIRECISSPSGD-----------------PKDSSGDGELDLSGIDDLE-IDRYILNESEARVKAELWMRENAEYLREQKEKEARIAKEKELGIYKEHKPKKSCKRREPILASTAGEAIEKM 527          
BLAST of Transcription factor IIIB 90 kDa subunit vs. UniProt/SwissProt
Match: sp|Q92994|TF3B_HUMAN (Transcription factor IIIB 90 kDa subunit OS=Homo sapiens OX=9606 GN=BRF1 PE=1 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.144e-58
Identity = 158/517 (30.56%), Postives = 235/517 (45.45%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLIL-----------TGFPA-----AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKL-SVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEING-------RRNMIKECINSKVVRNLFTNFSKSEVCITNP---------VCKLDQLPLVLPISDCDGLV---------PIDS--NAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEK 1454
             T   C+ C   ++  +    + VC  CG   E +    E++F E+S G    VG  +             GF       ++  T+   +  I+ L N+L L  +    A   +K A  R LT+GR    V  ACLYL  R +    MLLD+SD + VNVYVLGKT+ ++          IDPCL+I RFA  +E G+K   VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V  +  V E T RKRL E+  TPT+ LT+ EF  ID EEE DPP++T    K ++  + ++  K+   ++ +I   +  IE E   +    +   ++L                       D    D    + G               +N  + R L      S     +P            LD LP    +   D +          P D+  + E D++ IDD E I  YIL+  E+  K   + + N +Y R ++  + R A++
Sbjct:    1 MTGRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAK---------------------DGSTEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAASLGISDSIRECISSQSSDPKDASGDGELDLSGIDDLE-IDRYILNESEARVKAELWMRENAEYLREQREKEARIAKE 495          
BLAST of Transcription factor IIIB 90 kDa subunit vs. UniProt/SwissProt
Match: sp|P46070|TF3B_KLULA (Transcription factor IIIB 70 kDa subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=TDS4 PE=3 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 9.303e-42
Identity = 110/340 (32.35%), Postives = 175/340 (51.47%), Query Frame = 3
Query:   30 LYFTSMECKSCRSKNVVEN--DTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILT--GFPAAKQH-----------TINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDI-----DPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQN 989
            L  +S +CK+C S + V +  +T  E++C+ CG   E ++   E+ F E SNG+ V  G  +      P    H           T+N A+ K+  +   L +  YV   A + Y+ A      +GR +  V  ACLY+A R +    ML+D S ++ V+VY +G T+        +KLQ +     DP LFI  FA ++ELGDK   V   A+KL Q M +DW+  GRRP G+  A LLLA ++++  R + ++  I+ V+E T ++RL E+  T +A L++ EF+  D E E +    + ++  P      + EK+ I+   D  EM +  EE  ++N
Sbjct:    5 LQVSSRKCKNCGSTDFVRDISNTTNELICKVCGLVTEENSIVSEVTFGEASNGAAVIQGAFVSANQAHPTFMSHSGQNALMSRETTLNNARRKLKAVSYALNIPEYVTDAAFQWYRLALSNNFVQGRKSQNVIAACLYIACRKERTHHMLIDFSSRLQVSVYSIGATFL----KLAKKLQIVKLPLADPSLFIQHFAEKLELGDKKIKVIRDAVKLAQTMSRDWMYEGRRPAGIAGACLLLACRMNNLRRTHSEIVAISHVAEETLQQRLNEFKNTTSAKLSVKEFR--DDETEVNEGERSAESKPPSFDKNRLKEKK-IKDSLDTKEMLETSEEAVSRN 337          
BLAST of Transcription factor IIIB 90 kDa subunit vs. UniProt/SwissProt
Match: sp|P29056|TF3B_YEAST (Transcription factor IIIB 70 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRF1 PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.823e-40
Identity = 106/327 (32.42%), Postives = 172/327 (52.60%), Query Frame = 3
Query:   51 CKSCRSKNVVENDTNA--EIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPAA----------KQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTY-SVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEE-EFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQN 989
            CK+C       + +NA  ++VC+ CG   E +    E+ F ETS G+ V  G  I  G   A          ++ T+N A+ K+  +   L +  Y+   A + YK A      +GR +  V  +CLY+A R +    ML+D S ++ V+VY +G T+  ++K+    +L   DP LFI  FA +++L DK   V   A+KL QRM KDW+  GRRP G+  A +LLA ++++  R + ++  ++ V+E T ++RL E+  T  A L++ +F+  D E+ E  PP+F  +N K +  + +  +K+         EM Q  EE  N+N
Sbjct:    4 CKNCHGTEFERDLSNANNDLVCKACGVVSEDNPIVSEVTFGETSAGAAVVQGSFIGAGQSHAAFGGSSALESREATLNNARRKLRAVSYALHIPEYITDAAFQWYKLALANNFVQGRRSQNVIASCLYVACRKEKTHHMLIDFSSRLQVSVYSIGATFLKMVKKLHITELPLADPSLFIQHFAEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACRMNNLRRTHTEIVAVSHVAEETLQQRLNEFKNTKAAKLSVQKFRENDVEDGEARPPSFV-KNRKKERKIKDSLDKE---------EMFQTSEEALNKN 320          
BLAST of Transcription factor IIIB 90 kDa subunit vs. UniProt/SwissProt
Match: sp|P43072|TF3B_CANAL (Transcription factor IIIB 70 kDa subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TDS4 PE=3 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.217e-38
Identity = 136/517 (26.31%), Postives = 243/517 (47.00%), Query Frame = 3
Query:   48 ECKSCRSKNVVENDTNA--EIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLI-----LTGFPAAKQH-------TINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTY-SVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVPIDSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREI 1553
            +CK+C       N   A  ++ C  CG   E +    E++F E+S+G+ +  G ++        F   +Q+       T++  K KI  +   L +  Y+   A E ++ A      +GR +  V   CLY+A R +    ML+D S ++ ++VY LG T+  ++K      L   DP LFI  F  +++  DK   V+  A+KL  RM  DWI  GRRP G+  A +LLAA++++F R + ++  ++ V E T ++RL E+ +T    L++  F+ ++  E  +PP+F  +N   +L + +  ++Q    + D  E   K+ EE  Q      + F  L S  E   ++ ++ +L DI    +N +      +  +++ ++  +          N S+ +      + K   L   LP +D D L  + S  E ++   DD E++    L+ EE   K R +   N DY   ++  ++ K E  +   ++SK     R+KR    +  P E+ +E+
Sbjct:    9 KCKTCGHTQFDVNRYTAAGDVSCLRCGTVLEENPIVSEVQFGESSSGAAMVQGAMVGADQARATFAGGRQNAMESREQTLSNGKRKIKRIAAALKIPDYIAEAAGEWFRLALTLNFVQGRRSNNVLATCLYVACRKERTHHMLIDFSSRLQISVYSLGATFLKMVKALHITSLPLADPSLFIQHFVEKLDFKDKATKVAKDAVKLAHRMAADWIHEGRRPAGIAGACVLLAARMNNFRRSHAEIVAVSHVGEETLQRRLNEFKKTKAGTLSVKSFREVENLESSNPPSFE-KNRAMELKISKKLQQQ----QTDNFEDLSKMTEEEKQ------SVFGKL-SKEEAQKQLLMNTILSDITITTENLNDQMDRILKMKKSSLENSLYKTPYELALANGSEQDPSKIWNINKPKNLVANLPKTD-DILQNVSS--EVELNSDDDDEIVLESKLTEEEVAIKERIWTGLNHDYLVEQEKKRL-KQEADELTGNTSKSSSGNRRKRNKSSL--PAELRKEL 507          
BLAST of Transcription factor IIIB 90 kDa subunit vs. TrEMBL
Match: A0A4E0S313 (Transcription factor IIIB subunit OS=Fasciola hepatica OX=6192 GN=D915_002368 PE=4 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 2.234e-88
Identity = 191/561 (34.05%), Postives = 296/561 (52.76%), Query Frame = 3
Query:   45 MECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPA----AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETN-QNDTSMENNFSNLISSVEEDGEIPLDLLLGDID---SNPDNEDL----DFVEEINGR----------RNMIKECINSKVVRNLFTNFSKSEVCIT----NPVCKL---------------------------------------------DQLPLVLPISDCDGL-VPIDSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRG 1511
            M C  C S N  E+   A+++C DCG     +    E+EF ET NG    VG  +  G       +KQ T N+A+ +I+ +C +L L   V   A   Y+SA  RGLT+GR A+  A  C+YLA+R    ++MLLD+SD + +NVYVLG  Y+ +K      + ++DPCLFI RFA ++E GDK ++V+ TA++LLQRMKKDWI+TGRRP G+ AAALL+AA+IH F+R  EDVAR+A +S+ T RKRL+E+ RTPT+ L++ +F  ID+EEE DPPAF+    KP+ +V E+ E+ F RI  +I E++++IE +    ++      F++ ++ ++  G   L  L+ D D   + P   D+      V + +G+          RN++++ ++  V   L  N  +    +T    N +C+L                                              +LP+ +P +    +  P   +    + DIDD EL   YIL   E + K   +YK N +Y +  +  ++ K  +L+    +  K +  RQ+RG
Sbjct:    1 MRCVHCGSTNFDEDRARADLICLDCGMVLSENAISSEVEFVETGNGLSTAVGRFVSDGSQQVGRESKQITENRARRRIDTICGQLRLGSDVSVSAFRFYQSALFRGLTRGRGAMHTAAGCIYLAARQLRVNLMLLDLSDAVGINVYVLGHCYAELKRKLHLAIPEMDPCLFIERFANQLEFGDKMSVVATTAMRLLQRMKKDWIATGRRPSGLAAAALLVAARIHEFNRTEEDVARVARISQQTTRKRLQEFGRTPTSKLSIDDFFAIDYEEEQDPPAFSASK-KPEENVKEMDEEAFARITLEIKELERRIENQLRVLSEKRSSRTFADKLAHLDVGGSKGLHHLISDQDESLTGPPRSDVVGCGSTVSDESGQVSSSSSVCTTRNVLRDVLDGVVEPELLDNCVEDLQILTEHSGNAMCELLDKAEELRNLRELQADAKILDEKIATAATPSVSNEVDSGGTEQKTMKLPVFIPNAQASKIEYPTAEDGTLIVDDIDDEELDREYILHPREVMIKAAVWYKANAEYLQAVRRKRLAKKHQLEEDARNPPKKKAARQRRG 560          
BLAST of Transcription factor IIIB 90 kDa subunit vs. TrEMBL
Match: A0A4S2MG70 (TFIIB-type domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000173 PE=4 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 5.922e-83
Identity = 193/564 (34.22%), Postives = 294/564 (52.13%), Query Frame = 3
Query:   45 MECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPA----AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETN----------------QNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEING----------RRNMIKECINSKVVRNL----------FTNFSKSEVC--ITNPVCK---LDQLPLVL-PISDCDG--------------------LVPIDSNAEFDMTDIDDA----------ELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKR 1508
            M C  C   +  E+   A++VC DCG     +    E+EF ETS G    VG  +     A    ++Q T N+A+ +I+ +C  L L   + + A   Y+SA  RG+T+GR AL VA +C+YLA+R    ++MLLD+SD + +NVYVLG  Y+ ++      + ++DPCL+I RFA+++E GDK  +V+ TA++LLQRMKKDW++TGRRP G+ AAALL+AA+IH F+R+ EDVARIA +S+ T RKRLEE+ RTPT+ L++ +F T+D+EEE DPPAFT    K   SV E+ E  F RI  +I E++++I+ E                  + +       ++L+  + E  + P D       S PD   L    + +            R+++++ ++  V  +L           T  S +EVC  ++    +   LDQ P  L P S  +G                     +P    A+ +  D+ D           EL   YIL   E + K   +YK N +Y +N +   +   EKL+R ++ +K P  KR +R
Sbjct:    1 MRCTHCGGTSFDEDRARADLVCLDCGMVLSENVICSEVEFVETSAGVSAAVGRFVSDESQAIGRESRQVTENRARRRIDTICGHLRLGNDIATSAFRFYQSALFRGITRGRGALQVAASCVYLAARQLRVNLMLLDLSDAVGINVYVLGHCYTELRRRLHLSIPEMDPCLYIERFASQLEFGDKMPVVATTAMRLLQRMKKDWLTTGRRPSGLAAAALLVAARIHEFNRNEEDVARIARISQQTARKRLEEFGRTPTSALSIEDFFTVDYEEEQDPPAFTSAR-KSDESVKELDEASFARISAEINELERRIDVELQSLVDKRSSRKLRMKLEEMEVGQSKGINHLLYPISESSD-PTDQA---ATSTPDQSSLQASADEDTTATASTDPTPSRSILRDVLDGIVEPSLLDSCVEDLRILTEHSGAEVCELLSQAEAQQGLLDQNPESLDPDSKMNGESAPASEEKPNEPIPMKLPLFLPSARVAKIEYPDMKDGTLSLEGIDDEELDQEYILHPREVMIKAAIWYKANAEYLQNARRKHL---EKLRRAEEDAKNPPKKRARR 556          
BLAST of Transcription factor IIIB 90 kDa subunit vs. TrEMBL
Match: A0A5J4N8F9 (Transcription factor IIIB 90 kDa subunit OS=Paragonimus westermani OX=34504 GN=DEA37_0007915 PE=4 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 2.076e-82
Identity = 145/316 (45.89%), Postives = 204/316 (64.56%), Query Frame = 3
Query:   45 MECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGC-------LILTGFPAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIE 971
            M C  C S +  E+   A++VC DCG     +    E+EF ETS G    VG        L+L     +  H    A+ +I+ +C  L L       A   Y+SA  RGLT+GR AL VA  C+YLA+R    ++MLLD+SD + +NVYVLG  Y+ +K      + ++DPCL+I RFA+++E G+KT +V+ TA++LLQRMKKDW++TGRRP G+ AAALL+A++IH F+R+ EDVARIA +S+ T RKRLEE+ RTPT+ LT+ +F T+D+EEE DPPAFT    K   +V E+ EK F RI  +I E++++I+
Sbjct:    1 MRCTHCGSTSFDEDRARADLVCLDCGMVMSENVISSEVEFVETSAGVAAAVGRFVSDESKLVLHMLTFSASH----ARRRIDTICGHLRLGNDTAVSAFRYYQSALFRGLTRGRGALQVAAGCVYLAARQLRVNLMLLDLSDAVGINVYVLGHCYTDLKRRLNLAIPEMDPCLYIERFASQLEFGEKTPVVATTAMRLLQRMKKDWLTTGRRPSGLAAAALLVASRIHEFNRNEEDVARIARISQQTARKRLEEFGRTPTSALTIEDFFTVDYEEEQDPPAFTAAR-KLDEAVKELDEKDFARISAEITELERRID 311          
BLAST of Transcription factor IIIB 90 kDa subunit vs. TrEMBL
Match: A0A504Z522 (Transcription factor IIIB subunit OS=Fasciola gigantica OX=46835 GN=FGIG_03541 PE=4 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 1.395e-81
Identity = 151/351 (43.02%), Postives = 222/351 (63.25%), Query Frame = 3
Query:   45 MECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPA----AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETN-QNDTSMENNFSNLISSVEEDGEIPLDLLLGDID 1082
            M C  C S N  E+   A+++C DCG     +    E+EF ET NG    VG  +  G       +KQ T N+A+ +I+ +C +L L   V   A   Y+SA  RGLT+GR A+  A  C+YLA+R    ++MLLD+SD + +NVYVLG  Y+ +K      + ++DPCLFI RFA ++E GDK ++V+ TA++LLQRMKKDWI+TGRRP G+ AAALL+AA+IH F+R  EDVAR+A +S+ T RKRL+E+ RTPT+ L++ +F  ID+EEE DPPAF+    K + +V E+ E+ F RI  +I E++++IE +    ++      F++ ++ ++  G   L  L+ D D
Sbjct:    1 MRCVHCGSTNFDEDRARADLICLDCGMVLSENAISSEVEFVETGNGLSTAVGRFVSDGSQQVGRESKQITENRARRRIDTICGQLRLGSDVSVSAFRFYQSALFRGLTRGRGAMHTAAGCIYLAARQLRVNLMLLDLSDAVGINVYVLGHCYAELKRKLHLAIPEMDPCLFIERFANQLEFGDKMSVVATTAMRLLQRMKKDWIATGRRPSGLAAAALLVAARIHEFNRTEEDVARVARISQQTTRKRLQEFGRTPTSKLSIDDFFAIDYEEEQDPPAFSASK-KSEENVQEMDEEAFARITLEIKELERRIENQLRVLSEKRSSRTFADKLAHLDVGGSKGLHHLISDQD 350          
BLAST of Transcription factor IIIB 90 kDa subunit vs. TrEMBL
Match: G7YT46 (Transcription initiation factor brf1 OS=Clonorchis sinensis OX=79923 GN=CLF_110027 PE=4 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 1.565e-81
Identity = 189/556 (33.99%), Postives = 286/556 (51.44%), Query Frame = 3
Query:   45 MECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQ-NDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPD-------------------NEDLDFVEEIN--GRRNMIKECINSKVVRNL----------FTNFSKSEVC------------------ITNPVCKL-------------DQLPLVLPISDCDGLV-----PIDSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKR 1508
            M C  C   +  E+   A++VC DCG     +    E+EF ETS G    VG  +            ++ + +I+ +C  L L   + + A   Y+SA  RG+T+GR AL VA +C+YLA+R    ++MLLD+SD + +NVYVLG  Y+ ++      + ++DPCL+I RFA+++E GDK  +V+ TA++LLQRMKKDW++TGRRP G+ AAALL+AA+IH F+R+ EDVARIA +S+ T RKRLEE+ RTPT+ L++ +F T+D+EEE DPPAFT    K   SV E+ E  F RI  +I E++++I+ E     D          +  +E      ++ LL  I  + D                   NED+     I+    R+++++ ++  V  +L           T  S +EVC                    +P  KL             + +P+ LP+      V     P   +    +  IDD EL   YIL   E + K   +YK N +Y +N +   +   EKL+R ++ +K P  KR +R
Sbjct:    1 MRCTHCGGTSFDEDRARADLVCLDCGMVLSENVICSEVEFVETSAGVSAAVGRFV-----------SDETRRRIDTICGHLRLGNDIATSAFRFYQSALFRGITRGRGALQVAASCVYLAARQLRVNLMLLDLSDAVGINVYVLGHCYTELRRRLHLSIPEMDPCLYIERFASQLEFGDKMPVVATTAMRLLQRMKKDWLTTGRRPSGLAAAALLVAARIHEFNRNEEDVARIARISQQTARKRLEEFGRTPTSALSIEDFFTVDYEEEQDPPAFTSAR-KSDESVKELDEASFARISAEINELERRIDVELQSLIDKRSSRKLRIKLEEMEVGHSKGINHLLYPISESNDQTDQAATSTPGQSSPHASVNEDITSTASIDPTPTRSILRDVLDGIVEPSLLDSCVEDLRILTEHSGAEVCELLSQAEAQQSLVDQNPESLDPDSKLNGESEPTSEEKPNESIPMKLPLFLPSARVAKIEYPDMKDGTLSLEGIDDEELDQEYILHPREVMIKAAIWYKANAEYLQNARRKHL---EKLRRAEEDAKNPPKKRARR 541          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Cavefish
Match: brf1b (BRF1 RNA polymerase III transcription initiation factor subunit [Source:NCBI gene;Acc:103030783])

HSP 1 Score: 218.009 bits (554), Expect = 3.796e-62
Identity = 161/529 (30.43%), Postives = 253/529 (47.83%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPA----------------AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEI-TEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNL------FTNFSKSEVCITNPVCKLDQLPLV-----LPISDCDGLVPI----------DSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKR--IQDSSKKPRTKRQ 1502
             +S +C++C   ++  +      VC  CG   E +    E++F E S G    +G  +    P                 ++  T+   K +I+ L ++L L  +    A   +K    + LT+GR    V  ACLYL  R +    MLLD+SD + VNVY+LGKT+ ++          +DPCL+I RFA  +E G+KT  VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V R+  V E T RKRL E+  TPT++LT+ EF  +D E E DPP+F     K K+   E    K+    + +I   + +IE E   +   ++  ++        D  + L        S+P  E+    EE+      + +    +++ NL       T   + +     P      +PL      LP +   GL             D + E D+  ID+ E I  YIL+ +E   K   + K N++Y R +K  + R A++ ++   ++  KKP  +R+
Sbjct:    1 MSSRQCQNCGGADIDIDQARGSAVCTACGSVLEDNIIVSEVQFVENSGGGASAIGQFVSADGPVKAPVLGSSFHTSLGKESRVQTLQNGKRQIHSLGSQLQLNQHCLDTAFNFFKMVVSKHLTRGRKMTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYILGKTFLLLARELCINAPAVDPCLYIPRFAHMLEFGEKTHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHEFRRTVKEVIRVVKVCEATLRKRLTEFEDTPTSHLTIDEFMRVDLEAECDPPSFVAGQKKLKMQQLEHELAKKLDEYQGEISSYRDEIETELENSRPKLKGIYAAYTKEDTYDDSLSL-------SSDPAGEEDLEDEEMEAAAQHLSKDFICQMLPNLEHSPHSVTEAQEQDKEPAGPSVSSTHVPLAALLGPLPSAASLGLTESIRHCITEDKEDGDGELDLEGIDEDE-IEKYILNEKEVQAKTELWMKQNEEYLREQKEKEERIAKEKEQGTYKEKPKKPSKRRE 521          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Cavefish
Match: brf1b (BRF1 RNA polymerase III transcription initiation factor subunit [Source:NCBI gene;Acc:103030783])

HSP 1 Score: 213.001 bits (541), Expect = 4.928e-60
Identity = 160/533 (30.02%), Postives = 252/533 (47.28%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPA----------------AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEI-TEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNL------FTNFSKSEVCITNPVCKLDQLPLV-----LPISDCDGLVPI--------------DSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKR--IQDSSKKPRTKRQ 1502
             +S +C++C   ++  +      VC  CG   E +    E++F E S G    +G  +    P                 ++  T+   K +I+ L ++L L  +    A   +K    + LT+GR    V  ACLYL  R +    MLLD+SD + VNVY+LGKT+ ++          +DPCL+I RFA  +E G+KT  VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V R+  V E T RKRL E+  TPT++LT+ EF  +D E E DPP+F     K K+   E    K+    + +I   + +IE E   +   ++  ++        D  + L        S+P  E+    EE+      + +    +++ NL       T   + +     P      +PL      LP +   GL                   + E D+  ID+ E I  YIL+ +E   K   + K N++Y R +K  + R A++ ++   ++  KKP  +R+
Sbjct:    1 MSSRQCQNCGGADIDIDQARGSAVCTACGSVLEDNIIVSEVQFVENSGGGASAIGQFVSADGPVKAPVLGSSFHTSLGKESRVQTLQNGKRQIHSLGSQLQLNQHCLDTAFNFFKMVVSKHLTRGRKMTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYILGKTFLLLARELCINAPAVDPCLYIPRFAHMLEFGEKTHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHEFRRTVKEVIRVVKVCEATLRKRLTEFEDTPTSHLTIDEFMRVDLEAECDPPSFVAGQKKLKMQQLEHELAKKLDEYQGEISSYRDEIETELENSRPKLKGIYAAYTKEDTYDDSLSL-------SSDPAGEEDLEDEEMEAAAQHLSKDFICQMLPNLEHSPHSVTEAQEQDKEPAGPSVSSTHVPLAALLGPLPSAASLGLTESIRHCITEDKEDEGKSDSGELDLEGIDEDE-IEKYILNEKEVQAKTELWMKQNEEYLREQKEKEERIAKEKEQGTYKEKPKKPSKRRE 525          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Cavefish
Match: brf1b (BRF1 RNA polymerase III transcription initiation factor subunit [Source:NCBI gene;Acc:103030783])

HSP 1 Score: 213.001 bits (541), Expect = 7.550e-60
Identity = 160/533 (30.02%), Postives = 252/533 (47.28%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPA----------------AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEI-TEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNL------FTNFSKSEVCITNPVCKLDQLPLV-----LPISDCDGLVPI--------------DSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKR--IQDSSKKPRTKRQ 1502
             +S +C++C   ++  +      VC  CG   E +    E++F E S G    +G  +    P                 ++  T+   K +I+ L ++L L  +    A   +K    + LT+GR    V  ACLYL  R +    MLLD+SD + VNVY+LGKT+ ++          +DPCL+I RFA  +E G+KT  VSMTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  ++V R+  V E T RKRL E+  TPT++LT+ EF  +D E E DPP+F     K K+   E    K+    + +I   + +IE E   +   ++  ++        D  + L        S+P  E+    EE+      + +    +++ NL       T   + +     P      +PL      LP +   GL                   + E D+  ID+ E I  YIL+ +E   K   + K N++Y R +K  + R A++ ++   ++  KKP  +R+
Sbjct:    1 MSSRQCQNCGGADIDIDQARGSAVCTACGSVLEDNIIVSEVQFVENSGGGASAIGQFVSADGPVKAPVLGSSFHTSLGKESRVQTLQNGKRQIHSLGSQLQLNQHCLDTAFNFFKMVVSKHLTRGRKMTHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYILGKTFLLLARELCINAPAVDPCLYIPRFAHMLEFGEKTHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHEFRRTVKEVIRVVKVCEATLRKRLTEFEDTPTSHLTIDEFMRVDLEAECDPPSFVAGQKKLKMQQLEHELAKKLDEYQGEISSYRDEIETELENSRPKLKGIYAAYTKEDTYDDSLSL-------SSDPAGEEDLEDEEMEAAAQHLSKDFICQMLPNLEHSPHSVTEAQEQDKEPAGPSVSSTHVPLAALLGPLPSAASLGLTESIRHCITEDKEDEGKSDSGELDLEGIDEDE-IEKYILNEKEVQAKTELWMKQNEEYLREQKEKEERIAKEKEQGTYKEKPKKPSKRRE 525          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Cavefish
Match: brf1a (transcription factor IIIB 90 kDa subunit-like [Source:NCBI gene;Acc:103040939])

HSP 1 Score: 211.46 bits (537), Expect = 1.376e-59
Identity = 125/330 (37.88%), Postives = 182/330 (55.15%), Query Frame = 3
Query:   48 ECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLI--------------LTGFPA-AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLS-VPEITEKQFIRIKQDILEMKQKIEEETNQN 989
            +CK+C   N+  + T  + VC  CG   E +    E+ F E S G    VG  +               TG    ++  T+  AK  IN L ++L +  +  + A   YK A  + LT+GR +  V  ACLYL  R +    MLLD+SD + VNVYVLG+T+  + +        IDPCL++ RFA  +E G+K+  VSMTAL+L+QRMK+DW+ TGRRP G+  AALL+AA++H F R  +DV  +  V E T RKRL E+  TPT+ LT+ EF  +D ++E DPP+F     + +L  + E   K+   ++ +I   + +IE E   N
Sbjct:    3 KCKNCGGTNIDVDQTRGDAVCMGCGSVLEDNIIVSEVTFVENSGGGSSAVGQFVASDASGNAPSLGGNFTGMGKESRAQTLQNAKRNINHLGHQLQMNQHCLNTAFNFYKMALCKRLTRGRKSAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGRTFLALAKELCINAPAIDPCLYVPRFAQMLEFGEKSHEVSMTALRLVQRMKRDWMHTGRRPSGLCGAALLVAARMHEFHRTIKDVIGVVKVCEATLRKRLSEFEDTPTSELTIEEFMRVDLDQECDPPSFKDGLRRIRLQKIEEELAKKIDEVQGEICGYQDEIEMELESN 332          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Cavefish
Match: brf2 (BRF2 RNA polymerase III transcription initiation factor subunit [Source:NCBI gene;Acc:103028366])

HSP 1 Score: 53.1434 bits (126), Expect = 4.905e-7
Identity = 54/239 (22.59%), Postives = 99/239 (41.42%), Query Frame = 3
Query:   51 CKSCRSKNVVEND--TNAEIVCEDCGWFC---------EIDNYKGEIEFHETSNGSKVPVGCLILTGFPAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPAL---------IVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCL---FINR-----FAARMELGDKTAIVSMTALKLLQR-------MKKDWISTGRRP 662
            C  C S NVVE+D  +  + VCEDCG              + +   + ++E++  SK P   LI             K   ++  LC  L +   + S A+ +++ A+      G PA          ++ GAC+ L  R  ++ V +  IS+ + V +  +G  Y  + ++      +I+P      IN      +  ++  G+   + + T  +L++R           W+ TGR+P
Sbjct:    5 CPECGSSNVVEDDLYSQKQWVCEDCGSLVSEGVFTTTLSDEQHSRTVPYYESTETSKKPCPNLI-------------KGLIRVRALCRILRVPGDMESGAVSLFERAY------GNPAFLQVRLQKKEVLGGACILLICRQNNRPVTMGTISNLLEVELAFVGVVYQDLIKAL-----NIEPSTATSLINMLESYCYGYKLSPGEVAEVFAETPRRLVERSTALAELAADTWLVTGRQP 219          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Yeast
Match: BRF1 (TFIIIB B-related factor; one of three subunits of RNA polymerase III transcription initiation factor TFIIIB, binds TFIIIC and TBP and recruits RNA pol III to promoters, amino-terminal half is homologous to TFIIB; mutations in human homolog are associated with autosomal recessive cerebellar-facial-dental syndrome [Source:SGD;Acc:S000003478])

HSP 1 Score: 159.458 bits (402), Expect = 2.625e-42
Identity = 106/327 (32.42%), Postives = 172/327 (52.60%), Query Frame = 3
Query:   51 CKSCRSKNVVENDTNA--EIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPAA----------KQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTY-SVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEE-EFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQN 989
            CK+C       + +NA  ++VC+ CG   E +    E+ F ETS G+ V  G  I  G   A          ++ T+N A+ K+  +   L +  Y+   A + YK A      +GR +  V  +CLY+A R +    ML+D S ++ V+VY +G T+  ++K+    +L   DP LFI  FA +++L DK   V   A+KL QRM KDW+  GRRP G+  A +LLA ++++  R + ++  ++ V+E T ++RL E+  T  A L++ +F+  D E+ E  PP+F  +N K +  + +  +K+         EM Q  EE  N+N
Sbjct:    4 CKNCHGTEFERDLSNANNDLVCKACGVVSEDNPIVSEVTFGETSAGAAVVQGSFIGAGQSHAAFGGSSALESREATLNNARRKLRAVSYALHIPEYITDAAFQWYKLALANNFVQGRRSQNVIASCLYVACRKEKTHHMLIDFSSRLQVSVYSIGATFLKMVKKLHITELPLADPSLFIQHFAEKLDLADKKIKVVKDAVKLAQRMSKDWMFEGRRPAGIAGACILLACRMNNLRRTHTEIVAVSHVAEETLQQRLNEFKNTKAAKLSVQKFRENDVEDGEARPPSFV-KNRKKERKIKDSLDKE---------EMFQTSEEALNKN 320          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Nematostella
Match: EDO28578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T629])

HSP 1 Score: 201.83 bits (512), Expect = 1.134e-57
Identity = 121/337 (35.91%), Postives = 184/337 (54.60%), Query Frame = 3
Query:   51 CKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILT------GFPAAKQHT---------INKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSV-----PEITE--KQFIRIKQDILEMKQKIEEETNQNDT 995
            C +C   ++  + +  + VC  CG   E +    E++F E S G    +G  + +      G P+    T         + K + +IN L ++L +  +    A   YK A  + LT+GR    V  ACLYL  R +    MLLD SD + ++V+ LG+ Y  + +     L  IDPCL+I+RFA ++ELG+K   V++TAL+L+ RMK+DWI  GRRP G+  AALL+A+++H F+R   +V ++  +S+ T RKRL E+  TP++ LT+ EF  ID EEE DPP FT    K K        PEIT+  ++F     +IL ++Q+I  + N   T
Sbjct:    5 CSNCGGSDIDLDPSRGDAVCMGCGSVLEDNIIVSEVQFQENSLGGTSAIGQFVSSEGKEQFGTPSRGGGTYVHLNHFWSLFKGRKRINQLGHQLQMNQHCIDTAYNFYKLAVNKRLTRGRRTAHVVAACLYLVCRTERTPHMLLDFSDILQIDVFTLGRAYLKLAQELYINLPAIDPCLYIHRFAHKLELGEKEHDVAVTALRLVSRMKRDWIHHGRRPSGLCGAALLVASRLHSFNRSVREVVKVVRISDTTIRKRLGEFKDTPSSQLTIDEFHKIDLEEEQDPPCFTHARKKAKQQAEDVVNPEITQEVEKFRTEIDNILGIRQEIRNQENTEKT 341          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Nematostella
Match: EDO38125 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDS2])

HSP 1 Score: 96.6709 bits (239), Expect = 5.375e-24
Identity = 53/112 (47.32%), Postives = 74/112 (66.07%), Query Frame = 3
Query:  600 MTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSV-----PEITEK 920
            +TAL+L+ RMK+DWI  GRRP G+  AALL+A+++H F+R   +V ++  +S+ T RKRL E+  TP++ LT+ EF  ID EEE DPP FT    K K        PEIT++
Sbjct:    1 VTALRLVSRMKRDWIHHGRRPSGLCGAALLVASRLHSFNRSVREVVKVVRISDTTIRKRLGEFKDTPSSQLTIDEFHKIDLEEEQDPPCFTHARKKAKQQAEDVVNPEITQE 112          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Nematostella
Match: EDO38124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDS0])

HSP 1 Score: 50.447 bits (119), Expect = 1.850e-7
Identity = 36/139 (25.90%), Postives = 58/139 (41.73%), Query Frame = 3
Query:   42 SMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILT-------GFPAAKQH---------TINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASR 410
            S  C +C   ++  + +  + VC  CG   E +    E++F E S G    +G  + +       G     +H         T+   + +IN L ++L +  +    A   YK A  + LT+GR    V  ACLYL  R
Sbjct:    2 SSVCSNCGGSDIDLDPSRGDAVCMGCGSVLEDNIIVSEVQFQENSLGGTSAIGQFVSSEGNKAGIGLGTGFRHGLAQESRAITLENGRKRINQLGHQLQMNQHCIDTAYNFYKLAVNKRLTRGRRTAHVVAACLYLVCR 140          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Nematostella
Match: EDO36932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH79])

HSP 1 Score: 47.3654 bits (111), Expect = 9.953e-6
Identity = 43/187 (22.99%), Postives = 91/187 (48.66%), Query Frame = 3
Query:  213 TGFPAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRK 773
            +G   A +  +N  ++ I+++ +++ L   +   A +++K    +   KGR    +A ACLY+A R +     L +I     ++   +G+ + +I +     +  I    F++RF + + L      V   A  + +R  +  +  GR P  + AAA+ +A++     R  +++  IAGV+++T R+
Sbjct:   99 SGMSGADRSLMNAFRE-ISIMADRINLPRKIVDRANQLFKQVHEQKSLKGRSNDTIASACLYIACRQEGVPRTLKEICAIGKISKKEIGRCFKLILKHLETSVDLITSGDFMSRFCSNLTL---PLSVQKAATYIARRAVELDLVAGRSPISIAAAAIYMASQASEEKRSQKEIGDIAGVADVTIRQ 281          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Medaka
Match: ENSORLT00000022392.2 (BRF1, RNA polymerase III transcription initiation factor subunit [Source:NCBI gene;Acc:101163291])

HSP 1 Score: 208.764 bits (530), Expect = 1.720e-58
Identity = 169/543 (31.12%), Postives = 260/543 (47.88%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTG------------FPA----AKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDL--LLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLF-----TNFSKSEVCITNP-------VCKLDQLP----LVLP--ISDCDGLVPIDSNA----EFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVL 1544
             +S  CK+C S  +  +      VC  CG   + +    E+EF ET  G  + VG  + +             +P     ++  T+ +AK  IN L ++L +  +    A   YK A  + LT G  +  V  ACLYL  R +    MLLD+SD + VNVYVLGK +  + +        IDPCL+I RFA  +E G+K   VSMTA++L+QRMK+DW+ TGRRP G+  AALL++A +H F R  ++V  +  V E T RKRL E+  TPT+ LT+ EF  +D +EE DPP++T    K K    +  EKQ +    D+ +  +  ++E +    S+      + ++         D+  +L   D N  +ED    EE+        + +++  V  L      T   ++E  +  P          L  +P    L LP  I+ C G    +  A    E D++ IDD+E I  Y+LS  E   K   +   N DY + +K  + + A++ +      KKP++  +KR      T DE +
Sbjct:    1 MSSKVCKNCGSTAIDVDHARGNAVCMSCGSVLDDNIIVSEVEFVETGGGGSLAVGQFVSSEGGQRLPSFGDSYYPGVGSQSRAQTLQRAKQNINTLGHQLQMNQHCLDTAFNFYKMALNKRLTNGHRSSHVIAACLYLVCRTEGTPHMLLDLSDVLQVNVYVLGKVFLHLAKELCINAPAIDPCLYIPRFAQMLEFGEKNHDVSMTAMRLVQRMKRDWMHTGRRPSGLCGAALLVSAHMHDFCRTVKEVVNVVKVCESTLRKRLTEFEDTPTSKLTVEEFMRVDLDEECDPPSYTAGLKKTKT---QQLEKQLMEKMPDVEDEIKGYQDEIDAELESLRPKLKGVYAAYVNRDLSSEDIRSMLSQQDDNQSDED----EELRAVARHFDKDLDTLTVEALIKLEQKTPEEENECGMKIPERVGPSLASILGTMPSAATLGLPESINKCTGEERENDGAADSGELDLSGIDDSE-IELYLLSESEIKIKTALWMAENSDYLKEQKEKEAKIAKEKELGIYKEKKPKSSGKKRSQIRASTADEAI 535          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Medaka
Match: ENSORLT00000044900.1 (pep primary_assembly:ASM223467v1:24:23127015:23129105:-1 gene:ENSORLG00000024040.1 transcript:ENSORLT00000044900.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 2.536e-25
Identity = 59/140 (42.14%), Postives = 88/140 (62.86%), Query Frame = 3
Query:  600 MTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFT-GQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFS 1016
            MTAL+LLQRMK+DW+ TGRRP G+  AALL+AA++H F R  +DV  +  V   T RKRL E+  TPT+ LT+ EF  +D E+E DPP++T GQ+    L + +   K+   ++ +I   K +IE E  ++   +   ++
Sbjct:    1 MTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMHKFRRSVKDVISVVKVCHTTLRKRLTEFEDTPTSQLTIDEFMRVDLEQECDPPSYTAGQHKVKMLQLEQELTKKLDEVEGEISCYKDEIENELEKSRPKLRGIYA 140          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Medaka
Match: ENSORLT00000022757.2 (pep primary_assembly:ASM223467v1:24:23136217:23147112:-1 gene:ENSORLG00000018171.2 transcript:ENSORLT00000022757.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 1.995e-12
Identity = 49/166 (29.52%), Postives = 75/166 (45.18%), Query Frame = 3
Query:   36 FTSMECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVG-----------CLILTGFPAA-----KQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISD--KINVNVYVLG 479
             +S  CK+C   ++  +      VC  CG   E +    E++F E S G    VG            L+ +GF  +     +  T+   K +I  L ++L L  +    A   +K A  + LT+GR    V  ACLYL  R +    MLLD+SD  ++ + VY+LG
Sbjct:    1 MSSRVCKTCGGGDIDVDQARGSAVCTSCGSVLEDNIIVSEVQFVEGSGGVSSAVGQFVSADGPVKAPLLGSGFHTSVGKESRAQTLQNGKRQIQKLGSQLQLNQHCLDTAFNFFKLAVSKHLTRGRKTEHVIAACLYLVCRTEGTPHMLLDLSDLLQVRLTVYMLG 166          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Planmine SMEST
Match: SMESG000049775.1 (SMESG000049775.1)

HSP 1 Score: 1144.03 bits (2958), Expect = 0.000e+0
Identity = 561/564 (99.47%), Postives = 562/564 (99.65%), Query Frame = 3
Query:   45 MECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVPIDSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREIKPSYEGSETKIMKLSPGKEEVAQSPQNSPMKCERDYPPSEDDVPDGESDAPGMNDNYDADD 1736
            MECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTAAALLLAAKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNL+SSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVPIDSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREIKPSYEGSETKIMKLSPGKEEVAQS QNSPMKCERDYPPSEDDVPDGESDA GMNDNYDADD
Sbjct:    1 MECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTAAALLLAAKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQDILEMKQKIEEETNQNDTSMENNFSNLLSSVEEDGEIPLDLLLGDIDSNPDNEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQLPLVLPISDCDGLVPIDSNAEFDMTDIDDAELISTYILSHEESVKKLRWFYKTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVLREIKPSYEGSETKIMKLSPGKEEVAQSSQNSPMKCERDYPPSEDDVPDGESDALGMNDNYDADD 564          
BLAST of Transcription factor IIIB 90 kDa subunit vs. Planmine SMEST
Match: SMESG000010000.1 (SMESG000010000.1)

HSP 1 Score: 99.7525 bits (247), Expect = 9.915e-23
Identity = 68/260 (26.15%), Postives = 131/260 (50.38%), Query Frame = 3
Query:   48 ECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVPVGCLILTGFPAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFMRGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSVIKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWISTGRRPCGVTXXXXXXXXKIHHFDRHYEDVARIAGVSEITCRKRLEEWARTPTANLTLSEF 827
            +C  C S +  E+  + +++C +CG   E +  + ++     + G     G    +G   ++   I + K  I   C+KL L   +   +L+ +K    +  T G    ++ G C+Y A+  K + ++LLDIS+K+NV+VY L K    +K   G + +  DP +FINRF   ++   K   +   A+K+++ ++ D       P  +   A+++AAK++H ++ ++ +    G+ + T  K + +W +T TA + L EF
Sbjct:    3 KCFKCGSVDYDEDFNSRDLICLNCGTIYEGNETQNKVAVLNYAMGENFVGGKQEYSG-NISRFRLIRRTKQLIYSWCSKLKLSEDLNESSLDYFKKLLDKRKTIGVRKNMIIGVCIYFAAMSKGEPIILLDISNKLNVSVYKLVKLSKKLKTVLGLQFKAQDPLIFINRFVDYLQFEQKKKEIIQAAMKIVKMLEIDLKEITCSPTAIAVTAVVIAAKLNHIEKSHDQICIKFGICKQTVNKLINKWKKTATAQIPLEEF 261          
The following BLAST results are available for this feature:
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BRF12.381e-5930.56BRF1 RNA polymerase III transcription initiation f... [more]
BRF16.479e-5931.14BRF1 RNA polymerase III transcription initiation f... [more]
BRF17.719e-5233.17BRF1 RNA polymerase III transcription initiation f... [more]
BRF12.936e-4931.28BRF1 RNA polymerase III transcription initiation f... [more]
BRF11.464e-3546.51BRF1 RNA polymerase III transcription initiation f... [more]
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
brf-12.257e-5029.32BRF (Transcription factor) homolog [Source:UniPro... [more]
brf-16.114e-4934.17BRF (Transcription factor) homolog [Source:UniPro... [more]
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Brf1.012e-5530.71gene:FBgn0038499 transcript:FBtr0302317[more]
Brf1.012e-5530.71gene:FBgn0038499 transcript:FBtr0083452[more]
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brf1a1.653e-6032.77BRF1 RNA polymerase III transcription initiation f... [more]
brf1a1.653e-6032.77BRF1 RNA polymerase III transcription initiation f... [more]
brf1b9.460e-5930.75BRF1 RNA polymerase III transcription initiation f... [more]
brf1b9.460e-5930.75BRF1 RNA polymerase III transcription initiation f... [more]
brf1b3.121e-5029.17BRF1 RNA polymerase III transcription initiation f... [more]
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npas38.180e-6331.05neuronal PAS domain protein 3 [Source:Xenbase;Acc:... [more]
npas34.200e-6231.05neuronal PAS domain protein 3 [Source:Xenbase;Acc:... [more]
npas32.270e-6132.26neuronal PAS domain protein 3 [Source:Xenbase;Acc:... [more]
npas32.843e-5630.74neuronal PAS domain protein 3 [Source:Xenbase;Acc:... [more]
npas38.619e-5529.76neuronal PAS domain protein 3 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Brf12.445e-6230.73BRF1, RNA polymerase III transcription initiation ... [more]
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CFK2|TF3B_MOUSE1.781e-6130.73Transcription factor IIIB 90 kDa subunit OS=Mus mu... [more]
sp|Q92994|TF3B_HUMAN1.144e-5830.56Transcription factor IIIB 90 kDa subunit OS=Homo s... [more]
sp|P46070|TF3B_KLULA9.303e-4232.35Transcription factor IIIB 70 kDa subunit OS=Kluyve... [more]
sp|P29056|TF3B_YEAST1.823e-4032.42Transcription factor IIIB 70 kDa subunit OS=Saccha... [more]
sp|P43072|TF3B_CANAL1.217e-3826.31Transcription factor IIIB 70 kDa subunit OS=Candid... [more]
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0S3132.234e-8834.05Transcription factor IIIB subunit OS=Fasciola hepa... [more]
A0A4S2MG705.922e-8334.22TFIIB-type domain-containing protein OS=Opisthorch... [more]
A0A5J4N8F92.076e-8245.89Transcription factor IIIB 90 kDa subunit OS=Parago... [more]
A0A504Z5221.395e-8143.02Transcription factor IIIB subunit OS=Fasciola giga... [more]
G7YT461.565e-8133.99Transcription initiation factor brf1 OS=Clonorchis... [more]
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brf1b3.796e-6230.43BRF1 RNA polymerase III transcription initiation f... [more]
brf1b4.928e-6030.02BRF1 RNA polymerase III transcription initiation f... [more]
brf1b7.550e-6030.02BRF1 RNA polymerase III transcription initiation f... [more]
brf1a1.376e-5937.88transcription factor IIIB 90 kDa subunit-like [Sou... [more]
brf24.905e-722.59BRF2 RNA polymerase III transcription initiation f... [more]
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BRF12.625e-4232.42TFIIIB B-related factor; one of three subunits of ... [more]
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO285781.134e-5735.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381255.375e-2447.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381241.850e-725.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369329.953e-622.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000022392.21.720e-5831.12BRF1, RNA polymerase III transcription initiation ... [more]
ENSORLT00000044900.12.536e-2542.14pep primary_assembly:ASM223467v1:24:23127015:23129... [more]
ENSORLT00000022757.21.995e-1229.52pep primary_assembly:ASM223467v1:24:23136217:23147... [more]
back to top
BLAST of Transcription factor IIIB 90 kDa subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000049775.10.000e+099.47SMESG000049775.1[more]
SMESG000010000.19.915e-2326.15SMESG000010000.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013060 ID=SMED30013060|Name=Transcription factor IIIB 90 kDa subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1834bp
TTTTTTCACTTTTTAGTTAACCTTTAAATCTATATTTTACTTCTATGGAA
TGCAAATCTTGCAGGAGCAAAAATGTTGTCGAAAATGATACTAACGCAGA
AATAGTATGTGAAGATTGTGGGTGGTTTTGTGAAATCGATAATTATAAAG
GTGAGATTGAATTTCATGAAACATCAAATGGTAGTAAAGTTCCTGTTGGA
TGCTTGATTTTAACCGGATTCCCTGCTGCAAAACAACATACTATAAATAA
AGCTAAGGATAAAATAAATGTCTTATGTAATAAATTGTGTCTTGAGCCAT
ATGTCGGTTCATATGCTTTAGAGATTTATAAATCAGCTTTTATGAGGGGT
CTGACTAAAGGGCGACCGGCTTTAATCGTAGCTGGAGCTTGTCTATATTT
GGCGTCACGCTTAAAACATCAATCAGTTATGTTGTTAGATATCAGTGATA
AGATTAACGTAAATGTTTACGTGCTTGGTAAAACATATTCTGTTATCAAA
GAAAGTTTTGGTCAGAAATTGCAAGATATTGACCCTTGTTTGTTTATTAA
TCGATTTGCGGCTCGTATGGAATTGGGTGATAAAACTGCAATTGTGTCAA
TGACAGCGTTGAAATTATTGCAACGAATGAAAAAAGATTGGATCAGTACA
GGTCGGCGTCCGTGTGGAGTTACAGCAGCTGCGCTACTGTTAGCTGCAAA
AATTCACCATTTCGATAGACATTATGAAGATGTTGCTAGAATTGCTGGGG
TAAGTGAAATAACCTGCCGAAAACGGTTAGAAGAATGGGCAAGAACTCCT
ACCGCAAATTTGACGCTTTCTGAATTTCAAACTATCGATTTTGAGGAAGA
ATTCGATCCACCGGCTTTCACTGGACAAAATCTCAAACCTAAATTATCAG
TTCCAGAAATTACCGAAAAACAATTCATTCGAATCAAGCAAGATATTTTG
GAAATGAAGCAAAAAATTGAAGAAGAGACCAATCAAAACGATACGAGTAT
GGAAAACAATTTCTCAAATTTGATATCATCAGTTGAGGAGGATGGGGAAA
TTCCCTTGGATTTGTTGTTGGGTGACATTGACAGCAATCCCGACAATGAG
GATTTGGACTTCGTGGAGGAAATAAACGGCAGGAGAAATATGATAAAGGA
ATGTATCAATTCAAAAGTAGTGAGAAATTTATTCACGAATTTCTCGAAAT
CAGAAGTCTGTATAACGAATCCCGTGTGTAAATTAGACCAGTTGCCATTG
GTGTTACCGATAAGCGATTGCGATGGCTTGGTACCGATAGATAGCAATGC
AGAGTTCGACATGACAGACATTGACGATGCTGAATTGATATCGACATACA
TTTTGAGCCACGAGGAATCCGTTAAGAAGTTGCGATGGTTTTACAAAACG
AATAAGGATTATTACCGGAATAAAAAATCAACTCAGGTTAGGAAAGCGGA
AAAATTGAAAAGAATCCAGGACAGTTCTAAAAAGCCGAGGACGAAGCGCC
AAAAGCGGGGGGCGGAATTTATGGTGACTCCAGATGAGGTGCTCCGTGAG
ATCAAGCCGAGCTATGAAGGCAGCGAGACTAAAATCATGAAATTGTCTCC
GGGCAAAGAGGAAGTTGCTCAGAGTCCACAAAATTCTCCAATGAAGTGCG
AACGAGATTATCCACCGAGTGAAGACGATGTTCCCGATGGCGAGTCGGAC
GCTCCAGGAATGAATGACAACTACGACGCAGATGATTAGTAGCTGCGATT
ATATTGATAAAGCATCCTCCAATCCGTGATTTATCTGATCTTTGTATTAT
TTTGAATATAGTTGCCTTTTGCTTCAAAAAAAAA
back to top

protein sequence of SMED30013060-orf-1

>SMED30013060-orf-1 ID=SMED30013060-orf-1|Name=SMED30013060-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=565bp
MECKSCRSKNVVENDTNAEIVCEDCGWFCEIDNYKGEIEFHETSNGSKVP
VGCLILTGFPAAKQHTINKAKDKINVLCNKLCLEPYVGSYALEIYKSAFM
RGLTKGRPALIVAGACLYLASRLKHQSVMLLDISDKINVNVYVLGKTYSV
IKESFGQKLQDIDPCLFINRFAARMELGDKTAIVSMTALKLLQRMKKDWI
STGRRPCGVTAAALLLAAKIHHFDRHYEDVARIAGVSEITCRKRLEEWAR
TPTANLTLSEFQTIDFEEEFDPPAFTGQNLKPKLSVPEITEKQFIRIKQD
ILEMKQKIEEETNQNDTSMENNFSNLISSVEEDGEIPLDLLLGDIDSNPD
NEDLDFVEEINGRRNMIKECINSKVVRNLFTNFSKSEVCITNPVCKLDQL
PLVLPISDCDGLVPIDSNAEFDMTDIDDAELISTYILSHEESVKKLRWFY
KTNKDYYRNKKSTQVRKAEKLKRIQDSSKKPRTKRQKRGAEFMVTPDEVL
REIKPSYEGSETKIMKLSPGKEEVAQSPQNSPMKCERDYPPSEDDVPDGE
SDAPGMNDNYDADD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000995transcription factor activity, core RNA polymerase III binding
GO:0017025TBP-class protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006383transcription from RNA polymerase III promoter
GO:0070897DNA-templated transcriptional preinitiation complex assembly
GO:0006352DNA-templated transcription, initiation
GO:0006355regulation of transcription, DNA-templated
GO:0006384transcription initiation from RNA polymerase III promoter
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR000812TFIIB
IPR029529Brf1
IPR036915Cyclin-like_sf
IPR013763Cyclin-like
IPR011665BRF1_TBP-bd_dom
IPR013150TFIIB_cyclin
IPR013137Znf_TFIIB
Vocabulary: cellular component
TermDefinition
GO:0000126transcription factor TFIIIB complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 294..321
NoneNo IPR availableGENE3DG3DSA:1.10.472.10coord: 163..256
e-value: 5.3E-24
score: 86.3
NoneNo IPR availableGENE3DG3DSA:1.10.472.10coord: 61..160
e-value: 2.7E-18
score: 67.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 545..564
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 461..476
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 487..509
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 461..564
IPR013763Cyclin-likeSMARTSM00385cyclin_7coord: 166..250
e-value: 0.011
score: 24.9
coord: 72..153
e-value: 0.028
score: 23.6
IPR013763Cyclin-likeCDDcd00043CYCLINcoord: 66..133
e-value: 8.24426E-5
score: 39.5293
IPR011665Brf1, TBP-binding domainPFAMPF07741BRF1coord: 425..489
e-value: 2.6E-6
score: 27.7
IPR013150Transcription factor TFIIB, cyclin-like domainPFAMPF00382TFIIBcoord: 74..142
e-value: 6.7E-11
score: 42.1
coord: 168..240
e-value: 7.9E-13
score: 48.3
IPR000812Transcription factor TFIIBPANTHERPTHR11618TRANSCRIPTION INITIATION FACTOR IIB-RELATEDcoord: 2..491
IPR029529Transcription factor IIIB subunit Brf1PANTHERPTHR11618:SF4TRANSCRIPTION FACTOR IIIB 90 KDA SUBUNITcoord: 2..491
IPR013137Zinc finger, TFIIB-typePROSITEPS51134ZF_TFIIBcoord: 1..30
score: 7.844
IPR036915Cyclin-like superfamilySUPERFAMILYSSF47954Cyclin-likecoord: 69..157
IPR036915Cyclin-like superfamilySUPERFAMILYSSF47954Cyclin-likecoord: 162..261