Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30013054
Length (bp)3643
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30013054) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30013054) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30013054) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30013054) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013054

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013054SMESG000020466.1 Contig3128newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30013054SMESG000066997.1 Contig3128newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30013054SMESG000020466.1 SmedASXL_017431SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30013054SMESG000020466.1 dd_Smed_v4_11366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013054SMESG000020466.1 dd_Smed_v4_11366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30013054SMESG000020466.1 dd_Smed_v4_11366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30013054SMESG000020466.1 dd_Smed_v4_11366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30013054SMESG000020466.1 dd_Smed_v6_11366_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30013054SMESG000020466.1 dd_Smed_v4_11366_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK1 (NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC:7744])

HSP 1 Score: 351.288 bits (900), Expect = 4.381e-101
Identity = 215/573 (37.52%), Postives = 319/573 (55.67%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNE-----TKKQIQKRPSTASVVSRVDSGLSNKKKARVGRDNALINSP--YMQIPNRNIHDKR---------VSP----------RIVKQDA--------------------NPLVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMT--PAAIKQKINSPAYDRYYAELDRIKEQQVL-------RENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDAS------KPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALL 1660
            + RL KIG+G+FG A LV+S  D ++YV+KEI + +M  KER E+R+EV++L+ M HPNIV Y  SFEE G  +I+M+YCEGGDL+++I  Q GVLF+EDQ+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYELC+L +AF    +  L ++I   ++ PV   +S  LR+LV  +F+R P +RP++N+IL K FI K+I+KFL P+  L+ E     T  +   +P  A   +   + +S     ++ +  A    P  Y +  ++ +H+K+          +P          R + ++A                    + +   Q +   K ++E IN  RE GW+NVL      S     ++ A     G T  P++   +     Y+ Y+A  D++++Q+         RE  GR L +  +               GA G +   DA       K     SK     R  G++    A Q  ++EF++RKR+A   K R    M +L
Sbjct:    4 YVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQ--LIAEEFCLKTFSKFGSQPIPAKRPASGQNSISVMPAQKITKPAAKYGIPLAYKKYGDKKLHEKKPLQKHKQAHQTPEKRVNTGEERRKISEEAARKRRLEFIEKEKKQKDQIISLMKAEQMKRQEKERLERINRAREQGWRNVL------SAGGSGEVKAPFLGSGGTIAPSSFSSR---GQYEHYHAIFDQMQQQRAEDNEAKWKREIYGRGLPERGILPGVRPG-----FPYGAAGHHHFPDADDIRKTLKRLKAVSKQANANRQKGQLAVERAKQ--VEEFLQRKREAMQNKARAEGHMGIL 558          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK1 (NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC:7744])

HSP 1 Score: 348.977 bits (894), Expect = 1.994e-100
Identity = 215/573 (37.52%), Postives = 318/573 (55.50%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNE-----TKKQIQKRPSTASVVSRVDSGLSNKKKARVGRDNALINSP--YMQIPNRNIHDKR---------VSP----------RIVKQDA--------------------NPLVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMT--PAAIKQKINSPAYDRYYAELDRIKEQQVL-------RENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDAS------KPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALL 1660
            + RL KIG+G+FG A LV+S  D ++YV+KEI + +M  KER E+R+EV++L+ M HPNIV Y  SFEE G  +I+M+YCEGGDL+++I  Q GVLF+EDQ+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYELC+L +AF    +  L ++I   ++ PV   +S  LR+LV  +F+R P +RP++N+IL K FI K+I+KFL P+  L+ E     T  +   +P  A   +   + +S     ++ +  A    P  Y +  ++ +H+K+          +P          R + ++A                    + +   Q +   K ++E IN  RE GW+NVL      S     ++ A     G T  P++   +     Y+ Y+A  D++++Q+         RE  GR L +  +               GA G +   DA       K     SK     R  G++    A Q  ++EF++RKR+A   K R    M  L
Sbjct:    4 YVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQ--LIAEEFCLKTFSKFGSQPIPAKRPASGQNSISVMPAQKITKPAAKYGIPLAYKKYGDKKLHEKKPLQKHKQAHQTPEKRVNTGEERRKISEEAARKRRLEFIEKEKKQKDQIISLMKAEQMKRQEKERLERINRAREQGWRNVL------SAGGSGEVKAPFLGSGGTIAPSSFSSR---GQYEHYHAIFDQMQQQRAEDNEAKWKREIYGRGLPERGILPGVRPG-----FPYGAAGHHHFPDADDIRKTLKRLKAVSKQANANRQKGQLAVERAKQ--VEEFLQRKREAMQNKARAEGHMVYL 558          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK1 (NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC:7744])

HSP 1 Score: 347.051 bits (889), Expect = 4.160e-100
Identity = 152/266 (57.14%), Postives = 208/266 (78.20%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE 922
            + RL KIG+G+FG A LV+S  D ++YV+KEI + +M  KER E+R+EV++L+ M HPNIV Y  SFEE G  +I+M+YCEGGDL+++I  Q GVLF+EDQ+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYELC+L +AF    +  L ++I   ++ PV   +S  LR+LV  +F+R P +RP++N+IL K FI K+I+KFL P+
Sbjct:    4 YVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQ 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK1 (NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC:7744])

HSP 1 Score: 347.051 bits (889), Expect = 5.136e-100
Identity = 152/266 (57.14%), Postives = 208/266 (78.20%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE 922
            + RL KIG+G+FG A LV+S  D ++YV+KEI + +M  KER E+R+EV++L+ M HPNIV Y  SFEE G  +I+M+YCEGGDL+++I  Q GVLF+EDQ+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYELC+L +AF    +  L ++I   ++ PV   +S  LR+LV  +F+R P +RP++N+IL K FI K+I+KFL P+
Sbjct:    4 YVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQ 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: NEK1 (NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC:7744])

HSP 1 Score: 347.436 bits (890), Expect = 6.432e-100
Identity = 152/266 (57.14%), Postives = 208/266 (78.20%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE 922
            + RL KIG+G+FG A LV+S  D ++YV+KEI + +M  KER E+R+EV++L+ M HPNIV Y  SFEE G  +I+M+YCEGGDL+++I  Q GVLF+EDQ+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYELC+L +AF    +  L ++I   ++ PV   +S  LR+LV  +F+R P +RP++N+IL K FI K+I+KFL P+
Sbjct:    4 YVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQ 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-2 (Serine/threonine-protein kinase nekl-2 [Source:UniProtKB/Swiss-Prot;Acc:O01775])

HSP 1 Score: 223.402 bits (568), Expect = 1.962e-64
Identity = 111/269 (41.26%), Postives = 166/269 (61.71%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDC--KKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGV-------LFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSV-KLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFIL 892
            + +++++  +G+GAFG+ WL   K D   +K ++K I  + M EKE    + EV+LL K+ HP I+ Y +SF       I+M+Y EGG L R I  Q  +        F E  VLDYF QI +AL H+H + I+HRD+KPQNI + +  +V KL DFGI+K + + +A + T +GTP Y SPEICE  PYN KSD+WSLGC+LYEL  L  AF G+++  + M+I +    P+    S  ++ LV+N+ +   D+RP+++ +L  P +L
Sbjct:    1 MDNYEKVRVVGRGAFGVCWLCRGKNDASHQKVIIKLINTHGMTEKEENSIQSEVNLLKKVQHPLIIGYIDSFIMDNQLGIVMQYAEGGTLERLINDQRAIKDSNMREYFPEKTVLDYFTQILIALNHMHQKNIVHRDLKPQNILMNRRKTVLKLSDFGISKELGTKSAAS-TVIGTPNYLSPEICESRPYNQKSDMWSLGCVLYELLQLERAFDGENLPAIVMKITRSKQNPLGDHVSNDVKMLVENLLKTHTDKRPDVSQLLSDPLVL 268          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 232.646 bits (592), Expect = 8.912e-63
Identity = 111/254 (43.70%), Postives = 163/254 (64.17%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKI-KTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTAL--TKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILR 877
            ++R+  +G+GAFG A L   + D    ++KEI +Y +   +R  A  EVSLLS++ HPNI+ YY+SFEE G   I MEY +GG L + + +TQN  L  E+Q+ D  IQ+C A+ ++H+  +LHRD+K  N+FLT+++ VK+GDFGI+K M + T     KT VGTP+Y SPE+C G  YN KSD+W+LGCILYE+C L  AF G ++  L   I    Y PV   +SA ++ ++  + +  P +RP+    L+
Sbjct:  133 YERIRTVGKGAFGSAVLYRRREDSSLVIIKEINMYDLDSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQMLSRTQN--LLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGDNLPALVNSIMTCAYTPVKGPYSAEMKMVIRELLQLDPQKRPSAPQALK 384          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 232.646 bits (592), Expect = 1.105e-62
Identity = 110/248 (44.35%), Postives = 161/248 (64.92%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKI-KTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTAL--TKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPN 859
            ++R+  +G+GAFG A L   + D    ++KEI +Y +   +R  A  EVSLLS++ HPNI+ YY+SFEE G   I MEY +GG L + + +TQN  L  E+Q+ D  IQ+C A+ ++H+  +LHRD+K  N+FLT+++ VK+GDFGI+K M + T     KT VGTP+Y SPE+C G  YN KSD+W+LGCILYE+C L  AF G ++  L   I    Y PV   +SA ++ ++  + +  P +RP+
Sbjct:  171 YERIRTVGKGAFGSAVLYRRREDSSLVIIKEINMYDLDSSQRRLALNEVSLLSRIEHPNIIAYYDSFEEEGVLMIEMEYADGGTLAQMLSRTQN--LLDEEQIGDMMIQMCSAVAYLHENSVLHRDLKTANVFLTRDSFVKIGDFGISKIMGTETLAQGAKTVVGTPYYISPEMCSGVSYNEKSDMWALGCILYEMCCLKKAFEGDNLPALVNSIMTCAYTPVKGPYSAEMKMVIRELLQLDPQKRPS 416          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 185.267 bits (469), Expect = 6.958e-52
Identity = 97/252 (38.49%), Postives = 146/252 (57.94%), Query Frame = 2
Query:  140 KIGQGAFGIAWLVESKIDCKKYVLKEIGLYKM-HEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIK--TQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITI--LAMRIKKVNYKPVPS-VFSAPLRALVDNMFRRRPDERPNINTILR 877
            KIG+G F   +  +         LK+I +++M  +K R +  KE+ LL ++NH N++ YY SF +    +I++E  E GD+ R IK   + G L  E  +  YF+Q+  AL H+H +RI+HRDIKP N+F+T N  VKLGD G+ +   S T    + VGTP+Y SPE  +   YN KSD+WS GC+LYE+ +L   FYG  + +  L  +I+   Y P+P+ ++S  LR LV         +RP  + +L+
Sbjct:   28 KIGKGQFSEVFRAQCTWVDLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVLQ 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: nekl-3 (Serine/threonine-protein kinase nekl-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EFM9])

HSP 1 Score: 185.267 bits (469), Expect = 6.958e-52
Identity = 97/252 (38.49%), Postives = 146/252 (57.94%), Query Frame = 2
Query:  140 KIGQGAFGIAWLVESKIDCKKYVLKEIGLYKM-HEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIK--TQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITI--LAMRIKKVNYKPVPS-VFSAPLRALVDNMFRRRPDERPNINTILR 877
            KIG+G F   +  +         LK+I +++M  +K R +  KE+ LL ++NH N++ YY SF +    +I++E  E GD+ R IK   + G L  E  +  YF+Q+  AL H+H +RI+HRDIKP N+F+T N  VKLGD G+ +   S T    + VGTP+Y SPE  +   YN KSD+WS GC+LYE+ +L   FYG  + +  L  +I+   Y P+P+ ++S  LR LV         +RP  + +L+
Sbjct:   28 KIGKGQFSEVFRAQCTWVDLHVALKKIQVFEMVDQKARQDCLKEIDLLKQLNHVNVIRYYASFIDNNQLNIVLELAEAGDMSRMIKHFKKGGRLIPEKTIWKYFVQLARALAHMHSKRIMHRDIKPANVFITGNGIVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIQESGYNFKSDLWSTGCLLYEMAALQSPFYGDKMNLYSLCKKIENCEYPPLPADIYSTQLRDLVSRCILPEASKRPETSEVLQ 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: niki (gene:FBgn0045980 transcript:FBtr0084737)

HSP 1 Score: 215.698 bits (548), Expect = 1.524e-57
Identity = 110/267 (41.20%), Postives = 165/267 (61.80%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVL-FKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRK--PFILKKIDK 907
            +++++++  +GQG+FGIA L   K D  + V K+I L ++    R  A  EV + SK++HPNIV+Y  SF +     I MEY +GG L + I  + G L F E  ++  F QI  A+ ++H + ILHRD+K  N+FL +   VK+GDFGI+K M+ T    +T +GTP+YFSPE+CEG  Y+NKSDIW+LGCIL E+C L   F   +++ L  +I   NY PVPS +++ LR+L+ N+ +     RP  + +L    P I + + K
Sbjct:  102 LANYEKVRVVGQGSFGIAILYRRKSDGHQIVFKQINLSELSPPGRDLAMNEVDVFSKLHHPNIVSYLGSFIKDNTLLIEMEYADGGTLAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLKTANVFLNRRGIVKIGDFGISKIMN-TKIHAQTVLGTPYYFSPEMCEGKEYDNKSDIWALGCILGEMCCLKKTFAASNLSELVTKIMAGNYTPVPSGYTSGLRSLMSNLLQVEAPRRPTASEVLVYWIPLIFRSLGK 367          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Nek2 (gene:FBgn0029970 transcript:FBtr0071142)

HSP 1 Score: 182.185 bits (461), Expect = 4.352e-47
Identity = 96/296 (32.43%), Postives = 165/296 (55.74%), Query Frame = 2
Query:  113 SISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSF--EEVGCFHILMEYCEGGDLYRKIKTQNGVL--FKEDQVLDYFIQICLALKHIHDQ----RILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQKRPSTA 976
            ++ D++ L  +G G+FG  + V  K   + +  K +   ++ E +      E+S+L ++ HPNIV YY+     E    +I+ME C GGDL + ++        F+E  +     Q+C AL+  H++     ILHRDIKP NIFL    + KLGDFG+A+ +    +   + VGTP Y SPE+ +G  Y+ KSD+W++GC++YE+C+L   F G+    L+ +I +  +  +P+++S  L+ ++  M     ++RP I  I+R P +++ I + L  + P+L ++ +     PS A
Sbjct:   15 TLQDYEVLAVMGNGSFGTCYKVRDKSTGELFAWKGMNYDELDEAKCDALVSEISVLRQLQHPNIVQYYHHLVNREAKSVYIVMECCAGGDLAQIVQRARSQRQRFEEPYIWRVLFQLCRALQVCHNKIPNGTILHRDIKPANIFLDAAGNAKLGDFGLARMLRRDQSFAASFVGTPHYMSPELVKGRKYDRKSDVWAVGCLVYEMCALRPPFRGRAFDQLSEKIAQGEFSRIPAIYSTDLQEIIAFMLAVDHEQRPGIEVIIRHPLVVRNISE-LDGKFPILVDSGEDFYTLPSGA 309          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: fu (gene:FBgn0001079 transcript:FBtr0074602)

HSP 1 Score: 141.354 bits (355), Expect = 9.285e-34
Identity = 94/313 (30.03%), Postives = 152/313 (48.56%), Query Frame = 2
Query:  143 IGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKED--QVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKI-----DKFLPPENPLLN---ETKKQIQKRPSTASV---VSRVDSGLSNKKKARVGRDN 1042
            +GQG+FG  +    K D K   +K I       KE    R+E  + +++ HP+++    SFE      ++ E+    DL+R + + NG + +E   +V  + +    AL ++H  RILHRD+KPQN+ L KN   KL DFG+A+ M   T +  +  GTP Y +PE+    PY++ +D+WSLGCI YE  +    F    I  L   IK  + K  PS  ++  R+ +  +  + P  R +   +L  PF+  +I           E+P  N   + K   Q  P    +   ++ +D G S ++     RD+
Sbjct:   10 VGQGSFGCVYKATRKDDSKVVAIKVISKRGRATKELKNLRRECDIQARLKHPHVIEMIESFESKTDLFVVTEFALM-DLHRYL-SYNGAMGEEPARRVTGHLVS---ALYYLHSNRILHRDLKPQNVLLDKNMHAKLCDFGLARNMTLGTHVLTSIKGTPLYMAPELLAEQPYDHHADMWSLGCIAYESMAGQPPFCASSILHLVKMIKHEDVK-WPSTLTSECRSFLQGLLEKDPGLRISWTQLLCHPFVEGRIFIAETQAEAAKESPFTNPEAKVKSSKQSDPEVGDLDEALAALDFGESRQENLTTSRDS 316          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: polo (gene:FBgn0003124 transcript:FBtr0074839)

HSP 1 Score: 136.346 bits (342), Expect = 6.932e-33
Identity = 87/269 (32.34%), Postives = 144/269 (53.53%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAW-LVESKID---CKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFIL-KKIDKFLP 916
            +KR+   G+G F   + +++ + D     K V K++ + K ++KE+    +E+++   +NHPNIV ++N FE+    +I++E C+   +    K +  +   E +   Y  QI   +K++HD RI+HRD+K  N+FL     VK+GDFG+A  ++      KT  GTP Y +PEI     ++ + DIWS+GC++Y L      F  + +     +IKK  Y+ VPS    P   +V  M +  P+ RP I  +L   F+   K+  FLP
Sbjct:   25 YKRMRFFGKGGFAKCYEIIDVETDDVFAGKIVSKKL-MIKHNQKEK--TAQEITIHRSLNHPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKSI--TEFECRYYIYQIIQGVKYLHDNRIIHRDLKLGNLFLNDLLHVKIGDFGLATRIEYEGERKKTLCGTPNYIAPEILTKKGHSFEVDIWSIGCVMYTLLVGQPPFETKTLKDTYSKIKKCEYR-VPSYLRKPAADMVIAMLQPNPESRPAIGQLLNFEFLKGSKVPMFLP 287          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: polo (gene:FBgn0003124 transcript:FBtr0100318)

HSP 1 Score: 136.346 bits (342), Expect = 6.932e-33
Identity = 87/269 (32.34%), Postives = 144/269 (53.53%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAW-LVESKID---CKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFIL-KKIDKFLP 916
            +KR+   G+G F   + +++ + D     K V K++ + K ++KE+    +E+++   +NHPNIV ++N FE+    +I++E C+   +    K +  +   E +   Y  QI   +K++HD RI+HRD+K  N+FL     VK+GDFG+A  ++      KT  GTP Y +PEI     ++ + DIWS+GC++Y L      F  + +     +IKK  Y+ VPS    P   +V  M +  P+ RP I  +L   F+   K+  FLP
Sbjct:   25 YKRMRFFGKGGFAKCYEIIDVETDDVFAGKIVSKKL-MIKHNQKEK--TAQEITIHRSLNHPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKSI--TEFECRYYIYQIIQGVKYLHDNRIIHRDLKLGNLFLNDLLHVKIGDFGLATRIEYEGERKKTLCGTPNYIAPEILTKKGHSFEVDIWSIGCVMYTLLVGQPPFETKTLKDTYSKIKKCEYR-VPSYLRKPAADMVIAMLQPNPESRPAIGQLLNFEFLKGSKVPMFLP 287          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek1 (NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040730-1])

HSP 1 Score: 347.436 bits (890), Expect = 2.931e-110
Identity = 154/275 (56.00%), Postives = 216/275 (78.55%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKK 949
            ++RL KIG+G+FG A LV+S+ D ++YV+KEIG+ +M  KER E+RKEV++L+ M+HPNIV Y  SFEE GC +I+M+YCEGGDL++KI  Q G LF E+Q+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYE+C+L +AF   ++  L ++I + +Y PV   +S  LR+L+  +F+R P ERP+++TIL KPF+ ++I KFL P+    +E  +
Sbjct:    4 YERLKKIGEGSFGKAILVKSRTDGRQYVIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKESFEESGCLYIVMDYCEGGDLFKKINNQRGSLFPEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSIHYSPDLRSLLAQLFKRNPRERPSVSTILDKPFLARRIHKFLSPQVTYTHEQTR 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01040556.1 (NIMA related kinase 3 [Source:NCBI gene;Acc:100536894])

HSP 1 Score: 270.011 bits (689), Expect = 1.004e-79
Identity = 130/274 (47.45%), Postives = 187/274 (68.25%), Query Frame = 2
Query:  143 IGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQKR 964
            IG+G+FG A LV+   + K YV+KEI L K  E    ++R E  LLSKM HPNIV + +SFE  G  +I+ME+C GGDL ++I+ QN +LF E+Q+L +F Q+CL  KHIHD+R+LHRD+K +NIFLT + +VK+GDFG A +++S  A  +T VGTP+Y SPEI +  PYNNKSD+WSLGC+LYELC+L + F  +    L +++ + +Y P+PS F   L  L+ +MF+  P +RP+I+TIL    + + + K L  EN  L + + +  +R
Sbjct:   10 IGEGSFGRALLVQPIHEEKHYVMKEIRLPKA-ESGMKKSRSEAVLLSKMKHPNIVAFRDSFEADGHLYIVMEFCSGGDLMQRIRQQNRLLFSEEQILKWFAQMCLGTKHIHDKRVLHRDLKSKNIFLTDSGTVKVGDFGSACSLNSAKAYAQTYVGTPYYVSPEIWDNKPYNNKSDVWSLGCVLYELCTLQHPFQARSWKSLILQVCRGSYAPLPSHFPYELHYLIKHMFKTNPKDRPSIHTILSSHRVSRLLHKHLTLENQELLQERTRHWRR 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek4 (NIMA-related kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1392])

HSP 1 Score: 250.366 bits (638), Expect = 4.733e-69
Identity = 113/258 (43.80%), Postives = 173/258 (67.05%), Query Frame = 2
Query:  143 IGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGC-FHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFL 913
            +G+G++G   LV  K D K+YV+K++ L     +ER  A +E  LLS++ HPNIV Y  S+E   C  +I+M +CEGGDLY ++K Q G L  E QV+++F+QI +AL+++H++ ILHRD+K QNIFLTK N +K+GD GIA+ +++   +  T +GTP+Y SPE+    PYN KSD+W+LGC +YE+ +L +AF  +D+  L  RI +     +PS +   L  L+  M  ++P++RP++  ILR+P+I  +I  FL
Sbjct:   10 VGKGSYGEVNLVRHKSDRKQYVIKKLNLRTSSRRERRAAEQEAQLLSQLKHPNIVMYRESWEGEDCQLYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFVQIAMALQYLHEKHILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIVEGKLPQMPSKYDPQLGELIKRMLCKKPEDRPDVKHILRQPYIKHQISMFL 267          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek4 (NIMA-related kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-1392])

HSP 1 Score: 250.366 bits (638), Expect = 5.500e-69
Identity = 113/258 (43.80%), Postives = 173/258 (67.05%), Query Frame = 2
Query:  143 IGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGC-FHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFL 913
            +G+G++G   LV  K D K+YV+K++ L     +ER  A +E  LLS++ HPNIV Y  S+E   C  +I+M +CEGGDLY ++K Q G L  E QV+++F+QI +AL+++H++ ILHRD+K QNIFLTK N +K+GD GIA+ +++   +  T +GTP+Y SPE+    PYN KSD+W+LGC +YE+ +L +AF  +D+  L  RI +     +PS +   L  L+  M  ++P++RP++  ILR+P+I  +I  FL
Sbjct:   10 VGKGSYGEVNLVRHKSDRKQYVIKKLNLRTSSRRERRAAEQEAQLLSQLKHPNIVMYRESWEGEDCQLYIVMGFCEGGDLYHRLKQQKGELLPERQVVEWFVQIAMALQYLHEKHILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNYKSDVWALGCCVYEMATLKHAFNAKDMNSLVYRIVEGKLPQMPSKYDPQLGELIKRMLCKKPEDRPDVKHILRQPYIKHQISMFL 267          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek8 (NIMA-related kinase 8 [Source:NCBI gene;Acc:171094])

HSP 1 Score: 223.402 bits (568), Expect = 6.715e-61
Identity = 122/312 (39.10%), Postives = 175/312 (56.09%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNS-VKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKI---------DKFLPPENPLLNETKKQIQKRPSTASVVSRVDSGLSNKKKARV 1030
            ++++  +G+GAFGI  L   + D    +LKEI + +M   ER  A+ E  +L  ++HPNI+ YY +F E     I MEY  GG L   I+ +   L  ED +L +F+QI LAL H+H++ ILHRD+K QNI L K+   VK+GDFGI+K + S +    T VGTP Y SPE+CEG PYN KSDIW+LGC+LYEL SL  AF   ++  L ++I    + P+   +S  LR L+ NM    P +RP +N I+     ++ +          K    E PL N  +     RP      +R   GLS+   +++
Sbjct:    4 YEKIKVVGRGAFGIVHLCRRRTDSALVILKEIPVEQMTRDERLAAQNECQVLKLLSHPNIIEYYENFLEDKALMIAMEYAPGGTLADYIQKRCNSLLDEDTILHFFVQILLALYHVHNKLILHRDLKTQNILLDKHQMIVKIGDFGISKILVSKSK-AYTVVGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLILNMLNLDPSKRPQLNEIMAHAICIRPLLNLYTDIGNVKMRRIEKPLSN-VQAGPHGRPGGWITSTRTRGGLSSLTSSKM 313          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: nek1 (NIMA-related kinase 1 [Source:NCBI gene;Acc:100036653])

HSP 1 Score: 382.489 bits (981), Expect = 4.380e-112
Identity = 238/650 (36.62%), Postives = 367/650 (56.46%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPEN--------PLLNETKKQIQ----KRPSTASVV-------------SRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDA------NPLVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPA-AIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKI----------DASKPYDE----RSKMNELARIHGKIGGN------AADQA-VIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQ--SPIPRQTPRSIEEETTERLNKIRQKNFEIRQGMGFE-DFVKNSDIDGNGNFENFNQLEARKALEDLKKRV 1897
            ++ + R++KIG+G+FG A LV+SK D K+YV+KEIG+ KM  KER E+R+EV++L+ M HPNIV Y  SFEE GC +I+M+YCEGGDL+++I +Q GVLF EDQ+LD+F+Q+CLALKH+HD++ILHRDIK QNIFLTK  +++LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYE+C+L +AF   ++  L ++I + +Y PV   +S  LR L+  +F+R P +RP++N+IL KPFI ++I+KFL P++          +N  K  IQ    KRP+ A VV             ++    L+ KK +   + +     P ++        KR+  R ++++       N L   Q     K ++E IN  RE GW+NV+SS  S         + K   +G     A  Q +    Y+ Y++  D++++Q   +EN   A+ + +  + D ++PD           Y ++           A  P+ +    R ++  L  +H +  GN      +A++A  ++EF++RK +A   K R    M  +      C  +  S    +     E+E   RL +IR +NF  RQ +  +    K  + D +G   + +    RK +E LK + 
Sbjct:    1 MNKYVRVSKIGEGSFGKAILVKSKDDGKQYVIKEIGISKMSNKEREESRREVAVLANMKHPNIVQYQESFEESGCLYIVMDYCEGGDLFKRINSQKGVLFSEDQILDWFVQLCLALKHVHDRKILHRDIKSQNIFLTKGGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFKRNPRDRPSVNSILEKPFIYRRIEKFLSPQHIAEEFGLGAFVNHPKPGIQAAAAKRPTPAQVVPASPPAHKITKPAAKYGVPLTTKKSSDAAKKHH-DKKPQIRHRQDGAKKKRMDVRQLEKEKRQREQFNLLRAEQMRRLEKERLERINRAREQGWRNVISSGGSG--------DIKAPYFGGGGGVAPPQGMGRGPYEHYHSIFDQMQQQ---KENIKAAVEKEVKLKADIQNPD----------TYSRVPKHPEQENCPSAHSPFPDGDAVRRELKRLQEVHNQAIGNKIQGHVSAEKARQVEEFLQRKHEAMQNKARAEGHMDAVHNLAAICGGRPNSAGGGKARNREEKEYLARLRQIRLQNFNERQQIKAKLRGAKGDEGDADGKESSEDAELRRKKIEALKAQA 628          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: nek1 (NIMA-related kinase 1 [Source:NCBI gene;Acc:100036653])

HSP 1 Score: 371.318 bits (952), Expect = 4.526e-108
Identity = 232/622 (37.30%), Postives = 348/622 (55.95%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPEN--------PLLNETKKQIQ----KRPSTASVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDK------RVSPRIVKQDANP----------------LVVRQQELN------------------NKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPA-AIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDE----RSKMNELARIHGKIGGN------AADQA-VIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQ--SPIPRQTPRSIEEETTERLNKIRQKNFEIRQ 1783
            ++ + R++KIG+G+FG A LV+SK D K+YV+KEIG+ KM  KER E+R+EV++L+ M HPNIV Y  SFEE GC +I+M+YCEGGDL+++I +Q GVLF EDQ+LD+F+Q+CLALKH+HD++ILHRDIK QNIFLTK  +++LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYE+C+L +AF   ++  L ++I + +Y PV   +S  LR L+  +F+R P +RP++N+IL KPFI ++I+KFL P++          +N  K  IQ    KRP+ A VV    S  ++K      +    + +       +  HDK      R +P +  +  NP                + VRQ E                     K ++E IN  RE GW+NV+SS  S         + K   +G     A  Q +    Y+ Y++  D++++Q   +EN   A+ + +  + D ++PD                A  P+ +    R ++  L  +H +  GN      +A++A  ++EF++RK +A   K R    M  +      C  +  S    +     E+E   RL +IR +NF  RQ
Sbjct:    1 MNKYVRVSKIGEGSFGKAILVKSKDDGKQYVIKEIGISKMSNKEREESRREVAVLANMKHPNIVQYQESFEESGCLYIVMDYCEGGDLFKRINSQKGVLFSEDQILDWFVQLCLALKHVHDRKILHRDIKSQNIFLTKGGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFKRNPRDRPSVNSILEKPFIYRRIEKFLSPQHIAEEFGLGAFVNHPKPGIQAAAAKRPTPAQVVPA--SPPAHKITKPAAKYGVPLTTKKSSDAAKKHHDKKPQIRHRQAPAVPLKKVNPVDERRKMFEDGAKKKRMDVRQLEKEKRQREQFNLLRAEQMRRLEKERLERINRAREQGWRNVISSGGSG--------DIKAPYFGGGGGVAPPQGMGRGPYEHYHSIFDQMQQQ---KENIKAAVEKEVKLKADIQNPDTYSRVPKHPEQENCPSAHSPFPDGDAVRRELKRLQEVHNQAIGNKIQGHVSAEKARQVEEFLQRKHEAMQNKARAEGHMDAVHNLAAICGGRPNSAGGGKARNREEKEYLARLRQIRLQNFNERQ 609          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: nek1 (NIMA-related kinase 1 [Source:NCBI gene;Acc:100036653])

HSP 1 Score: 368.237 bits (944), Expect = 4.058e-107
Identity = 221/579 (38.17%), Postives = 331/579 (57.17%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPEN--------PLLNETKKQIQ----KRPSTASVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDK------RVSPRIVKQDANP----------------LVVRQQELN------------------NKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPA-AIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDE----RSKMNELARIHGKIGGN------AADQA-VIQEFIERKRQAKNIKNRNGSGMALL 1660
            ++ + R++KIG+G+FG A LV+SK D K+YV+KEIG+ KM  KER E+R+EV++L+ M HPNIV Y  SFEE GC +I+M+YCEGGDL+++I +Q GVLF EDQ+LD+F+Q+CLALKH+HD++ILHRDIK QNIFLTK  +++LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYE+C+L +AF   ++  L ++I + +Y PV   +S  LR L+  +F+R P +RP++N+IL KPFI ++I+KFL P++          +N  K  IQ    KRP+ A VV    S  ++K      +    + +       +  HDK      R +P +  +  NP                + VRQ E                     K ++E IN  RE GW+NV+SS  S         + K   +G     A  Q +    Y+ Y++  D++++Q   +EN   A+ + +  + D ++PD                A  P+ +    R ++  L  +H +  GN      +A++A  ++EF++RK +A   K R    M  L
Sbjct:    1 MNKYVRVSKIGEGSFGKAILVKSKDDGKQYVIKEIGISKMSNKEREESRREVAVLANMKHPNIVQYQESFEESGCLYIVMDYCEGGDLFKRINSQKGVLFSEDQILDWFVQLCLALKHVHDRKILHRDIKSQNIFLTKGGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFKRNPRDRPSVNSILEKPFIYRRIEKFLSPQHIAEEFGLGAFVNHPKPGIQAAAAKRPTPAQVVPA--SPPAHKITKPAAKYGVPLTTKKSSDAAKKHHDKKPQIRHRQAPAVPLKKVNPVDERRKMFEDGAKKKRMDVRQLEKEKRQREQFNLLRAEQMRRLEKERLERINRAREQGWRNVISSGGSG--------DIKAPYFGGGGGVAPPQGMGRGPYEHYHSIFDQMQQQ---KENIKAAVEKEVKLKADIQNPDTYSRVPKHPEQENCPSAHSPFPDGDAVRRELKRLQEVHNQAIGNKIQGHVSAEKARQVEEFLQRKHEAMQNKARAEGHMEYL 566          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: nek1 (NIMA-related kinase 1 [Source:NCBI gene;Acc:100036653])

HSP 1 Score: 368.237 bits (944), Expect = 4.234e-107
Identity = 221/576 (38.37%), Postives = 329/576 (57.12%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPEN--------PLLNETKKQIQ----KRPSTASVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDK------RVSPRIVKQDANP----------------LVVRQQELN------------------NKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPA-AIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDE----RSKMNELARIHGKIGGN------AADQA-VIQEFIERKRQAKNIKNRNGSGMALL 1660
            + R++KIG+G+FG A LV+SK D K+YV+KEIG+ KM  KER E+R+EV++L+ M HPNIV Y  SFEE GC +I+M+YCEGGDL+++I +Q GVLF EDQ+LD+F+Q+CLALKH+HD++ILHRDIK QNIFLTK  +++LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYE+C+L +AF   ++  L ++I + +Y PV   +S  LR L+  +F+R P +RP++N+IL KPFI ++I+KFL P++          +N  K  IQ    KRP+ A VV    S  ++K      +    + +       +  HDK      R +P +  +  NP                + VRQ E                     K ++E IN  RE GW+NV+SS  S         + K   +G     A  Q +    Y+ Y++  D++++Q   +EN   A+ + +  + D ++PD                A  P+ +    R ++  L  +H +  GN      +A++A  ++EF++RK +A   K R    M  L
Sbjct:    4 YVRVSKIGEGSFGKAILVKSKDDGKQYVIKEIGISKMSNKEREESRREVAVLANMKHPNIVQYQESFEESGCLYIVMDYCEGGDLFKRINSQKGVLFSEDQILDWFVQLCLALKHVHDRKILHRDIKSQNIFLTKGGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFKRNPRDRPSVNSILEKPFIYRRIEKFLSPQHIAEEFGLGAFVNHPKPGIQAAAAKRPTPAQVVPA--SPPAHKITKPAAKYGVPLTTKKSSDAAKKHHDKKPQIRHRQAPAVPLKKVNPVDERRKMFEDGAKKKRMDVRQLEKEKRQREQFNLLRAEQMRRLEKERLERINRAREQGWRNVISSGGSG--------DIKAPYFGGGGGVAPPQGMGRGPYEHYHSIFDQMQQQ---KENIKAAVEKEVKLKADIQNPDTYSRVPKHPEQENCPSAHSPFPDGDAVRRELKRLQEVHNQAIGNKIQGHVSAEKARQVEEFLQRKHEAMQNKARAEGHMEYL 566          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: sez6l2 (seizure related 6 homolog like 2 [Source:Xenbase;Acc:XB-GENE-921456])

HSP 1 Score: 305.834 bits (782), Expect = 2.320e-94
Identity = 142/261 (54.41%), Postives = 196/261 (75.10%), Query Frame = 2
Query:  143 IGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSV-KLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE 922
            IG+GAFG A+L + K D  + V+KEI L KM  KE+  + KEV LL+KM HPNIVT+++S EE    +I+MEYC+GGDL +++  Q GVLF+EDQ+L +F+QI L LKHIHD+++LHRDIK QNIFL+ N ++ KLGDFGIA+ +++T  L +T VGTP+Y SPEICE  PYNNK+DIWSLGC+LYELC+L + F    +  L ++I +  Y+P+P+ +S  LR LV  +F+    +RP+IN+IL+KPF+ K+I+K L PE
Sbjct:   10 IGEGAFGKAYLAKGKSDNMQCVIKEINLSKMPTKEKEASHKEVVLLAKMKHPNIVTFFSSIEERNKLYIVMEYCDGGDLMKRVNKQRGVLFEEDQILSWFVQISLGLKHIHDRKVLHRDIKAQNIFLSNNGTLAKLGDFGIARMLNNTMELARTCVGTPYYLSPEICENKPYNNKTDIWSLGCVLYELCALKHPFEASSLRQLVLKICRGRYEPIPTKYSYDLRILVSQLFKISSRDRPSINSILKKPFLEKRINKHLSPE 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek1 (NIMA (never in mitosis gene a)-related expressed kinase 1 [Source:MGI Symbol;Acc:MGI:97303])

HSP 1 Score: 369.392 bits (947), Expect = 1.224e-107
Identity = 244/652 (37.42%), Postives = 354/652 (54.29%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPP-----ENPLLNETKKQIQ----KRPSTASVVSR-VDSGLSNKKKARVG--------RDNALI-------NSPYMQIPNRNIHDKRVSPRIVKQDANP------------------LVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPAAIKQKINSP--AYDRYYAELDRIKEQQVLRENEGRALMQHMLKQN---DNKSPDGKLLKVG----ADGLYRKIDAS------KPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALLMG-GHQFCAEQSPIPRQTPRSIEEET-TERLNKIRQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEAR-KALEDLKKRV 1897
            + RL KIG+G+FG A LV+S  D + YV+KEI + +M +KER E+R+EV++L+ M HPNIV Y  SFEE G  +I+M+YCEGGDL+++I  Q G LF+EDQ+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYELC+L +AF   ++  L ++I   ++ PV   +S  LR+L+  +F+R P +RP++N+IL K FI K+I+KFL P     E  L   +K   Q    KRP++   VS  V +    K  A+ G         D  L+       +    QIP + ++      ++ ++ A                    L   Q +   K ++E IN  RE GW+NVL +  S           K + +G+   A+     SP   Y+ Y+A  D++   Q LR  +  A  +  +      +   P G  ++ G    A G Y   DA       K     SK     R  G +    A+Q  ++EF++RKR+A   K R    + LL      +    S      PR+ EEE    RL +IR +NF  RQ +  +   +N + DG    E   + + R K +E LK + 
Sbjct:    4 YVRLQKIGEGSFGKAVLVKSTEDGRHYVIKEINISRMSDKERQESRREVAVLANMKHPNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQKGALFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQLIAEEFCLKTLSKFGPQPLPGKRPASGQGVSSFVPAQKITKPAAKYGVPLTYKKYGDKKLLEKKPPPKHKQAHQIPVKKMNSGEERKKMSEEAAKKRRLEFIEKEKKQKDQIRFLKAEQMKRQEKQRLERINRAREQGWRNVLRAGGSG--------EVKASFFGIG-GAVSPSPCSPRGQYEHYHAIFDQM---QRLRAEDNEARWKGGIYGRWLPERGVPPG--VRPGFPSEASGHYHSPDAGAIRKTLKRLKAVSKQASTNRQKGHLAVERANQ--VEEFLQRKREAMQNKARAEGHVGLLQNLASLYGGRPSSSRGGKPRNNEEEVYLARLRQIRLQNFNERQQIKAKLRGENKEADGTKGQEATEETDMRLKKMESLKAQT 639          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek1 (NIMA (never in mitosis gene a)-related expressed kinase 1 [Source:MGI Symbol;Acc:MGI:97303])

HSP 1 Score: 346.665 bits (888), Expect = 4.326e-100
Identity = 198/474 (41.77%), Postives = 285/474 (60.13%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNE-------TKKQIQ----KRPSTASVVSR-VDSGLSNKKKARVG--------RDNALI-------NSPYMQIPNRNIHDKRVSPRIVKQDANP------------------LVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPAAIKQKINSP--AYDRYYAELDRIKEQQVLR--ENEGR 1399
            + RL KIG+G+FG A LV+S  D + YV+KEI + +M +KER E+R+EV++L+ M HPNIV Y  SFEE G  +I+M+YCEGGDL+++I  Q G LF+EDQ+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYELC+L +AF   ++  L ++I   ++ PV   +S  LR+L+  +F+R P +RP++N+IL K FI K+I+KFL P+  L+ E       +K   Q    KRP++   VS  V +    K  A+ G         D  L+       +    QIP + ++      ++ ++ A                    L   Q +   K ++E IN  RE GW+NVL +  S           K + +G+   A+     SP   Y+ Y+A  D++   Q LR  +NE R
Sbjct:    4 YVRLQKIGEGSFGKAVLVKSTEDGRHYVIKEINISRMSDKERQESRREVAVLANMKHPNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQKGALFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQ--LIAEEFCLKTLSKFGPQPLPGKRPASGQGVSSFVPAQKITKPAAKYGVPLTYKKYGDKKLLEKKPPPKHKQAHQIPVKKMNSGEERKKMSEEAAKKRRLEFIEKEKKQKDQIRFLKAEQMKRQEKQRLERINRAREQGWRNVLRAGGSG--------EVKASFFGIG-GAVSPSPCSPRGQYEHYHAIFDQM---QRLRAEDNEAR 463          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek1 (NIMA (never in mitosis gene a)-related expressed kinase 1 [Source:MGI Symbol;Acc:MGI:97303])

HSP 1 Score: 347.051 bits (889), Expect = 4.400e-100
Identity = 198/474 (41.77%), Postives = 285/474 (60.13%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNE-------TKKQIQ----KRPSTASVVSR-VDSGLSNKKKARVG--------RDNALI-------NSPYMQIPNRNIHDKRVSPRIVKQDANP------------------LVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPAAIKQKINSP--AYDRYYAELDRIKEQQVLR--ENEGR 1399
            + RL KIG+G+FG A LV+S  D + YV+KEI + +M +KER E+R+EV++L+ M HPNIV Y  SFEE G  +I+M+YCEGGDL+++I  Q G LF+EDQ+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYELC+L +AF   ++  L ++I   ++ PV   +S  LR+L+  +F+R P +RP++N+IL K FI K+I+KFL P+  L+ E       +K   Q    KRP++   VS  V +    K  A+ G         D  L+       +    QIP + ++      ++ ++ A                    L   Q +   K ++E IN  RE GW+NVL +  S           K + +G+   A+     SP   Y+ Y+A  D++   Q LR  +NE R
Sbjct:    4 YVRLQKIGEGSFGKAVLVKSTEDGRHYVIKEINISRMSDKERQESRREVAVLANMKHPNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQKGALFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQ--LIAEEFCLKTLSKFGPQPLPGKRPASGQGVSSFVPAQKITKPAAKYGVPLTYKKYGDKKLLEKKPPPKHKQAHQIPVKKMNSGEERKKMSEEAAKKRRLEFIEKEKKQKDQIRFLKAEQMKRQEKQRLERINRAREQGWRNVLRAGGSG--------EVKASFFGIG-GAVSPSPCSPRGQYEHYHAIFDQM---QRLRAEDNEAR 463          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek1 (NIMA (never in mitosis gene a)-related expressed kinase 1 [Source:MGI Symbol;Acc:MGI:97303])

HSP 1 Score: 343.584 bits (880), Expect = 3.362e-99
Identity = 150/266 (56.39%), Postives = 208/266 (78.20%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE 922
            + RL KIG+G+FG A LV+S  D + YV+KEI + +M +KER E+R+EV++L+ M HPNIV Y  SFEE G  +I+M+YCEGGDL+++I  Q G LF+EDQ+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYELC+L +AF   ++  L ++I   ++ PV   +S  LR+L+  +F+R P +RP++N+IL K FI K+I+KFL P+
Sbjct:    4 YVRLQKIGEGSFGKAVLVKSTEDGRHYVIKEINISRMSDKERQESRREVAVLANMKHPNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQKGALFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQ 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Nek5 (NIMA (never in mitosis gene a)-related expressed kinase 5 [Source:MGI Symbol;Acc:MGI:2142824])

HSP 1 Score: 277.33 bits (708), Expect = 4.446e-80
Identity = 129/270 (47.78%), Postives = 187/270 (69.26%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSV-KLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE 922
            + +F  +  IG+G FG  +L + K +    V+KEI L K    E+  ++ EV LL++M HPNIVT+++SF+E G   I+MEYC+GGDL ++I+ Q GV+F EDQ+L +F+QI L LKHIHD++ILHRDIK QNIFL+KN  V KLGDFG A+ ++ +  L +T  GTP+Y SPEIC+  PYNNK+DIWSLGC+LYELC+L + F   +   L ++I +    P+   FS  L++L+  +FR  P +RP++ ++L++PF+   I + L PE
Sbjct:    1 MDNFHLIKIIGEGTFGKVYLAKDKSESSHCVIKEISLTK----EKEASKNEVILLARMEHPNIVTFFSSFQENGRLFIVMEYCDGGDLMQRIQRQRGVMFSEDQILCWFVQISLGLKHIHDRKILHRDIKSQNIFLSKNGMVAKLGDFGTARTLNDSMELAQTCAGTPYYLSPEICQNRPYNNKTDIWSLGCVLYELCTLKHPFESNNFHHLVLKICQGRVAPISPHFSRDLQSLIPQLFRVSPQDRPSVTSLLKRPFLETLIARSLYPE 266          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96PY6|NEK1_HUMAN (Serine/threonine-protein kinase Nek1 OS=Homo sapiens OX=9606 GN=NEK1 PE=1 SV=2)

HSP 1 Score: 348.977 bits (894), Expect = 9.576e-100
Identity = 215/573 (37.52%), Postives = 318/573 (55.50%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNE-----TKKQIQKRPSTASVVSRVDSGLSNKKKARVGRDNALINSP--YMQIPNRNIHDKR---------VSP----------RIVKQDA--------------------NPLVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMT--PAAIKQKINSPAYDRYYAELDRIKEQQVL-------RENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDAS------KPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALL 1660
            + RL KIG+G+FG A LV+S  D ++YV+KEI + +M  KER E+R+EV++L+ M HPNIV Y  SFEE G  +I+M+YCEGGDL+++I  Q GVLF+EDQ+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYELC+L +AF    +  L ++I   ++ PV   +S  LR+LV  +F+R P +RP++N+IL K FI K+I+KFL P+  L+ E     T  +   +P  A   +   + +S     ++ +  A    P  Y +  ++ +H+K+          +P          R + ++A                    + +   Q +   K ++E IN  RE GW+NVL      S     ++ A     G T  P++   +     Y+ Y+A  D++++Q+         RE  GR L +  +               GA G +   DA       K     SK     R  G++    A Q  ++EF++RKR+A   K R    M  L
Sbjct:    4 YVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQ--LIAEEFCLKTFSKFGSQPIPAKRPASGQNSISVMPAQKITKPAAKYGIPLAYKKYGDKKLHEKKPLQKHKQAHQTPEKRVNTGEERRKISEEAARKRRLEFIEKEKKQKDQIISLMKAEQMKRQEKERLERINRAREQGWRNVL------SAGGSGEVKAPFLGSGGTIAPSSFSSR---GQYEHYHAIFDQMQQQRAEDNEAKWKREIYGRGLPERGILPGVRPG-----FPYGAAGHHHFPDADDIRKTLKRLKAVSKQANANRQKGQLAVERAKQ--VEEFLQRKREAMQNKARAEGHMVYL 558          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P51954|NEK1_MOUSE (Serine/threonine-protein kinase Nek1 OS=Mus musculus OX=10090 GN=Nek1 PE=1 SV=2)

HSP 1 Score: 346.665 bits (888), Expect = 3.026e-99
Identity = 198/474 (41.77%), Postives = 285/474 (60.13%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNE-------TKKQIQ----KRPSTASVVSR-VDSGLSNKKKARVG--------RDNALI-------NSPYMQIPNRNIHDKRVSPRIVKQDANP------------------LVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPAAIKQKINSP--AYDRYYAELDRIKEQQVLR--ENEGR 1399
            + RL KIG+G+FG A LV+S  D + YV+KEI + +M +KER E+R+EV++L+ M HPNIV Y  SFEE G  +I+M+YCEGGDL+++I  Q G LF+EDQ+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYELC+L +AF   ++  L ++I   ++ PV   +S  LR+L+  +F+R P +RP++N+IL K FI K+I+KFL P+  L+ E       +K   Q    KRP++   VS  V +    K  A+ G         D  L+       +    QIP + ++      ++ ++ A                    L   Q +   K ++E IN  RE GW+NVL +  S           K + +G+   A+     SP   Y+ Y+A  D++   Q LR  +NE R
Sbjct:    4 YVRLQKIGEGSFGKAVLVKSTEDGRHYVIKEINISRMSDKERQESRREVAVLANMKHPNIVQYKESFEENGSLYIVMDYCEGGDLFKRINAQKGALFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGNMKNLVLKIISGSFPPVSPHYSYDLRSLLSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQ--LIAEEFCLKTLSKFGPQPLPGKRPASGQGVSSFVPAQKITKPAAKYGVPLTYKKYGDKKLLEKKPPPKHKQAHQIPVKKMNSGEERKKMSEEAAKKRRLEFIEKEKKQKDQIRFLKAEQMKRQEKQRLERINRAREQGWRNVLRAGGSG--------EVKASFFGIG-GAVSPSPCSPRGQYEHYHAIFDQM---QRLRAEDNEAR 463          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P3R8|NEK5_HUMAN (Serine/threonine-protein kinase Nek5 OS=Homo sapiens OX=9606 GN=NEK5 PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 6.476e-89
Identity = 141/264 (53.41%), Postives = 194/264 (73.48%), Query Frame = 2
Query:  134 LNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSV-KLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE 922
            +  IGQGAFG A+L + K D K  V+KEI   KM  +E+  ++KEV LL KM HPNIV ++NSF+E G   I+MEYC+GGDL ++I  Q GVLF EDQ+L +F+QI L LKHIHD++ILHRDIK QNIFL+KN  V KLGDFGIA+ ++++  L +T +GTP+Y SPEIC+  PYNNK+DIWSLGC+LYELC+L + F G ++  L ++I + ++ P+   FS  L +L+  +F+  P +RP+IN+IL++PF+   I K+L PE
Sbjct:    7 IKAIGQGAFGKAYLAKGKSDSKHCVIKEINFEKMPIQEKEASKKEVILLEKMKHPNIVAFFNSFQENGRLFIVMEYCDGGDLMKRINRQRGVLFSEDQILGWFVQISLGLKHIHDRKILHRDIKAQNIFLSKNGMVAKLGDFGIARVLNNSMELARTCIGTPYYLSPEICQNKPYNNKTDIWSLGCVLYELCTLKHPFEGNNLQQLVLKICQAHFAPISPGFSRELHSLISQLFQVSPRDRPSINSILKRPFLENLIPKYLTPE 270          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P51956|NEK3_HUMAN (Serine/threonine-protein kinase Nek3 OS=Homo sapiens OX=9606 GN=NEK3 PE=1 SV=2)

HSP 1 Score: 275.789 bits (704), Expect = 4.174e-80
Identity = 139/306 (45.42%), Postives = 189/306 (61.76%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE------NPLLNETKKQIQKRPSTASVVSRVDSGLSNK 1015
            + D+  L  IG+G+FG A LV+ +   + + +KEI L K     +  +RKE  LL+KM HPNIV +  SFE  G  +I+MEYC+GGDL +KIK Q G LF ED +L++F Q+CL + HIH +R+LHRDIK +NIFLT+N  VKLGDFG A+ + +  A   T VGTP+Y  PEI E  PYNNKSDIWSLGCILYELC+L + F       L +++ +    P+PS +S  L+ LV  MF+R P  RP+  T+L +  + + + K LPPE        +L E K      P   +  SR+   L N+
Sbjct:    1 MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQ-NSRKEAVLLAKMKHPNIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYELCTLKHPFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRIALGNE 305          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7TSC3|NEK5_MOUSE (Serine/threonine-protein kinase Nek5 OS=Mus musculus OX=10090 GN=Nek5 PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 3.110e-79
Identity = 129/270 (47.78%), Postives = 187/270 (69.26%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSV-KLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE 922
            + +F  +  IG+G FG  +L + K +    V+KEI L K    E+  ++ EV LL++M HPNIVT+++SF+E G   I+MEYC+GGDL ++I+ Q GV+F EDQ+L +F+QI L LKHIHD++ILHRDIK QNIFL+KN  V KLGDFG A+ ++ +  L +T  GTP+Y SPEIC+  PYNNK+DIWSLGC+LYELC+L + F   +   L ++I +    P+   FS  L++L+  +FR  P +RP++ ++L++PF+   I + L PE
Sbjct:    1 MDNFHLIKIIGEGTFGKVYLAKDKSESSHCVIKEISLTK----EKEASKNEVILLARMEHPNIVTFFSSFQENGRLFIVMEYCDGGDLMQRIQRQRGVMFSEDQILCWFVQISLGLKHIHDRKILHRDIKSQNIFLSKNGMVAKLGDFGTARTLNDSMELAQTCAGTPYYLSPEICQNRPYNNKTDIWSLGCVLYELCTLKHPFESNNFHHLVLKICQGRVAPISPHFSRDLQSLIPQLFRVSPQDRPSVTSLLKRPFLETLIARSLYPE 266          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2D4I327 (Protein kinase domain-containing protein (Fragment) OS=Micrurus lemniscatus lemniscatus OX=129467 PE=4 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 1.383e-115
Identity = 225/590 (38.14%), Postives = 338/590 (57.29%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQ---------KRPSTASVVSRVDSGLS-NKKKARVG--------RDNA--LINSPYMQIPNRNIHDKRVSPRIVKQDANPLVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPAAIKQKI-NSPAYDRYYAELDRIKEQQVLRENEGRALM---QHMLKQNDNKSPDGKLLKV--GADGLYRKIDAS------KPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQ--SPIPRQTPRSIEEETTERLNKIRQKNFEIRQ 1783
            +  + ++ KIG+G+FG A LV++K + K+YV+KEI + KM  KER E+R+EV++L+ M HPNIV Y  SFEE GC +I+M+YCEGGDL++KI  Q GV F EDQ++D+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +++LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSD+W+LGC+LYE+C+L +AF   ++  L ++I   ++ PV + +S  LR+L+  +F+R P ERP++N+IL K FI+K+I+KFL P+      + K  Q         KRP+    ++ V       K  A+ G         D+A      P  +     +  KR+  +  ++  + + V Q     K ++E IN  RE GW+NVLS   S           K   +G   A +   + +   Y+ Y+A  D+I++Q+   + EG+ +    +  ++    +SP G    +  G+   +   DA       K  +E S+     R  G +    A Q  ++EF +RKR+A+  K R    M  L      C  +  S   R+     EEE   RL +IR +NF  RQ
Sbjct:    1 MDKYIKVQKIGEGSFGKAILVKAKENGKQYVIKEINISKMSNKEREESRREVAVLANMKHPNIVLYRESFEETGCLYIVMDYCEGGDLFKKINAQKGVFFSEDQIMDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDMWALGCVLYEMCTLKHAFEAGNMKNLVLKIISGSFPPVSTRYSHELRSLISQLFKRNPRERPSVNSILEKMFIVKRIEKFLTPQLIAEEFSHKMFQKFGPHAGPAKRPAQGQNLASVAPAHKITKPAAKYGVPLILKKSGDSAKKFFEKPITKCKQEAVKKKRLEEKQQREQISYMKVEQMRRLEKERMERINRAREQGWRNVLSISGSS--------EIKAQYFGGGGAIMPLPVPDRGPYEHYHAIFDQIQQQKENLKIEGKDVKLNEKPCVEPIHRRSPHGIHAGIHKGSAAYHHSSDADAIRKGMKRLEEVSRQANANRQKGWLAAERAKQ--VEEFWQRKREARQNKARAEGHMDTLQNLTAICGGRSISSRGRKARNKEEEEYLTRLRQIRLQNFNERQ 580          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2D4I310 (Protein kinase domain-containing protein (Fragment) OS=Micrurus lemniscatus lemniscatus OX=129467 PE=4 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 9.194e-114
Identity = 222/574 (38.68%), Postives = 331/574 (57.67%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQKRPSTASVVSRVDSG---LSNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDANPL-VVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPAAIKQKI-NSPAYDRYYAELDRIKEQQVLRENEGRALM---QHMLKQNDNKSPDGKLLKV--GADGLYRKIDAS------KPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQ--SPIPRQTPRSIEEETTERLNKIRQKNFEIRQ 1783
            +  + ++ KIG+G+FG A LV++K + K+YV+KEI + KM  KER E+R+EV++L+ M HPNIV Y  SFEE GC +I+M+YCEGGDL++KI  Q GV F EDQ++D+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +++LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSD+W+LGC+LYE+C+L +AF   ++  L ++I   ++ PV + +S  LR+L+  +F+R P ERP++N+IL K FI+K+I+KFL P+      + K  QK    A    R   G    S     ++ +  A    P +   + +   K     I K     +   R +E   + ++E IN  RE GW+NVLS   S           K   +G   A +   + +   Y+ Y+A  D+I++Q+   + EG+ +    +  ++    +SP G    +  G+   +   DA       K  +E S+     R  G +    A Q  ++EF +RKR+A+  K R    M  L      C  +  S   R+     EEE   RL +IR +NF  RQ
Sbjct:    1 MDKYIKVQKIGEGSFGKAILVKAKENGKQYVIKEINISKMSNKEREESRREVAVLANMKHPNIVLYRESFEETGCLYIVMDYCEGGDLFKKINAQKGVFFSEDQIMDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDMWALGCVLYEMCTLKHAFEAGNMKNLVLKIISGSFPPVSTRYSHELRSLISQLFKRNPRERPSVNSILEKMFIVKRIEKFLTPQLIAEEFSHKMFQKFGPHAGPAKRPAQGQNLASVAPAHKITKPAAKYGVPLILKKSGDSAKKFFEKPITKCKQEAVKKKRLEEKQQREQMERINRAREQGWRNVLSISGSS--------EIKAQYFGGGGAIMPLPVPDRGPYEHYHAIFDQIQQQKENLKIEGKDVKLNEKPCVEPIHRRSPHGIHAGIHKGSAAYHHSSDADAIRKGMKRLEEVSRQANANRQKGWLAAERAKQ--VEEFWQRKREARQNKARAEGHMDTLQNLTAICGGRSISSRGRKARNKEEEEYLTRLRQIRLQNFNERQ 564          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A5G3JN56 (Protein kinase domain-containing protein OS=Xenopus tropicalis OX=8364 GN=nek1 PE=4 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 6.877e-109
Identity = 238/650 (36.62%), Postives = 367/650 (56.46%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPEN--------PLLNETKKQIQ----KRPSTASVV-------------SRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDA------NPLVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPA-AIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKI----------DASKPYDE----RSKMNELARIHGKIGGN------AADQA-VIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQ--SPIPRQTPRSIEEETTERLNKIRQKNFEIRQGMGFE-DFVKNSDIDGNGNFENFNQLEARKALEDLKKRV 1897
            ++ + R++KIG+G+FG A LV+SK D K+YV+KEIG+ KM  KER E+R+EV++L+ M HPNIV Y  SFEE GC +I+M+YCEGGDL+++I +Q GVLF EDQ+LD+F+Q+CLALKH+HD++ILHRDIK QNIFLTK  +++LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYE+C+L +AF   ++  L ++I + +Y PV   +S  LR L+  +F+R P +RP++N+IL KPFI ++I+KFL P++          +N  K  IQ    KRP+ A VV             ++    L+ KK +   + +     P ++        KR+  R ++++       N L   Q     K ++E IN  RE GW+NV+SS  S         + K   +G     A  Q +    Y+ Y++  D++++Q   +EN   A+ + +  + D ++PD           Y ++           A  P+ +    R ++  L  +H +  GN      +A++A  ++EF++RK +A   K R    M  +      C  +  S    +     E+E   RL +IR +NF  RQ +  +    K  + D +G   + +    RK +E LK + 
Sbjct:    1 MNKYVRVSKIGEGSFGKAILVKSKDDGKQYVIKEIGISKMSNKEREESRREVAVLANMKHPNIVQYQESFEESGCLYIVMDYCEGGDLFKRINSQKGVLFSEDQILDWFVQLCLALKHVHDRKILHRDIKSQNIFLTKGGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENRPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSYDLRNLLSMLFKRNPRDRPSVNSILEKPFIYRRIEKFLSPQHIAEEFGLGAFVNHPKPGIQAAAAKRPTPAQVVPASPPAHKITKPAAKYGVPLTTKKSSDAAKKHH-DKKPQIRHRQDGAKKKRMDVRQLEKEKRQREQFNLLRAEQMRRLEKERLERINRAREQGWRNVISSGGSG--------DIKAPYFGGGGGVAPPQGMGRGPYEHYHSIFDQMQQQ---KENIKAAVEKEVKLKADIQNPD----------TYSRVPKHPEQENCPSAHSPFPDGDAVRRELKRLQEVHNQAIGNKIQGHVSAEKARQVEEFLQRKHEAMQNKARAEGHMDAVHNLAAICGGRPNSAGGGKARNREEKEYLARLRQIRLQNFNERQQIKAKLRGAKGDEGDADGKESSEDAELRRKKIEALKAQA 628          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: I3J4T0 (NIMA-related kinase 1 OS=Oreochromis niloticus OX=8128 GN=nek1 PE=4 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 1.448e-108
Identity = 242/650 (37.23%), Postives = 367/650 (56.46%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE--------NPLLNETKKQIQKRPSTAS--------------VVSRVDSGL---SNKKKARVGRDNALINSPYMQIPN----RNIHDKRVSPRIV-------KQDANPLVVRQQELN--NKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAK------LNVYGMTPAAIKQKINSPAYDRYYAELDRIKE---QQVLRENE--GRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNR------NGSGMALLMGGHQF---CAEQSPIPRQTPRSIEEETTERLNKIRQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEA-RKALEDLKKRV 1897
            ++++ KIG+G+FG A LV+SK D  +YV+KEIG+  M  KER E+RKEV++L+ M+HPNIV Y  SFEE GC +I+M+YCEGGDL++KI +Q GVLF E+Q+LD+ +QICLALKH+HD++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYE+C+L +AF   ++  L ++I + +Y PV   +S  LR+L+  +F+R P ERP++N+IL KPF+  +I+KFL P+          L  + K  + + PS ++               V +V  G    ++KK A   +   L  +P  ++      R  H+  +  + +       KQ     +++ +++    K K+  IN  RE GWK+VLSS    S  ++  +           V G TPA +  K  SP Y+ Y+A LD++ +   + V R++   G      +        P+G   ++  D + R++         SK   ++R  G++    A Q  ++EF++R+R+A   K R          +A + GG      C       R  P   EEE   RL +IR +NF  RQ +      +  D DG+ + E+  + E  RK +E LK + 
Sbjct:    4 YEKVKKIGEGSFGKAILVKSKDDGHQYVIKEIGISGMSSKERQESRKEVAVLANMSHPNIVQYKESFEEGGCLYIVMDYCEGGDLFKKINSQKGVLFSEEQILDWLVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSCHYSQELRSLLAQLFKRNPRERPSVNSILDKPFLSCRIEKFLTPQIIAQEFRHTFLHKQPKLGVAQMPSASAQKITKPAAKYGVPLTVRKVPDGARKPADKKPAGKHKPAPLPATPQRRVSQVEEERKKHEDSIRKKRMEMIEKERKQREQMFMLKAEQMKRYEKEKINRINQAREQGWKHVLSSSGGSSPERKCFVGGGKRGAHVAAVQGSTPAPLPGK--SP-YEHYHAILDQMAKPTPKDVSRKSSSAGPCSPIRVPAAAGPVLPNGPARRLDPDVIKRELHR---LQHVSKQAHISRQRGQMAAERAFQ--VEEFLQRRREAMLNKARAEGQLGTRQNLAAIYGGRAGGVRCG------RSKPNKEEEEYLARLRQIRLQNFNERQQIKARLRGEKYDSDGSDSQESSEEAELRRKKIEALKAQA 639          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2Y9Q561 (serine/threonine-protein kinase Nek1 isoform X6 OS=Delphinapterus leucas OX=9749 GN=NEK1 PE=4 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 5.887e-107
Identity = 242/652 (37.12%), Postives = 364/652 (55.83%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNE-----------TKKQIQKRPSTA-SVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHD---------------KRVSPRIVKQD--ANPLVVRQQELNNKYK---------------------VEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPAAIKQKINSPA-YDRYYAELDRIKEQQVLRENEGRALMQ-HMLKQNDNKSPDG--KLLKVGADGLYRKIDAS---KPYDERSKMNELARIHGKIGGNAADQA-VIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQSPIPR-QTPRSIEEET-TERLNKIRQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEA-RKALEDLKKRV 1897
            + R+ KIG+G+FG A LV+S  D ++YV+KEI +  M  KER E+R+EV++L+ M HPNIV Y  SFEE G  +I+M+YCEGGDL+++I  Q G+LF+EDQ+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +++LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYE+C+L +AF   ++  L ++I   ++ PV   +S  LR+L+  +F+R P +RP++N+IL K FI K+I+KFL P+  L+ E           T+    KRP +  S+ S V +    K  A+ G     +   Y +  ++ +H+               K+V+P   ++     P   R+ ELN K K                     +E IN  RE GW+NVLS+  S           K  ++G   A      +S   Y+ Y+A  D++ +QQ   +NE +   + H  +  +   P G       GA G +   DA    K +     +++ A I+ + G  A ++A  ++EF++R+R+A+  K R    M  L      C  +    R   PRS EEE    RL +IR +NF  RQ +  +   +  + D +   E   + +  RK +E LK +V
Sbjct:    4 YVRVQKIGEGSFGKAILVKSIEDGRQYVIKEINISSMSSKEREESRREVAVLANMKHPNIVQYRESFEENGSLYIVMDYCEGGDLFKRINAQKGILFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTIQLGDFGIARVLNSTVELVRTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIISGSFPPVSLHYSYDLRSLISQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQ--LIAEEFCLKTFSRFGTQPIPAKRPGSGQSLASVVSAQKITKPAAKYG-----VPLTYKKYGDKKLHEKKPLQKHKQAHQSPVKKVNPGEERRKLFEEPARKRRLELNEKEKKQKDQISLMKAEQMKRQEKERLEKINRAREQGWRNVLSAGGSG--------EMKAPLFGSGGAVAPSSFSSRGQYEHYHAIFDQM-QQQRAEDNEAKWKGERHGRRLPERGIPPGVHPGFPKGAAGHHHSSDADALRKTWKRLKAVSKQANINRQKGQLAVERAKQVEEFLQRRREARQNKARAEGHMGTLHNLAALCEGRRSSSRGGKPRSKEEEVYLARLRQIRLQNFNERQQIRAKLRGEKKEADSSEGQEGSEEADVRRKKVEVLKAQV 639          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek1 (NIMA related kinase 1 [Source:NCBI gene;Acc:103028272])

HSP 1 Score: 356.681 bits (914), Expect = 8.448e-103
Identity = 180/398 (45.23%), Postives = 261/398 (65.58%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE-------NPLLNETKKQIQ----KRPSTASV-----------VSRVDSGLSNKKKARVGR---DNA---LINSPYMQIPNRNIHDKRVS--PRIVKQDANPLVVRQQELN--NKYKVEMINVDRENGWKNVL 1222
            ++++ KIG+G+FG A LV SK D  +YV+KEIG+ +M  KER E+RKEV++L+ M+HPNIV Y  SFEE GC +I+M+YCEGGDL++KI  Q GVLF E+Q+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +++LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYE+C+L +AF   ++  L ++I + +Y PV   +S  LR+L+  +F+R P ERP++ TIL KPF+  +I +FL P+         LL + K   Q    KRP+                ++    L+ K+ A  GR   D+A   +   P +++    +  KR+    R  KQ     +++  ++    + K+  IN  RE GW++VL
Sbjct:    4 YEKVKKIGEGSFGKAILVRSKEDGHQYVIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKESFEEGGCLYIVMDYCEGGDLFKKINNQKGVLFTEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSMHYSQDLRSLLGLLFKRNPRERPSVCTILDKPFLAHRIHRFLSPQLIAQEFSQSLLRQPKTPAQGLPAKRPAPGPSPITPAQKITKPAAKYGVPLTVKRPADAGRKVADSAKKQVERKPGIKLKQEGVRKKRMELMERERKQREQMFILKAAQVKRFEREKLNRINRAREQGWRHVL 401          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: nek1 (NIMA related kinase 1 [Source:NCBI gene;Acc:103028272])

HSP 1 Score: 348.591 bits (893), Expect = 6.138e-100
Identity = 151/266 (56.77%), Postives = 210/266 (78.95%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE 922
            ++++ KIG+G+FG A LV SK D  +YV+KEIG+ +M  KER E+RKEV++L+ M+HPNIV Y  SFEE GC +I+M+YCEGGDL++KI  Q GVLF E+Q+LD+F+QICLALKH+HD++ILHRDIK QNIFLTK+ +++LGDFGIA+ ++ST  L +T +GTP+Y SPEICE  PYNNKSDIW+LGC+LYE+C+L +AF   ++  L ++I + +Y PV   +S  LR+L+  +F+R P ERP++ TIL KPF+  +I +FL P+
Sbjct:    4 YEKVKKIGEGSFGKAILVRSKEDGHQYVIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKESFEEGGCLYIVMDYCEGGDLFKKINNQKGVLFTEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTIQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSMHYSQDLRSLLGLLFKRNPRERPSVCTILDKPFLAHRIHRFLSPQ 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000049860.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000129.1:61559:73217:-1 gene:ENSAMXG00000043136.1 transcript:ENSAMXT00000049860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 306.22 bits (783), Expect = 4.271e-89
Identity = 153/329 (46.50%), Postives = 215/329 (65.35%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLV-ESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNS-VKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE-------NPLLNETKKQIQKRP--STASVVSRVDSGLSNKKKARVGRDNALINSPYMQ 1069
            +++++ + +IG GA+G A LV E   + +  V+K+I   +M  +ER +++KEV+LLSKM HPNIV ++ SF E    +I+MEYC+GGDL +KI  Q G  FKE Q++D+F+QICL LKHIHD+++LHRDIK QNIFLT+  S VKLGDFGIA+ +++T  L +T VGTP+Y SPEICE  PYNNK+D+WSLGC+LYELC+L + F G  +  L +RI K  Y PV   +S+ LR LV  +F+  P +RP++N++L++P +   I K L P+       + +L+  K   Q  P  S  S VS    G  NK   R     A+   P  Q
Sbjct:    1 MNEYELVRQIGHGAYGKALLVRERSGNARHCVIKQISWSRMSPREREDSKKEVTLLSKMKHPNIVAFFRSFNERNSLYIVMEYCDGGDLMKKISMQRGQPFKEQQIMDWFVQICLGLKHIHDRKVLHRDIKAQNIFLTQGGSKVKLGDFGIARLLNNTVELARTCVGTPYYLSPEICENRPYNNKTDMWSLGCVLYELCTLRHPFEGSSLRQLIVRICKGYYTPVSQRYSSDLRTLVSQLFKISPRDRPSVNSLLKRPLLHTLISKHLHPQLMEEEFSHTVLHRVKPVAQPGPKHSAVSKVSPRSGGAVNKLPPRPPWRRAVTKPPSPQ 329          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000040192.1 (NIMA related kinase 3 [Source:NCBI gene;Acc:103034307])

HSP 1 Score: 260.766 bits (665), Expect = 2.275e-76
Identity = 123/261 (47.13%), Postives = 177/261 (67.82%), Query Frame = 2
Query:  143 IGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPEN 925
            IG G+FG A LV+++   +K+V+KEI L K     R   R+E  LL+KM H NIV +  SFE+ G   I+ME+C GGDL ++I+ Q G LF ED +L +F Q+CL  KHIHD+R+LHRD+K +NIFLT++ ++KLGDFG A  ++S  A  +T VGTP+Y SPEI +  PYNNKSD+WSLGC+LYELC+L++ F  +    L +++ + +Y P+P      L  L+ +MF+  P +RP+I+TIL    + + + K LP E+
Sbjct:   10 IGTGSFGRALLVQTEGRGEKWVMKEIRLPKAESGMR-TTRREAVLLAKMKHSNIVAFRESFEDDGHLFIVMEFCSGGDLLQRIRQQKGSLFSEDVILRWFSQMCLGTKHIHDKRVLHRDLKSKNIFLTEHGTIKLGDFGSACTLNSARAYAQTYVGTPYYVSPEIWDNQPYNNKSDVWSLGCVLYELCTLHHPFQSRSWKNLILKVCRGSYAPLPRHLPYELHYLIKHMFKTNPRDRPSIHTILNSHRVSRLLLKHLPEES 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000010177.2 (NIMA related kinase 3 [Source:NCBI gene;Acc:103034307])

HSP 1 Score: 260.381 bits (664), Expect = 5.347e-76
Identity = 123/261 (47.13%), Postives = 177/261 (67.82%), Query Frame = 2
Query:  143 IGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPEN 925
            IG G+FG A LV+++   +K+V+KEI L K     R   R+E  LL+KM H NIV +  SFE+ G   I+ME+C GGDL ++I+ Q G LF ED +L +F Q+CL  KHIHD+R+LHRD+K +NIFLT++ ++KLGDFG A  ++S  A  +T VGTP+Y SPEI +  PYNNKSD+WSLGC+LYELC+L++ F  +    L +++ + +Y P+P      L  L+ +MF+  P +RP+I+TIL    + + + K LP E+
Sbjct:   10 IGTGSFGRALLVQTEGRGEKWVMKEIRLPKAESGMR-TTRREAVLLAKMKHSNIVAFRESFEDDGHLFIVMEFCSGGDLLQRIRQQKGSLFSEDVILRWFSQMCLGTKHIHDKRVLHRDLKSKNIFLTEHGTIKLGDFGSACTLNSARAYAQTYVGTPYYVSPEIWDNQPYNNKSDVWSLGCVLYELCTLHHPFQSRSWKNLILKVCRGSYAPLPRHLPYELHYLIKHMFKTNPRDRPSIHTILNSHRVSRLLLKHLPEES 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 313.538 bits (802), Expect = 9.223e-98
Identity = 137/266 (51.50%), Postives = 198/266 (74.44%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE 922
            +  +++IG+G+FG A LV+SK D   YV+KEI + +M  KER EARKEV +L+ M HPNIV+Y  SFEE G  +I+M+YCEGGDL+++I  Q GVLF EDQ+LD+ +Q+CLALKH+HD++ILHRDIK QNIFLTK   V+LGDFGIA+ ++STT L +T +GTP+Y SPEICE  PYN+KSD+W+LGC+LYE+C+L +AF   ++  L ++I + ++ PV + +S+ LR+ +  + RR P  RP +  +L +P ++ +  + +  E
Sbjct:    4 YTMVSQIGEGSFGKAMLVKSKADGHLYVIKEINISRMSPKERDEARKEVCVLANMRHPNIVSYKESFEERGNLYIVMDYCEGGDLFKRINAQKGVLFSEDQILDWLVQLCLALKHVHDRKILHRDIKSQNIFLTKAGIVQLGDFGIARVLNSTTELARTCIGTPYYLSPEICENKPYNHKSDMWALGCVLYEMCTLRHAFEAGNMKNLVLKIIRGSFPPVSAHYSSELRSTLSGLLRRDPRARPPVAVLLSRPLLMARAQRLMVSE 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 195.667 bits (496), Expect = 6.822e-52
Identity = 101/248 (40.73%), Postives = 152/248 (61.29%), Query Frame = 2
Query:  143 IGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRI----KKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTIL 874
            +G+GAFG A L     D    V KEI L ++ +KER +++ E+ +LS + H NI++YYN F +     I +EYC GG LY KI  Q+G  F E  ++ YF Q+  A++ IH+ +ILHRDIK  NIFLTK++ +K+GDFGI+K +DS + + ++ VGTP+Y SPE+  G  YN KSDIW++GC+LYEL +L   F   +   L   I    K+V    +   +S  ++ +V    ++  ++RP    +L
Sbjct:   42 LGRGAFGEAALYRRNEDNSLVVWKEIDLTRLSDKERRDSQNEIDILSLLEHANIISYYNHFLDGNVLLIELEYCNGGTLYEKIIKQHGAFFPEKDIVWYFYQLVSAVEQIHNFKILHRDIKTLNIFLTKSDLIKVGDFGISKILDSRSQMAESYVGTPYYMSPELIRGDKYNTKSDIWAMGCVLYELLTLTRTFDATNPLKLCYEIIHGKKQVE---IDDQYSKEIKEVVQKCLQQDAEQRPTAEDLL 286          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000555.1 (pep scaffold:Pmarinus_7.0:GL477093:35206:42652:1 gene:ENSPMAG00000000500.1 transcript:ENSPMAT00000000555.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.392 bits (420), Expect = 1.495e-47
Identity = 74/173 (42.77%), Postives = 115/173 (66.47%), Query Frame = 2
Query:  410 LFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMR-----IKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFL 913
            +  +  V+ +F+Q+C+A+++IH  +ILHRDIK  N+FLTK  +VK+GDFGI+KAM+ T  +  T VGTP+Y SPE+C+  PY++KSD+W+LGC+LYELC+L  AF   +I  L  R     I +    P+   +S  +RALV  +  R P++RP+ + +L  P+  + +  F+
Sbjct:    4 IITKTNVMQWFVQVCMAVQYIHSVKILHRDIKTSNVFLTKAGTVKVGDFGISKAMEGTLDMAVTCVGTPYYLSPEMCQDLPYSSKSDVWALGCLLYELCALRPAFEASNIIRLTRRSLFYKIMRGEPDPLDESYSRDVRALVALLLSRSPEDRPSASAVLASPYAQRHLRLFV 176          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001750.1 (pep scaffold:Pmarinus_7.0:GL481695:1137:12922:1 gene:ENSPMAG00000001576.1 transcript:ENSPMAT00000001750.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.555 bits (436), Expect = 2.481e-45
Identity = 83/182 (45.60%), Postives = 113/182 (62.09%), Query Frame = 2
Query:  368 GGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSV-KLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKF 910
            GG L   I+ + G L  ED +L +F+QI LAL H+H   ILHRD+K  NI L K  +V K+GDFGI+K + S +    T VGTP Y SPE+CEG PYN KSDIW+LGCILYEL SL  AF  +++  L ++I   N+ PV   +S  LR LV ++    P +RP ++ +L  P  +  + + 
Sbjct:    1 GGTLAEYIQKRGGSLLDEDTILHFFVQIALALHHVHSNHILHRDLKTHNILLDKRQTVVKIGDFGISKILSSKSK-AYTVVGTPCYISPELCEGKPYNQKSDIWALGCILYELASLKRAFEAENLPALVLKIMSGNFAPVSDRYSGELRQLVVSLLNLDPSKRPQLSEVLSHPVCMSAMIRL 181          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: nek2 (NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-752])

HSP 1 Score: 165.622 bits (418), Expect = 2.832e-44
Identity = 93/244 (38.11%), Postives = 138/244 (56.56%), Query Frame = 2
Query:  233 MHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVG--CFHILMEYCEGGDLYRKIKT--QNGVLFKEDQVLDYFIQICLALKHIH-----DQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDK---FLPPENP 928
            M E E+     EV+LL ++ HPNIV Y++   +      +I+MEYCE GDL   I    ++    +E+ VL    Q+ LAL+  H      + +LHRD+KP N+FL   ++VKLGDFG+A+ +   T+  KT VGTP+Y SPE      YN KSDIWSLGC+LYELC+L   F   +   LA +IK+  ++ +P  +S  L  ++  M   +   RP+I  I++   + + +D+      PE P
Sbjct:   13 MSEPEKQMLVSEVNLLRELKHPNIVRYFDRIIDRSNTTLYIVMEYCECGDLASLISRCRRDRRFLEEEFVLRVLAQLVLALRECHRRTAGGRTVLHRDLKPANVFLDARHNVKLGDFGLARILQHDTSFAKTFVGTPYYMSPEQFSRMSYNEKSDIWSLGCLLYELCALVPPFTAMNQKQLAEKIKEGKFRRIPYRYSDELNEIISKMLNLKDYLRPSIEQIMQYGLLAEVLDEEQARAAPEKP 256          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KIN3 (Nonessential serine/threonine protein kinase; possible role in DNA damage response; influences tolerance to high levels of ethanol [Source:SGD;Acc:S000000071])

HSP 1 Score: 144.821 bits (364), Expect = 2.508e-37
Identity = 117/389 (30.08%), Postives = 174/389 (44.73%), Query Frame = 2
Query:  119 SDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYN-SFEEVG-CFHILMEYCEGGDLYRKIK--TQNGVLFKEDQVLDYFIQICLALKHIH---------------------DQRILHRDIKPQNIFLTKNNS---------------------------------------VKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTIL--------RKPFILKKID-KFLPPENPLLN----------ETKKQIQ--KRPSTASVVSRVDSGLSNKKKARV 1030
            S+++ L +IG+G+FG    V      K  V K+I    M+ KER +   E S+LS++ H NIV +YN  F+E     ++ MEYC  GDL + IK   Q      E  V     Q+  AL   H                        ++HRD+KP NIFL+ ++S                                       VKLGDFG+AK+++++     T VGTP+Y SPE+    PY+  SDIWSLGC+++E+CSL+  F  ++   L  +IK      VP  +S  L A++ +M       RP+   +L        RK   L++ + K L  EN L N          E ++++   K   T +V  R    +S KK  +V
Sbjct:   23 SEYQVLEEIGRGSFGSVRKVIHIPTKKLLVRKDIKYGHMNSKERQQLIAECSILSQLKHENIVEFYNWDFDEQKEVLYLYMEYCSRGDLSQMIKHYKQEHKYIPEKIVWGILAQLLTALYKCHYGVELPTLTTIYDRMKPPVKGKNIVIHRDLKPGNIFLSYDDSDYNINEQVDGHEEVNSNYYRDHRVNSGKRGSPMDYSQVVVKLGDFGLAKSLETSIQFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIFEMCSLHPPFQAKNYLELQTKIKNGKCDTVPEYYSRGLNAIIHSMIDVNLRTRPSTFELLQDIQIRTARKSLQLERFERKLLDYENELTNIEKILEKQAIEYERELSQLKEQFTQAVEERAREVISGKKVGKV 411          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 134.035 bits (336), Expect = 5.085e-34
Identity = 78/248 (31.45%), Postives = 130/248 (52.42%), Query Frame = 2
Query:  113 SISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFE-ARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDER 853
            S+SDF+ L  +G G+FG   L+ S  + + Y LK +  + + + ++ E    E  +LS ++HP I+  + +F++     ++M+Y EGG+L+  ++      F       Y  ++CLAL+++H + I++RD+KP+NI L KN  +K+ DFG AK +     +T T  GTP Y +PE+    PYN   D WS G ++YE+ +    FY  +       I     K  P  F    + L+  +  R   ER
Sbjct:   84 SLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQ--RFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD---VTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELK-FPPFFHPDAQDLLKKLITRDLSER 325          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 130.183 bits (326), Expect = 9.365e-33
Identity = 76/250 (30.40%), Postives = 132/250 (52.80%), Query Frame = 2
Query:  113 SISDFKRLNKIGQGAFGIAWLVESKIDCKKY---VLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDER 853
            S+ DF+ L  +G G+FG   L+ S+ + + Y   VLK+  + ++ + E      E  +LS + HP I+  + +F++     ++M+Y EGG+L+  ++      F       Y  ++CLAL+++H + I++RD+KP+NI L KN  +K+ DFG AK +     +T T  GTP Y +PE+    PYN   D WS G ++YE+ +    FY  +      +I     +  P  F+  ++ L+  +  R   +R
Sbjct:   83 SLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEH--TNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQ--RFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD---VTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELR-FPPFFNEDVKDLLSRLITRDLSQR 324          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 131.724 bits (330), Expect = 1.719e-31
Identity = 78/249 (31.33%), Postives = 138/249 (55.42%), Query Frame = 2
Query:  143 IGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFI 889
            IG+G++G+ +   +K   +   +KE+ +Y+ +++E  +   E+SLL  +NH NIV Y+    +    +IL+EYC  G L R++ +++     E++   Y  Q  L LK++H + ++HRDIK  NI L+ +N+VKL DFG++  ++S+     T  GT  + +PEI      +  SDIWSLG  + E+ + N  ++      +   ++   Y P PS FS PL+  +   F +   +RP  + +L+  +I
Sbjct:   31 IGRGSYGVVYKAINKHTDQVVAIKEV-VYE-NDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSL-RRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSAL---TLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTYYP-PSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWI 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 129.798 bits (325), Expect = 2.998e-31
Identity = 78/255 (30.59%), Postives = 135/255 (52.94%), Query Frame = 2
Query:  122 DFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKM-HEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEG--CPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYK-PVPSVFSAPLRALVDNMFRRRPDERPNINTIL 874
            D+ R + +G+G F   + ++     + +  K +    +  EK R +   E+ +   M+HPNIV + + FE+    +IL+E C  G L   +K +   +  E +V  +  QIC A+K++H +R++HRD+K  NIF   N ++K+GDFG+A  + + +    T  GTP Y +PE+  G    ++ + DIWSLG +LY L      F  +D+  +  RIK  ++  P     S   + L+ ++    P ERP++  I+
Sbjct:   81 DYHRGHFLGEGGFARCFQIKDD-SGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRK--VLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIM 332          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 323.939 bits (829), Expect = 5.450e-102
Identity = 145/266 (54.51%), Postives = 203/266 (76.32%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPE 922
            + R+ KIG+G+FG A LV+ + D K YV+KEI + +M  +ER E+RKEV +LS++ HPNIV+Y  SFEE G  +I+M+YC+GGDLY+KI  Q G+ F EDQV+D+F+QICL LKH+HD++ILHRDIK QNIFLT++  +K+GDFGIA+ + ST  L +T +GTP+Y SPEI E  PYNNKSDIWSLGC+LYE+ +L +AF   ++  L ++I + +Y P+P  +SA +R LV  + +R P +RP++NT+L+K FI K+I+KFL  E
Sbjct:    4 YVRVKKIGEGSFGKALLVKKRNDGKHYVIKEINICRMKPREREESRKEVKVLSQLKHPNIVSYQESFEESGNLYIVMDYCDGGDLYKKINGQRGIAFSEDQVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHSTVELARTCIGTPYYLSPEIVENRPYNNKSDIWSLGCVLYEMLTLKHAFEAGNMKNLVLKIIRGSYPPIPLRYSADIRMLVAQLLKRNPHDRPSVNTVLKKNFIQKRIEKFLSKE 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 260.766 bits (665), Expect = 3.591e-79
Identity = 126/262 (48.09%), Postives = 176/262 (67.18%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKF 910
            +++++ IG+G FG AWLVES+   + Y LKE+    M  ++R  A  EV +LS + H NIV Y ++FEE G F+I+MEY EGGDL+ KIK Q    F  +++L++  Q+ LALKHIH Q ILHRD+K QNIFLTK++ VK+GDFGIA+ +DST    +T VGTP+Y SPEIC+  PYNNKSDIW+LGC+LYEL +  + F   ++T L ++I   NY P+P  +   L  LV  M +  P +RP+   ++  P +   IDK+
Sbjct:    4 YQKIDIIGKGTFGSAWLVESRQSKRLYALKELNATAMPSEDRHLALNEVKILSTLKHRNIVRYRDAFEETGRFYIVMEYAEGGDLHTKIK-QAVEPFSSERILNWLAQLLLALKHIHGQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDHARTTVGTPYYLSPEICQRQPYNNKSDIWALGCVLYELTTRTHPFTADNLTNLVVKILHGNYPPIPRFYGPLLEDLVAVMLKINPADRPSAKQLIYVPGLTPYIDKY 264          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG02])

HSP 1 Score: 258.07 bits (658), Expect = 5.821e-78
Identity = 116/258 (44.96%), Postives = 183/258 (70.93%), Query Frame = 2
Query:  143 IGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEE-VGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFL 913
            IG+G++G  +L + K D K+YVLK++ L K   +ER  A  E  LLS++ HPNIV+Y  SF++  G  +I M +CEGGDLY ++K Q G+   E+Q++++F+QI +AL+++H++ ILHRD+K QNIFLTK+  +K+GD GIA+ ++S++ +  T +GTP+Y SPE+    PYN+KSD+W+LGC LYE+C+L +AF  +D++ L  +I K    P+P  +S  L +++ +M  + PD+RP+ + +LR P+I K+I  FL
Sbjct:   12 IGKGSYGEVFLSKHKKDKKQYVLKKVDLQKASVRERKAAELEAKLLSQLRHPNIVSYRESFQDDTGFLYIAMNFCEGGDLYSRLKAQKGIPLDENQIVEWFVQIAMALQYMHEKHILHRDLKTQNIFLTKSKIIKVGDLGIARVLESSSDMATTLIGTPYYMSPELFSNKPYNHKSDVWALGCCLYEMCTLRHAFNAKDMSSLVYKILKGKTPPLPKQYSTDLCSIIKSMLDQDPDKRPSASRLLRHPYIKKQIALFL 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGU2])

HSP 1 Score: 225.328 bits (573), Expect = 1.501e-66
Identity = 116/263 (44.11%), Postives = 172/263 (65.40%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVES-KIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKT--QNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKID 904
            ++ + ++G G+FG  +LVE  K + ++ VLKEI + ++   E  +A +E  LLSK+NHPNIV + +SF +   F I+ EYCEGGDL  KI    ++G  F E  +L +FIQI LA++H+H+ RILHRD+K +NIFL KNN VKLGDFGI++ +  T+ +  T  GTP+Y SPE+ +   YN+KSDIWSLG +LYELC+L +AF GQ +  +  +I +     +   +S+ L+A    +  + P  RP+ N IL+  FI + I+
Sbjct:    6 YRVVRRLGSGSFGTVFLVEDLKANGERKVLKEIYVGELQPDETVDAMREAKLLSKLNHPNIVKFMDSFMDREYFCIVTEYCEGGDLDDKISAWRKSGKKFDESLILAWFIQIVLAVQHMHEMRILHRDLKTRNIFL-KNNIVKLGDFGISRILMGTSDMATTFTGTPYYMSPEVLKHEGYNHKSDIWSLGVVLYELCNLQHAFQGQSLMGVMYKIVEGELPALSDKYSSQLQAFYSRLMDKDPKLRPSANEILKHHFIAENIN 267          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO46185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQY7])

HSP 1 Score: 226.868 bits (577), Expect = 9.380e-63
Identity = 108/263 (41.06%), Postives = 168/263 (63.88%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNS-VKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKI 901
            + +++++  +G+GA+G  +L    +D    ++K+I + +M ++ER  A  EV +LS   HPNI+ YY+SF +     I+MEY +GG +Y  ++ + G L  ED++L  F+QI LAL+H+H  +ILHRD+K QNI L K    VK+GDFGI+K + S +    T +G+P Y SPE+CEG PYN KSD+WSLGC+LYEL +L  AF   ++  L ++I +  + P+P  +S  LR L+ +M    P +RP I  I+ +P I+  +
Sbjct:    1 MQNYEKVRIVGRGAYGTVYLCRRLVDNFLVIIKQIPVEEMTKEERQSALNEVKVLSMFQHPNIIRYYDSFVQEKALMIVMEYAQGGTIYDYLQQRGGKLMDEDEILRLFVQILLALRHVHKGQILHRDLKTQNILLNKKRKVVKIGDFGISKILSSKSK-ANTVIGSPCYISPELCEGKPYNQKSDVWSLGCVLYELTTLKRAFEASNLPALVLKIMRGYFSPIPERYSEELRKLILDMLVLDPTKRPGIKEIMAQPVIVNAL 262          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000000545.2 (pep primary_assembly:ASM223467v1:4:1040495:1044496:1 gene:ENSORLG00000000439.2 transcript:ENSORLT00000000545.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 321.242 bits (822), Expect = 8.966e-101
Identity = 149/263 (56.65%), Postives = 206/263 (78.33%), Query Frame = 2
Query:  125 FKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFL 913
            ++ + +IG+G+FG A LV SK D ++YV+KEIG+  M  KER E+RKEVS+L+ M+HPNIV Y  SFE  GC +I+M+YCEGGDL++KI +Q GVLF EDQ+LD+F+QICLALKH+H ++ILHRDIK QNIFLTK+ +V+LGDFGIA+ ++ T  L +T +GTP+Y SPEICE  PYNNK DIW+LGC+LYE+C+L +AF   ++  L ++I + +Y PV   +S  LR+L+  +FRR P ERP++++IL KPF+  +I+KFL
Sbjct:    4 YENVKQIGEGSFGKAILVNSKEDGRQYVIKEIGISGMSTKERRESRKEVSVLANMSHPNIVQYKESFEG-GCLYIVMDYCEGGDLFKKINSQKGVLFSEDQILDWFVQICLALKHVHGRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLN-TVELARTCIGTPYYLSPEICENKPYNNK-DIWALGCVLYEMCTLKHAFEAGNMKNLVLKIIRGSYPPVSVHYSPELRSLLAQLFRRNPRERPSVSSILEKPFLSCRIEKFL 263          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000034147.1 (serine/threonine-protein kinase Nek5 [Source:NCBI gene;Acc:101162253])

HSP 1 Score: 304.679 bits (779), Expect = 9.796e-89
Identity = 140/267 (52.43%), Postives = 197/267 (73.78%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDC--KKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNN-SVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDK 907
            ++D++ L +IG+GAFG A+LV SK      + V+K+I L KM  KER  +RKEV+LLS+M HPNIV++ +SF E G   I+ME+C+GGDL +KI  Q GV F+E+++LD F+QICL LKHIHD+++LHRDIK QNIFLT      KLGDFGIA+ ++++  L +T VGTP+Y SPEICE  PYNNK+D+WSLGC+LYELC+L + F G  +  L  +I +  Y PVP+ ++  LR LV+ +F+  P +RP+I+++L++PF+ K I K
Sbjct:    1 MNDYEVLWQIGEGAFGKAFLVRSKTGGGDTQCVIKQINLQKMSAKERESSRKEVTLLSRMRHPNIVSFISSFLEKGSLFIVMEFCDGGDLLKKINMQRGVPFREEEILDLFVQICLGLKHIHDKKVLHRDIKCQNIFLTNGGMKAKLGDFGIARMLNNSMDLARTCVGTPYYLSPEICESRPYNNKTDVWSLGCVLYELCTLRHPFEGSSLRQLLGKICRGRYAPVPTRYTHELRLLVNQLFKVNPRDRPSISSVLQRPFLQKHISK 267          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: nek4 (NIMA related kinase 4 [Source:NCBI gene;Acc:101169778])

HSP 1 Score: 252.677 bits (644), Expect = 9.558e-70
Identity = 113/258 (43.80%), Postives = 179/258 (69.38%), Query Frame = 2
Query:  143 IGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFE-EVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFL 913
            +G+G++G   LV+ K D K+YV+K++ L    ++ER  A +E  LLS++ HPNIVTY  S+E +    +I+M +CEGGDLY ++K + G L  E QV+++F+QI +AL+++H++ ILHRD+K QNIFLTK N +K+GD GIA+ +++   +  T +GTP+Y SPE+    PYN+KSD+W+LGC +YE+ +L +AF  +D+  L  RI +     +PS +   L  L+ +M  ++P+ERP++  ILR+P+I ++I  FL
Sbjct:   10 VGKGSYGEVNLVKHKTDRKQYVIKKLNLSTSSKRERRSAEQEAQLLSQLRHPNIVTYRESWEGDDRQLYIVMGFCEGGDLYHRLKQRKGELLPERQVVEWFVQIAMALQYLHERNILHRDLKTQNIFLTKTNIIKVGDLGIARVLENQNDMASTLIGTPYYMSPELFSNKPYNHKSDVWALGCCVYEMSTLKHAFNAKDMNSLVYRIVEGKLPQMPSRYDPQLGDLIKSMLSKKPEERPDVKLILRQPYIKRQIAMFL 267          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027525.1 (NIMA related kinase 3 [Source:NCBI gene;Acc:101171427])

HSP 1 Score: 241.506 bits (615), Expect = 1.956e-69
Identity = 117/267 (43.82%), Postives = 168/267 (62.92%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLP 916
            +  + +L  +G+G+FG A LV+     +KYV+KEI L K   K R ++RKE  LLS+M HPNIV +  +FE      I+MEYC GGDL ++I+ Q    F  + +L +F Q+C   +HIHD+R+LHRD+K +NIFLT + SVKLGDFG A  ++S+ A     VGTP+Y +PEI +  PYNNKSD+WSLGC+LYELC+L + F       L +++ +  Y P+P      L  L+  +F+  P +RP++ TIL    + K +   LP
Sbjct:    1 MEKYTQLKVVGEGSFGRAVLVQWISTQEKYVVKEIQLPKNESKLR-DSRKEAILLSRMKHPNIVAFREAFEMTDLLCIVMEYCSGGDLLQRIQQQKATNFCTENILRWFAQMCAGAQHIHDKRVLHRDLKSKNIFLTGDGSVKLGDFGSACVLNSSKAYAHAYVGTPYYVAPEIWDNKPYNNKSDVWSLGCVLYELCALQHPFQASSWKSLILKVCRGAYPPLPRHLPYELLHLMKQIFKTNPKDRPSVQTILTSHRVSKLLRSHLP 266          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045610.1 (NIMA related kinase 3 [Source:NCBI gene;Acc:101171427])

HSP 1 Score: 241.506 bits (615), Expect = 1.956e-69
Identity = 117/267 (43.82%), Postives = 168/267 (62.92%), Query Frame = 2
Query:  116 ISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLP 916
            +  + +L  +G+G+FG A LV+     +KYV+KEI L K   K R ++RKE  LLS+M HPNIV +  +FE      I+MEYC GGDL ++I+ Q    F  + +L +F Q+C   +HIHD+R+LHRD+K +NIFLT + SVKLGDFG A  ++S+ A     VGTP+Y +PEI +  PYNNKSD+WSLGC+LYELC+L + F       L +++ +  Y P+P      L  L+  +F+  P +RP++ TIL    + K +   LP
Sbjct:    1 MEKYTQLKVVGEGSFGRAVLVQWISTQEKYVVKEIQLPKNESKLR-DSRKEAILLSRMKHPNIVAFREAFEMTDLLCIVMEYCSGGDLLQRIQQQKATNFCTENILRWFAQMCAGAQHIHDKRVLHRDLKSKNIFLTGDGSVKLGDFGSACVLNSSKAYAHAYVGTPYYVAPEIWDNKPYNNKSDVWSLGCVLYELCALQHPFQASSWKSLILKVCRGAYPPLPRHLPYELLHLMKQIFKTNPKDRPSVQTILTSHRVSKLLRSHLP 266          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 2123.21 bits (5500), Expect = 0.000e+0
Identity = 1124/1124 (100.00%), Postives = 1124/1124 (100.00%), Query Frame = 2
Query:  107 MSSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQKRPSTASVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDANPLVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPAAIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQSPIPRQTPRSIEEETTERLNKIRQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEARKALEDLKKRVXXXXXXXXXXXXXXXXXXXXXLPSVIDDDPPNNAILFPKRPPVVVNKPENSSNVSHPIAEPGIISVILERIHENITPAGDAPKVDNIELPESLSVILSQLDDKSRPSTASCSDQSEIRKRKDDILKRLNMKCNKVSGGXXXXXXXXXXXTPRKSWIFDMDENNICIKNNLDNTISDCETMVDVSILQHDEEKMRGKWQIDDEITSDTVVLQNIKLNQDSGGSTIVLDQPSIEIDVPRISESMNCNENSIMEISNLSTIIEVSQEIIEITLNDDKKIKSNFFEREEVWNQNVSKGNIKNQHQPICTLENKKEKSENEALEKVKNTQIIGLEXXXXXXXXXXXVSETAENSDIIDSSGSDTEDLIECFKNAXXXXXXXXXXXXXXXXXXXXTINIGIFNDQSKISNANSLQNLTEKPVTRIRRTKSYSEFEMNLNKEWSSEDTFSSEDFGDDEISNPGNIFLKIEKIRAELEEKIGIDSLMDAVEFVRENQDLNGDQLAEKLKDMIGDEASINDILQLVVLEEQYHNIE 3478
            MSSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQKRPSTASVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDANPLVVRQQELNNKYKVEMINVDRENGWKNVLSSDDSKSDCKESKLNAKLNVYGMTPAAIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQSPIPRQTPRSIEEETTERLNKIRQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEARKALEDLKKRVKQKTEELKQKLERKEKERNKELPSVIDDDPPNNAILFPKRPPVVVNKPENSSNVSHPIAEPGIISVILERIHENITPAGDAPKVDNIELPESLSVILSQLDDKSRPSTASCSDQSEIRKRKDDILKRLNMKCNKVSGGEKENEEAKEKETPRKSWIFDMDENNICIKNNLDNTISDCETMVDVSILQHDEEKMRGKWQIDDEITSDTVVLQNIKLNQDSGGSTIVLDQPSIEIDVPRISESMNCNENSIMEISNLSTIIEVSQEIIEITLNDDKKIKSNFFEREEVWNQNVSKGNIKNQHQPICTLENKKEKSENEALEKVKNTQIIGLEDDIIITNIDDDVSETAENSDIIDSSGSDTEDLIECFKNALSIDISNSSSSKSVDNLSDKTINIGIFNDQSKISNANSLQNLTEKPVTRIRRTKSYSEFEMNLNKEWSSEDTFSSEDFGDDEISNPGNIFLKIEKIRAELEEKIGIDSLMDAVEFVRENQDLNGDQLAEKLKDMIGDEASINDILQLVVLEEQYHNIE
Sbjct:    1 MSSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQKRPSTASVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDANPLVVRQQELNNKYKVEMINVDRENGWKNVLSSDDSKSDCKESKLNAKLNVYGMTPAAIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQSPIPRQTPRSIEEETTERLNKIRQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEARKALEDLKKRVKQKTEELKQKLERKEKERNKELPSVIDDDPPNNAILFPKRPPVVVNKPENSSNVSHPIAEPGIISVILERIHENITPAGDAPKVDNIELPESLSVILSQLDDKSRPSTASCSDQSEIRKRKDDILKRLNMKCNKVSGGEKENEEAKEKETPRKSWIFDMDENNICIKNNLDNTISDCETMVDVSILQHDEEKMRGKWQIDDEITSDTVVLQNIKLNQDSGGSTIVLDQPSIEIDVPRISESMNCNENSIMEISNLSTIIEVSQEIIEITLNDDKKIKSNFFEREEVWNQNVSKGNIKNQHQPICTLENKKEKSENEALEKVKNTQIIGLEDDIIITNIDDDVSETAENSDIIDSSGSDTEDLIECFKNALSIDISNSSSSKSVDNLSDKTINIGIFNDQSKISNANSLQNLTEKPVTRIRRTKSYSEFEMNLNKEWSSEDTFSSEDFGDDEISNPGNIFLKIEKIRAELEEKIGIDSLMDAVEFVRENQDLNGDQLAEKLKDMIGDEASINDILQLVVLEEQYHNIE 1124          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 2118.58 bits (5488), Expect = 0.000e+0
Identity = 1124/1125 (99.91%), Postives = 1124/1125 (99.91%), Query Frame = 2
Query:  107 MSSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQKRPSTASVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDANPLVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPAAIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQSPIPRQTPRSIEEETTERLNKIRQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEARKALEDLKKRVXXXXXXXXXXXXXXXXXXXXXLPSVIDDDPPNNAILFPKR-PPVVVNKPENSSNVSHPIAEPGIISVILERIHENITPAGDAPKVDNIELPESLSVILSQLDDKSRPSTASCSDQSEIRKRKDDILKRLNMKCNKVSGGXXXXXXXXXXXTPRKSWIFDMDENNICIKNNLDNTISDCETMVDVSILQHDEEKMRGKWQIDDEITSDTVVLQNIKLNQDSGGSTIVLDQPSIEIDVPRISESMNCNENSIMEISNLSTIIEVSQEIIEITLNDDKKIKSNFFEREEVWNQNVSKGNIKNQHQPICTLENKKEKSENEALEKVKNTQIIGLEXXXXXXXXXXXVSETAENSDIIDSSGSDTEDLIECFKNAXXXXXXXXXXXXXXXXXXXXTINIGIFNDQSKISNANSLQNLTEKPVTRIRRTKSYSEFEMNLNKEWSSEDTFSSEDFGDDEISNPGNIFLKIEKIRAELEEKIGIDSLMDAVEFVRENQDLNGDQLAEKLKDMIGDEASINDILQLVVLEEQYHNIE 3478
            MSSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQKRPSTASVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDANPLVVRQQELNNKYKVEMINVDRENGWKNVLSSDDSKSDCKESKLNAKLNVYGMTPAAIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQSPIPRQTPRSIEEETTERLNKIRQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEARKALEDLKKRVKQKTEELKQKLERKEKERNKELPSVIDDDPPNNAILFPKR PPVVVNKPENSSNVSHPIAEPGIISVILERIHENITPAGDAPKVDNIELPESLSVILSQLDDKSRPSTASCSDQSEIRKRKDDILKRLNMKCNKVSGGEKENEEAKEKETPRKSWIFDMDENNICIKNNLDNTISDCETMVDVSILQHDEEKMRGKWQIDDEITSDTVVLQNIKLNQDSGGSTIVLDQPSIEIDVPRISESMNCNENSIMEISNLSTIIEVSQEIIEITLNDDKKIKSNFFEREEVWNQNVSKGNIKNQHQPICTLENKKEKSENEALEKVKNTQIIGLEDDIIITNIDDDVSETAENSDIIDSSGSDTEDLIECFKNALSIDISNSSSSKSVDNLSDKTINIGIFNDQSKISNANSLQNLTEKPVTRIRRTKSYSEFEMNLNKEWSSEDTFSSEDFGDDEISNPGNIFLKIEKIRAELEEKIGIDSLMDAVEFVRENQDLNGDQLAEKLKDMIGDEASINDILQLVVLEEQYHNIE
Sbjct:    1 MSSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQKRPSTASVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDANPLVVRQQELNNKYKVEMINVDRENGWKNVLSSDDSKSDCKESKLNAKLNVYGMTPAAIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQSPIPRQTPRSIEEETTERLNKIRQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEARKALEDLKKRVKQKTEELKQKLERKEKERNKELPSVIDDDPPNNAILFPKRSPPVVVNKPENSSNVSHPIAEPGIISVILERIHENITPAGDAPKVDNIELPESLSVILSQLDDKSRPSTASCSDQSEIRKRKDDILKRLNMKCNKVSGGEKENEEAKEKETPRKSWIFDMDENNICIKNNLDNTISDCETMVDVSILQHDEEKMRGKWQIDDEITSDTVVLQNIKLNQDSGGSTIVLDQPSIEIDVPRISESMNCNENSIMEISNLSTIIEVSQEIIEITLNDDKKIKSNFFEREEVWNQNVSKGNIKNQHQPICTLENKKEKSENEALEKVKNTQIIGLEDDIIITNIDDDVSETAENSDIIDSSGSDTEDLIECFKNALSIDISNSSSSKSVDNLSDKTINIGIFNDQSKISNANSLQNLTEKPVTRIRRTKSYSEFEMNLNKEWSSEDTFSSEDFGDDEISNPGNIFLKIEKIRAELEEKIGIDSLMDAVEFVRENQDLNGDQLAEKLKDMIGDEASINDILQLVVLEEQYHNIE 1125          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000020466.1 (SMESG000020466.1)

HSP 1 Score: 2070.43 bits (5363), Expect = 0.000e+0
Identity = 1106/1125 (98.31%), Postives = 1106/1125 (98.31%), Query Frame = 2
Query:  107 MSSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQKRPSTASVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDANPLVVRQQELNNKYKVEMINVDRENGWKNVLXXXXXXXXXXXXXLNAKLNVYGMTPAAIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQSPIPRQTPRSIEEETTERLNKIRQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEARKALEDLKKRVXXXXXXXXXXXXXXXXXXXXXLPSVIDDDPPNNAILFPKR-PPVVVNKPENSSNVSHPIAEPGIISVILERIHENITPAGDAPKVDNIELPESLSVILSQLDDKSRPSTASCSDQSEIRKRKDDILKRLNMKCNKVSGGXXXXXXXXXXXTPRKSWIFDMDENNICIKNNLDNTISDCETMVDVSILQHDEEKMRGKWQIDDEITSDTVVLQNIKLNQDSGGSTIVLDQPSIEIDVPRISESMNCNENSIMEISNLSTIIEVSQEIIEITLNDDKKIKSNFFEREEVWNQNVSKGNIKNQHQPICTLENKKEKSENEALEKVKNTQIIGLEXXXXXXXXXXXVSETAENSDIIDSSGSDTEDLIECFKNAXXXXXXXXXXXXXXXXXXXXTINIGIFNDQSKISNANSLQNLTEKPVTRIRRTKSYSEFEMNLNKEWSSEDTFSSEDFGDDEISNPGNIFLKIEKIRAELEEKIGIDSLMDAVEFVRENQDLNGDQLAEKLKDMIGDEASINDILQLVVLEEQYHNIE 3478
            MSSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQKRPSTASVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDANPLVVRQQELNNKYKVEMINVDRENGWKNVLSSDDSKSDCKESKLNAKLNVYGMTPAAIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQSPIPRQTPRSIEEETTERLNKIRQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEARKALEDLKKRVKQKTEELKQKLERKEKERNKELPSVIDDDPPNNAILFPKR PPVVVNKPENSSNVSHPIAEPGIISVILERIHENITPAGDAPKVDNIELPESLSVILSQLDDKSRPSTASCSDQSEIRKRKDDILKRLNMKCNKVSGGEKENEEAKEKETPRKSWIFDMDENNI                  VSILQHDEEKMRGKWQIDDEITSDTVVLQNIKLNQDSGGSTIVLDQPSIEIDVPRISESMNCNENSIMEISNLSTIIEVSQEIIEITLNDDKKIKSNFFEREEVWNQNVSKGNIKNQHQPICTLENKKEKSENEALEKVKNTQIIGLEDDIIITNIDDDVSETAENSDIIDSSGSDTEDLIECFKNALSIDISNSSSSKSVDNLSDKTINIGIFNDQSKISNANSLQNLTEKPVTRIRRTKSYSEFEMNLNKEWSSEDTFSSEDFGDDEISNPGNIFLKIEKIRAELEEKIGIDSLMDAVEFVRENQDLNGDQLAEKLKDMIGDEASINDILQLVVLEEQYHNIE
Sbjct:    1 MSSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFLPPENPLLNETKKQIQKRPSTASVVSRVDSGLSNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDANPLVVRQQELNNKYKVEMINVDRENGWKNVLSSDDSKSDCKESKLNAKLNVYGMTPAAIKQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKLLKVGADGLYRKIDASKPYDERSKMNELARIHGKIGGNAADQAVIQEFIERKRQAKNIKNRNGSGMALLMGGHQFCAEQSPIPRQTPRSIEEETTERLNKIRQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEARKALEDLKKRVKQKTEELKQKLERKEKERNKELPSVIDDDPPNNAILFPKRSPPVVVNKPENSSNVSHPIAEPGIISVILERIHENITPAGDAPKVDNIELPESLSVILSQLDDKSRPSTASCSDQSEIRKRKDDILKRLNMKCNKVSGGEKENEEAKEKETPRKSWIFDMDENNIY-----------------VSILQHDEEKMRGKWQIDDEITSDTVVLQNIKLNQDSGGSTIVLDQPSIEIDVPRISESMNCNENSIMEISNLSTIIEVSQEIIEITLNDDKKIKSNFFEREEVWNQNVSKGNIKNQHQPICTLENKKEKSENEALEKVKNTQIIGLEDDIIITNIDDDVSETAENSDIIDSSGSDTEDLIECFKNALSIDISNSSSSKSVDNLSDKTINIGIFNDQSKISNANSLQNLTEKPVTRIRRTKSYSEFEMNLNKEWSSEDTFSSEDFGDDEISNPGNIFLKIEKIRAELEEKIGIDSLMDAVEFVRENQDLNGDQLAEKLKDMIGDEASINDILQLVVLEEQYHNIE 1108          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000005635.1 (SMESG000005635.1)

HSP 1 Score: 239.195 bits (609), Expect = 6.639e-67
Identity = 118/261 (45.21%), Postives = 169/261 (64.75%), Query Frame = 2
Query:  134 LNKIGQGAFGIAWLVESK-IDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRKPFILKKIDKFL 913
            + KIGQG++G  WLV+ K  D KK+VLK+I   +  ++E   AR E  LL  + HPNIV Y +SFEE    +I M +CE GDLY ++K + G L  E Q++++ IQI +AL +IH++ ILHRD+K QNIFLTK + +K+GD GIAK ++S   + KT +GTP+Y SPE+ E  PYN KSDIWSLGC+ YE+ +L +AF  ++ T L+ +I       +PS ++  L  L+  M  + P++RP+   IL   FI   I  F+
Sbjct:   11 IKKIGQGSYGEVWLVKHKDYDHKKFVLKKISFARSSDREMEAARLECQLLKSLEHPNIVQYKDSFEENNSLYIAMAFCESGDLYTRLKERKGSLLCEKQIIEWLIQITMALSYIHERNILHRDLKTQNIFLTK-SIIKIGDLGIAKQLESKYDMAKTVIGTPYYMSPELFEKKPYNFKSDIWSLGCVTYEMATLKHAFNAKNYTALSYKILMGQTPDMPSKYNKELINLIQAMLNKSPEKRPSTGKILCNNFIRDHIHMFV 270          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000043302.1 (SMESG000043302.1)

HSP 1 Score: 222.631 bits (566), Expect = 1.164e-61
Identity = 116/311 (37.30%), Postives = 181/311 (58.20%), Query Frame = 2
Query:  104 VMSSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFEARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNGVLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDFGIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELCSLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERPNINTILRK--PFILKKIDKFLPPENPLLNETKKQIQKRPSTASVVSRVDSGLSNKKKARV 1030
            +  +I+ F+++  +G+GA+G A L   K D    +LKEI ++ +   ER  A  EV +LS+++HPNIV Y++SFEE G   I MEY + G L + +  Q   L +E ++L+ F QI  A+ +IH+ +ILHRD+K  NIFLTK   +K+GDFGI+K + +T     + +GTP+Y SPE+C+G  YN KSD+W+LGCILYE+  L+  F G ++  L  +I K  ++PV   +S  L+ L+ ++  + PD+R +   IL    P ++K             + +      +P T SVV  +D    N    R+
Sbjct:   53 IQQTINGFEKIRTVGKGAYGTAVLYRKKDDDSLVILKEINMHDLSATERQLAMNEVKVLSQLDHPNIVAYFDSFEEDGVLMIEMEYADNGTLAQFLSNQEKPL-EEKKILEMFFQIVSAIHYIHEHKILHRDLKTVNIFLTKEEIIKIGDFGISKMLSTTHEGANSVIGTPYYISPEMCQGKLYNEKSDVWALGCILYEMTCLHKTFEGSNLPALVNKILKGQFEPVKGSYSDELKELISSLLEKNPDDRLSTEVILHHKLPMMMKTFHT---------DSSDNVDTAKPQTRSVVYVMDINTLNLSPVRL 353          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NEK14.381e-10137.52NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK11.994e-10037.52NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK14.160e-10057.14NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK15.136e-10057.14NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
NEK16.432e-10057.14NIMA related kinase 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nekl-21.962e-6441.26Serine/threonine-protein kinase nekl-2 [Source:Un... [more]
nekl-18.912e-6343.70NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-11.105e-6244.35NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-36.958e-5238.49Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
nekl-36.958e-5238.49Serine/threonine-protein kinase nekl-3 [Source:Un... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
niki1.524e-5741.20gene:FBgn0045980 transcript:FBtr0084737[more]
Nek24.352e-4732.43gene:FBgn0029970 transcript:FBtr0071142[more]
fu9.285e-3430.03gene:FBgn0001079 transcript:FBtr0074602[more]
polo6.932e-3332.34gene:FBgn0003124 transcript:FBtr0074839[more]
polo6.932e-3332.34gene:FBgn0003124 transcript:FBtr0100318[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek12.931e-11056.00NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
CABZ01040556.11.004e-7947.45NIMA related kinase 3 [Source:NCBI gene;Acc:100536... [more]
nek44.733e-6943.80NIMA-related kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek45.500e-6943.80NIMA-related kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
nek86.715e-6139.10NIMA-related kinase 8 [Source:NCBI gene;Acc:171094... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek14.380e-11236.62NIMA-related kinase 1 [Source:NCBI gene;Acc:100036... [more]
nek14.526e-10837.30NIMA-related kinase 1 [Source:NCBI gene;Acc:100036... [more]
nek14.058e-10738.17NIMA-related kinase 1 [Source:NCBI gene;Acc:100036... [more]
nek14.234e-10738.37NIMA-related kinase 1 [Source:NCBI gene;Acc:100036... [more]
sez6l22.320e-9454.41seizure related 6 homolog like 2 [Source:Xenbase;A... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nek11.224e-10737.42NIMA (never in mitosis gene a)-related expressed k... [more]
Nek14.326e-10041.77NIMA (never in mitosis gene a)-related expressed k... [more]
Nek14.400e-10041.77NIMA (never in mitosis gene a)-related expressed k... [more]
Nek13.362e-9956.39NIMA (never in mitosis gene a)-related expressed k... [more]
Nek54.446e-8047.78NIMA (never in mitosis gene a)-related expressed k... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96PY6|NEK1_HUMAN9.576e-10037.52Serine/threonine-protein kinase Nek1 OS=Homo sapie... [more]
sp|P51954|NEK1_MOUSE3.026e-9941.77Serine/threonine-protein kinase Nek1 OS=Mus muscul... [more]
sp|Q6P3R8|NEK5_HUMAN6.476e-8953.41Serine/threonine-protein kinase Nek5 OS=Homo sapie... [more]
sp|P51956|NEK3_HUMAN4.174e-8045.42Serine/threonine-protein kinase Nek3 OS=Homo sapie... [more]
sp|Q7TSC3|NEK5_MOUSE3.110e-7947.78Serine/threonine-protein kinase Nek5 OS=Mus muscul... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2D4I3271.383e-11538.14Protein kinase domain-containing protein (Fragment... [more]
A0A2D4I3109.194e-11438.68Protein kinase domain-containing protein (Fragment... [more]
A0A5G3JN566.877e-10936.62Protein kinase domain-containing protein OS=Xenopu... [more]
I3J4T01.448e-10837.23NIMA-related kinase 1 OS=Oreochromis niloticus OX=... [more]
A0A2Y9Q5615.887e-10737.12serine/threonine-protein kinase Nek1 isoform X6 OS... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek18.448e-10345.23NIMA related kinase 1 [Source:NCBI gene;Acc:103028... [more]
nek16.138e-10056.77NIMA related kinase 1 [Source:NCBI gene;Acc:103028... [more]
ENSAMXT00000049860.14.271e-8946.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000040192.12.275e-7647.13NIMA related kinase 3 [Source:NCBI gene;Acc:103034... [more]
ENSAMXT00000010177.25.347e-7647.13NIMA related kinase 3 [Source:NCBI gene;Acc:103034... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007414.19.223e-9851.50pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
NEK96.822e-5240.73NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
ENSPMAT00000000555.11.495e-4742.77pep scaffold:Pmarinus_7.0:GL477093:35206:42652:1 g... [more]
ENSPMAT00000001750.12.481e-4545.60pep scaffold:Pmarinus_7.0:GL481695:1137:12922:1 ge... [more]
nek22.832e-4438.11NIMA-related kinase 2 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KIN32.508e-3730.08Nonessential serine/threonine protein kinase; poss... [more]
TPK35.085e-3431.45cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK19.365e-3330.40cAMP-dependent protein kinase catalytic subunit; p... [more]
CDC151.719e-3131.33Protein kinase of the Mitotic Exit Network; locali... [more]
CDC52.998e-3130.59Polo-like kinase; controls targeting and activatio... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498225.450e-10254.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491383.591e-7948.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496905.821e-7844.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO370691.501e-6644.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461859.380e-6341.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000545.28.966e-10156.65pep primary_assembly:ASM223467v1:4:1040495:1044496... [more]
ENSORLT00000034147.19.796e-8952.43serine/threonine-protein kinase Nek5 [Source:NCBI ... [more]
nek49.558e-7043.80NIMA related kinase 4 [Source:NCBI gene;Acc:101169... [more]
ENSORLT00000027525.11.956e-6943.82NIMA related kinase 3 [Source:NCBI gene;Acc:101171... [more]
ENSORLT00000045610.11.956e-6943.82NIMA related kinase 3 [Source:NCBI gene;Acc:101171... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020466.10.000e+0100.00SMESG000020466.1[more]
SMESG000020466.10.000e+099.91SMESG000020466.1[more]
SMESG000020466.10.000e+098.31SMESG000020466.1[more]
SMESG000005635.16.639e-6745.21SMESG000005635.1[more]
SMESG000043302.11.164e-6137.30SMESG000043302.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013054 ID=SMED30013054|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3643bp
GGTGTATAAACTAATACAATTTAAATTATTTAATTTTTATTATTAATTTA
TTAAAATATTAAATTTATTATTTATTAAAAGAAAATTATTTTAAATCCTT
GATGTTATGAGTTCTATTTCTGATTTTAAACGATTAAATAAAATTGGACA
AGGTGCTTTTGGAATAGCATGGCTTGTTGAATCGAAAATTGATTGTAAAA
AATATGTTTTAAAAGAAATTGGATTATATAAAATGCATGAAAAAGAGCGA
TTTGAAGCTAGAAAAGAGGTTTCTTTACTTTCAAAAATGAATCATCCAAA
TATTGTTACTTATTATAATTCTTTTGAAGAAGTCGGCTGTTTTCACATAC
TGATGGAATATTGTGAAGGCGGAGATCTTTATAGGAAAATTAAAACCCAA
AATGGGGTTTTATTCAAAGAAGATCAAGTATTGGATTATTTCATTCAAAT
TTGTCTTGCATTAAAACATATTCACGATCAAAGAATTTTGCATCGAGATA
TCAAACCGCAAAATATTTTCCTCACGAAAAATAACAGCGTAAAACTTGGT
GATTTCGGCATCGCCAAAGCCATGGACAGCACAACAGCTCTGACAAAAAC
ACAAGTTGGCACTCCATTCTATTTCTCTCCTGAAATATGTGAAGGCTGTC
CGTACAATAATAAGAGTGATATCTGGTCTTTGGGGTGTATTCTCTATGAA
TTATGTTCGTTGAATTATGCATTTTACGGACAAGACATTACTATTTTGGC
TATGAGAATTAAAAAAGTCAATTACAAACCGGTTCCCAGTGTATTTTCAG
CACCTTTGCGTGCACTTGTTGATAATATGTTTCGTCGTCGACCAGATGAG
CGTCCAAATATAAATACGATTCTGAGAAAGCCATTCATTTTGAAAAAAAT
CGACAAATTCTTGCCTCCTGAAAATCCATTATTAAATGAAACGAAAAAAC
AAATTCAAAAACGTCCATCTACTGCCAGTGTTGTAAGTCGTGTTGATTCT
GGTCTCAGTAATAAAAAGAAAGCCAGAGTGGGAAGGGATAATGCCTTGAT
AAATAGCCCATATATGCAGATTCCTAACAGGAATATACATGATAAACGAG
TGTCTCCGAGAATTGTCAAGCAAGATGCTAATCCACTTGTAGTGCGACAA
CAAGAATTGAATAATAAATACAAAGTCGAGATGATCAATGTCGATAGGGA
AAACGGTTGGAAGAACGTTCTTTCTTCTGATGATTCCAAATCAGATTGTA
AAGAATCAAAATTGAATGCAAAACTTAATGTTTATGGAATGACTCCTGCT
GCAATTAAACAAAAAATTAATTCCCCGGCTTATGACCGTTATTATGCTGA
ACTTGATCGAATAAAAGAACAACAAGTTTTGAGAGAGAATGAAGGAAGAG
CTCTAATGCAACATATGCTTAAGCAAAATGATAATAAATCTCCTGATGGT
AAATTACTGAAAGTTGGTGCTGATGGATTATATAGAAAAATTGATGCTTC
AAAGCCATACGATGAGCGGAGCAAAATGAATGAATTAGCTAGAATTCATG
GGAAGATTGGAGGAAATGCGGCAGATCAAGCTGTTATTCAAGAGTTTATT
GAACGTAAACGGCAAGCAAAAAATATTAAAAACCGAAACGGTTCTGGAAT
GGCTTTATTGATGGGAGGACATCAGTTTTGTGCTGAACAATCGCCGATTC
CAAGACAAACTCCTCGGAGTATTGAAGAAGAGACTACTGAAAGACTAAAT
AAAATAAGGCAGAAAAATTTTGAAATAAGACAAGGTATGGGATTTGAGGA
TTTTGTTAAAAATTCTGACATAGATGGAAATGGAAACTTTGAGAATTTCA
ATCAACTTGAAGCTCGCAAAGCCTTGGAAGATCTAAAAAAGAGAGTGAAA
CAAAAAACTGAAGAATTAAAGCAAAAATTGGAAAGAAAGGAAAAGGAGAG
AAATAAGGAATTGCCTTCTGTAATCGATGATGACCCCCCTAACAACGCAA
TTTTATTTCCAAAACGTCCTCCAGTTGTGGTCAATAAACCAGAAAACTCT
TCTAATGTTTCTCATCCAATAGCTGAACCAGGTATTATATCAGTTATACT
TGAAAGGATTCATGAAAATATAACCCCTGCTGGTGATGCTCCTAAAGTTG
ATAACATTGAATTACCTGAATCTTTATCAGTTATTTTAAGTCAACTAGAT
GATAAATCTCGACCTTCTACAGCTTCTTGCAGCGACCAGTCAGAAATTCG
AAAAAGAAAAGACGATATTTTGAAAAGATTAAATATGAAGTGTAATAAAG
TATCGGGTGGAGAAAAAGAAAACGAAGAAGCAAAAGAGAAAGAAACTCCT
CGGAAATCATGGATTTTCGATATGGATGAAAATAATATTTGTATAAAAAA
TAATTTAGACAACACGATTAGTGATTGTGAAACAATGGTAGACGTGAGCA
TTTTGCAGCACGATGAGGAGAAAATGAGAGGCAAGTGGCAGATCGACGAC
GAAATAACTTCCGACACGGTTGTGTTGCAAAATATTAAATTAAATCAAGA
TTCAGGTGGTTCAACTATAGTTCTTGATCAGCCGTCGATTGAAATTGATG
TCCCTAGGATCTCTGAAAGCATGAACTGTAATGAAAACTCCATTATGGAA
ATATCGAATTTGAGTACAATAATTGAAGTATCCCAAGAAATTATCGAAAT
CACATTAAATGATGATAAGAAAATAAAATCAAATTTCTTTGAAAGAGAAG
AAGTTTGGAATCAGAATGTATCAAAAGGAAACATAAAAAACCAACATCAA
CCCATATGCACACTAGAAAATAAAAAGGAAAAATCTGAAAATGAAGCACT
TGAAAAAGTAAAGAATACTCAGATTATCGGTTTAGAAGATGACATAATAA
TTACTAATATTGATGATGACGTGAGTGAAACCGCTGAAAATTCGGATATA
ATAGATTCTTCTGGGTCGGACACTGAAGATTTAATCGAGTGCTTCAAAAA
TGCTTTATCCATTGATATTTCAAATAGCAGCAGCTCTAAATCTGTTGATA
ATCTGAGTGATAAAACCATTAATATCGGGATTTTCAATGATCAGAGCAAG
ATATCAAACGCCAACTCACTGCAGAATTTAACGGAGAAACCTGTCACCAG
AATTCGTCGAACAAAGTCGTACAGTGAATTCGAAATGAATTTGAACAAAG
AATGGTCTTCTGAAGATACTTTTAGTTCAGAAGATTTTGGAGATGACGAA
ATTTCCAATCCAGGAAATATTTTCTTGAAAATAGAAAAAATTCGAGCAGA
ATTAGAAGAGAAAATCGGTATCGACTCGTTAATGGATGCGGTAGAATTTG
TTCGAGAGAATCAAGATTTGAATGGCGATCAGTTGGCGGAGAAATTAAAA
GATATGATAGGAGATGAAGCCTCCATCAACGACATTTTGCAATTAGTGGT
TCTTGAAGAACAATATCACAACATCGAATAACTTTAACAGCCTTGGGCGA
TTTAACAGATTTTTCTTTGTGCATTCGTTTCACATTTTTCCATCCTGGAG
TTAAGTTGTAAAATATTTCGAAACTACAAAACGTTCTCCCTTGTCTGGGA
AAGTTTAATAATTTTTTGTCTTGAATAAAGTCTGAATTGTGAA
back to top

protein sequence of SMED30013054-orf-1

>SMED30013054-orf-1 ID=SMED30013054-orf-1|Name=SMED30013054-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1125bp
MSSISDFKRLNKIGQGAFGIAWLVESKIDCKKYVLKEIGLYKMHEKERFE
ARKEVSLLSKMNHPNIVTYYNSFEEVGCFHILMEYCEGGDLYRKIKTQNG
VLFKEDQVLDYFIQICLALKHIHDQRILHRDIKPQNIFLTKNNSVKLGDF
GIAKAMDSTTALTKTQVGTPFYFSPEICEGCPYNNKSDIWSLGCILYELC
SLNYAFYGQDITILAMRIKKVNYKPVPSVFSAPLRALVDNMFRRRPDERP
NINTILRKPFILKKIDKFLPPENPLLNETKKQIQKRPSTASVVSRVDSGL
SNKKKARVGRDNALINSPYMQIPNRNIHDKRVSPRIVKQDANPLVVRQQE
LNNKYKVEMINVDRENGWKNVLSSDDSKSDCKESKLNAKLNVYGMTPAAI
KQKINSPAYDRYYAELDRIKEQQVLRENEGRALMQHMLKQNDNKSPDGKL
LKVGADGLYRKIDASKPYDERSKMNELARIHGKIGGNAADQAVIQEFIER
KRQAKNIKNRNGSGMALLMGGHQFCAEQSPIPRQTPRSIEEETTERLNKI
RQKNFEIRQGMGFEDFVKNSDIDGNGNFENFNQLEARKALEDLKKRVKQK
TEELKQKLERKEKERNKELPSVIDDDPPNNAILFPKRPPVVVNKPENSSN
VSHPIAEPGIISVILERIHENITPAGDAPKVDNIELPESLSVILSQLDDK
SRPSTASCSDQSEIRKRKDDILKRLNMKCNKVSGGEKENEEAKEKETPRK
SWIFDMDENNICIKNNLDNTISDCETMVDVSILQHDEEKMRGKWQIDDEI
TSDTVVLQNIKLNQDSGGSTIVLDQPSIEIDVPRISESMNCNENSIMEIS
NLSTIIEVSQEIIEITLNDDKKIKSNFFEREEVWNQNVSKGNIKNQHQPI
CTLENKKEKSENEALEKVKNTQIIGLEDDIIITNIDDDVSETAENSDIID
SSGSDTEDLIECFKNALSIDISNSSSSKSVDNLSDKTINIGIFNDQSKIS
NANSLQNLTEKPVTRIRRTKSYSEFEMNLNKEWSSEDTFSSEDFGDDEIS
NPGNIFLKIEKIRAELEEKIGIDSLMDAVEFVRENQDLNGDQLAEKLKDM
IGDEASINDILQLVVLEEQYHNIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
IPR013809ENTH
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 583..618
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 86..295
e-value: 1.2E-58
score: 199.8
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 1..85
e-value: 2.5E-25
score: 90.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 286..305
NoneNo IPR availablePANTHERPTHR44899FAMILY NOT NAMEDcoord: 6..898
NoneNo IPR availableCDDcd08215STKc_Nekcoord: 6..261
e-value: 7.00589E-142
score: 425.338
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 7..261
e-value: 1.0E-90
score: 317.3
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 7..261
e-value: 1.2E-63
score: 215.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 7..261
score: 48.258
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 13..36
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 127..139
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 4..281