RING-type domain-containing protein

Overview
NameRING-type domain-containing protein
Smed IDSMED30013035
Length (bp)2077
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RING-type domain-containing protein (SMED30013035) t-SNE clustered cells

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30013035) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RING-type domain-containing protein (SMED30013035) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RING-type domain-containing protein (SMED30013035) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013035

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30013035h1SMcG0000554 dd_Smed_v4_4025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013035h1SMcG0000554 dd_Smed_v4_4025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013035h1SMcG0000554 dd_Smed_v4_4025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013035h1SMcG0000554 dd_Smed_v4_4025_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013035h1SMcG0000554 dd_Smed_v4_4025_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30013035h1SMcG0000554 dd_Smed_v4_4025_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RNF31 (ring finger protein 31 [Source:HGNC Symbol;Acc:HGNC:16031])

HSP 1 Score: 213.386 bits (542), Expect = 3.970e-58
Identity = 139/434 (32.03%), Postives = 212/434 (48.85%), Query Frame = 2
Query:  656 RFLMTEMDLQSHG----PLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHY-----AQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGK---PEKMCQLMITNE---QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
            R L+    L S G     L LL+E  R+  LG+ +       +V+ H   +A + ++        L + C +C +  P   M+   +C+  +C DC  Q     ++ K      CP C   +  +  + L Y      QL++ L  +     +F  KL +  LM+   F WCA   C+ GF  E    +  CP C    CV+C R W+E H  ++C++F+ W   NDP      L+  L + GI+CP C   YALA GGC+HF C  C  +FC GCY  F   NKC +PNC +  ++H HHPR+CL++LRD+T   L+K+L+D    F+     G    P   C+++   E    L++ AC K+   G   LC+ HYKEYLV  IN + +DPA   +  +L     + +  R      E   A++ R+ +K+ E
Sbjct:  490 RRLLAVYALPSWGRAELALSLLQETPRNYELGDVVE------AVR-HSQDRAFLRRL--------LAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDA--YALFHKKLTEGVLMRDPKFLWCAQ--CSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTE 904          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RNF31 (ring finger protein 31 [Source:HGNC Symbol;Acc:HGNC:16031])

HSP 1 Score: 213.386 bits (542), Expect = 3.970e-58
Identity = 139/434 (32.03%), Postives = 212/434 (48.85%), Query Frame = 2
Query:  656 RFLMTEMDLQSHG----PLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHY-----AQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGK---PEKMCQLMITNE---QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
            R L+    L S G     L LL+E  R+  LG+ +       +V+ H   +A + ++        L + C +C +  P   M+   +C+  +C DC  Q     ++ K      CP C   +  +  + L Y      QL++ L  +     +F  KL +  LM+   F WCA   C+ GF  E    +  CP C    CV+C R W+E H  ++C++F+ W   NDP      L+  L + GI+CP C   YALA GGC+HF C  C  +FC GCY  F   NKC +PNC +  ++H HHPR+CL++LRD+T   L+K+L+D    F+     G    P   C+++   E    L++ AC K+   G   LC+ HYKEYLV  IN + +DPA   +  +L     + +  R      E   A++ R+ +K+ E
Sbjct:  490 RRLLAVYALPSWGRAELALSLLQETPRNYELGDVVE------AVR-HSQDRAFLRRL--------LAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDA--YALFHKKLTEGVLMRDPKFLWCAQ--CSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTE 904          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RNF31 (ring finger protein 31 [Source:HGNC Symbol;Acc:HGNC:16031])

HSP 1 Score: 213.386 bits (542), Expect = 4.678e-58
Identity = 139/434 (32.03%), Postives = 212/434 (48.85%), Query Frame = 2
Query:  656 RFLMTEMDLQSHG----PLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHY-----AQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGK---PEKMCQLMITNE---QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
            R L+    L S G     L LL+E  R+  LG+ +       +V+ H   +A + ++        L + C +C +  P   M+   +C+  +C DC  Q     ++ K      CP C   +  +  + L Y      QL++ L  +     +F  KL +  LM+   F WCA   C+ GF  E    +  CP C    CV+C R W+E H  ++C++F+ W   NDP      L+  L + GI+CP C   YALA GGC+HF C  C  +FC GCY  F   NKC +PNC +  ++H HHPR+CL++LRD+T   L+K+L+D    F+     G    P   C+++   E    L++ AC K+   G   LC+ HYKEYLV  IN + +DPA   +  +L     + +  R      E   A++ R+ +K+ E
Sbjct:  494 RRLLAVYALPSWGRAELALSLLQETPRNYELGDVVE------AVR-HSQDRAFLRRL--------LAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDA--YALFHKKLTEGVLMRDPKFLWCAQ--CSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTE 908          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: RNF31 (ring finger protein 31 [Source:HGNC Symbol;Acc:HGNC:16031])

HSP 1 Score: 213.386 bits (542), Expect = 4.678e-58
Identity = 139/434 (32.03%), Postives = 212/434 (48.85%), Query Frame = 2
Query:  656 RFLMTEMDLQSHG----PLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHY-----AQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGK---PEKMCQLMITNE---QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
            R L+    L S G     L LL+E  R+  LG+ +       +V+ H   +A + ++        L + C +C +  P   M+   +C+  +C DC  Q     ++ K      CP C   +  +  + L Y      QL++ L  +     +F  KL +  LM+   F WCA   C+ GF  E    +  CP C    CV+C R W+E H  ++C++F+ W   NDP      L+  L + GI+CP C   YALA GGC+HF C  C  +FC GCY  F   NKC +PNC +  ++H HHPR+CL++LRD+T   L+K+L+D    F+     G    P   C+++   E    L++ AC K+   G   LC+ HYKEYLV  IN + +DPA   +  +L     + +  R      E   A++ R+ +K+ E
Sbjct:  494 RRLLAVYALPSWGRAELALSLLQETPRNYELGDVVE------AVR-HSQDRAFLRRL--------LAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDA--YALFHKKLTEGVLMRDPKFLWCAQ--CSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTE 908          
BLAST of RING-type domain-containing protein vs. Ensembl Human
Match: AL136295.10 (novel transcript)

HSP 1 Score: 214.157 bits (544), Expect = 4.786e-58
Identity = 139/434 (32.03%), Postives = 212/434 (48.85%), Query Frame = 2
Query:  656 RFLMTEMDLQSHG----PLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHY-----AQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGK---PEKMCQLMITNE---QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
            R L+    L S G     L LL+E  R+  LG+ +       +V+ H   +A + ++        L + C +C +  P   M+   +C+  +C DC  Q     ++ K      CP C   +  +  + L Y      QL++ L  +     +F  KL +  LM+   F WCA   C+ GF  E    +  CP C    CV+C R W+E H  ++C++F+ W   NDP      L+  L + GI+CP C   YALA GGC+HF C  C  +FC GCY  F   NKC +PNC +  ++H HHPR+CL++LRD+T   L+K+L+D    F+     G    P   C+++   E    L++ AC K+   G   LC+ HYKEYLV  IN + +DPA   +  +L     + +  R      E   A++ R+ +K+ E
Sbjct:  645 RRLLAVYALPSWGRAELALSLLQETPRNYELGDVVE------AVR-HSQDRAFLRRL--------LAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDA--YALFHKKLTEGVLMRDPKFLWCAQ--CSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTE 1059          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: Y49F6B.9 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A8DJA7])

HSP 1 Score: 70.0922 bits (170), Expect = 1.723e-12
Identity = 64/248 (25.81%), Postives = 99/248 (39.92%), Query Frame = 2
Query:  821 DGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETI---EVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF-----DAEGIDKIIC--PSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLSKLL-NDIGIE-CPNC-TMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYF 1525
             GAM    K CE+C    P       I C+H  C+ C+ +++  +I    V+ PC   CP             +H   +  +L  N  LI+ +ES  ++  L +  +  WC    C  GF     + +   +I C  P C  + C KC ++W E    +TC        K    L K+  ND+    CP C T+      G C H  C  CG +FC  C +            + ++H   P  C ++
Sbjct:   35 SGAM----KECELCCEMVPAGAFCQLINCRHVYCRICIRKYMELSILGNRVEIPCPGGCP-----------AVIHPNDVTRYLLPNTDLISKYESFSIRMALCRIQDVRWCPAPDC--GFAVIVPNGQKCPRIKCQRPGCGREFCFKCRKVWHEG--TRTCS-------KTFEQLKKITENDVSAHPCPRCKTLIVKENDGSCNHMHCTLCGAEFCWLCLK-----------EINDLHYMSPTGCTFW 245          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: Y49F6B.9 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A8DJA7])

HSP 1 Score: 70.0922 bits (170), Expect = 1.723e-12
Identity = 64/248 (25.81%), Postives = 99/248 (39.92%), Query Frame = 2
Query:  821 DGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETI---EVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF-----DAEGIDKIIC--PSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLSKLL-NDIGIE-CPNC-TMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYF 1525
             GAM    K CE+C    P       I C+H  C+ C+ +++  +I    V+ PC   CP             +H   +  +L  N  LI+ +ES  ++  L +  +  WC    C  GF     + +   +I C  P C  + C KC ++W E    +TC        K    L K+  ND+    CP C T+      G C H  C  CG +FC  C +            + ++H   P  C ++
Sbjct:   35 SGAM----KECELCCEMVPAGAFCQLINCRHVYCRICIRKYMELSILGNRVEIPCPGGCP-----------AVIHPNDVTRYLLPNTDLISKYESFSIRMALCRIQDVRWCPAPDC--GFAVIVPNGQKCPRIKCQRPGCGREFCFKCRKVWHEG--TRTCS-------KTFEQLKKITENDVSAHPCPRCKTLIVKENDGSCNHMHCTLCGAEFCWLCLK-----------EINDLHYMSPTGCTFW 245          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: Y49F6B.9 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A8DJA7])

HSP 1 Score: 69.3218 bits (168), Expect = 2.764e-12
Identity = 59/214 (27.57%), Postives = 90/214 (42.06%), Query Frame = 2
Query:  845 KSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETI---EVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF-----DAEGIDKIIC--PSCKTQMCVKCNRMWKEAHENKTCQE-FELWMLKNDPNLSKLL-NDIGIE-CPNC-TMRYALAPGGCIHFDCKACGTKFCGGCYQ 1444
            K CE+C    P       I C+H  C+ C+ +++  +I    V+ PC   CP             +H   +  +L  N  LI+ +ES  ++  L +  +  WC    C  GF     + +   +I C  P C  + C KC ++W E    +TC + FE         L K+  ND+    CP C T+      G C H  C  CG +FC  C +
Sbjct:    2 KECELCCEMVPAGAFCQLINCRHVYCRICIRKYMELSILGNRVEIPCPGGCP-----------AVIHPNDVTRYLLPNTDLISKYESFSIRMALCRIQDVRWCPAPDC--GFAVIVPNGQKCPRIKCQRPGCGREFCFKCRKVWHEG--TRTCSKTFE--------QLKKITENDVSAHPCPRCKTLIVKENDGSCNHMHCTLCGAEFCWLCLK 192          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: C17H11.6 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A0A0K3AYH3])

HSP 1 Score: 59.6918 bits (143), Expect = 5.452e-9
Identity = 63/252 (25.00%), Postives = 94/252 (37.30%), Query Frame = 2
Query:  851 CEICSFDYP---IPEMRGFITCQHELCKDCMSQWLAETI---EVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDA---EGIDKIIC--PSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNL---------------SKLLNDIGIECPNC-TMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYF 1525
            C +C+   P    P+++G   CQH  C+ C+ Q++  +I    V+ P    CP C        +  LH   +K  + D  +LI  +E+  L+  LM   +  WC    C   F A       ++ C  P C T  C  C R W   H N+TC E      +    L               S L       CP C T    +  G C H  C  C  +FC  C +            + ++H   P  C ++
Sbjct:   85 CPLCAAKMPGSAFPKLKG---CQHRSCRACLRQYVELSITENRVEVP----CPEC--------SSYLHPNDIKMLIGDIPTLIEKYEAFSLRRYLMTEADARWCPAPDCGFVFIATKCAACPQLKCQRPDCGTLFCYHCKREW---HSNQTCDEARRPEKRKSRGLAFEEIMRTGFHQSADSTLKPGDVKACPRCKTYIVKMDDGSCNHMVCTMCNAEFCWLCLK-----------EISDLHYLSPTGCTFW 307          
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Match: C17H11.6 (RBR-type E3 ubiquitin transferase [Source:UniProtKB/TrEMBL;Acc:A0A0K3AYH3])

HSP 1 Score: 59.6918 bits (143), Expect = 5.452e-9
Identity = 63/252 (25.00%), Postives = 94/252 (37.30%), Query Frame = 2
Query:  851 CEICSFDYP---IPEMRGFITCQHELCKDCMSQWLAETI---EVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDA---EGIDKIIC--PSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNL---------------SKLLNDIGIECPNC-TMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYF 1525
            C +C+   P    P+++G   CQH  C+ C+ Q++  +I    V+ P    CP C        +  LH   +K  + D  +LI  +E+  L+  LM   +  WC    C   F A       ++ C  P C T  C  C R W   H N+TC E      +    L               S L       CP C T    +  G C H  C  C  +FC  C +            + ++H   P  C ++
Sbjct:   85 CPLCAAKMPGSAFPKLKG---CQHRSCRACLRQYVELSITENRVEVP----CPEC--------SSYLHPNDIKMLIGDIPTLIEKYEAFSLRRYLMTEADARWCPAPDCGFVFIATKCAACPQLKCQRPDCGTLFCYHCKREW---HSNQTCDEARRPEKRKSRGLAFEEIMRTGFHQSADSTLKPGDVKACPRCKTYIVKMDDGSCNHMVCTMCNAEFCWLCLK-----------EISDLHYLSPTGCTFW 307          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: LUBEL (gene:FBgn0031857 transcript:FBtr0331221)

HSP 1 Score: 192.971 bits (489), Expect = 6.892e-51
Identity = 115/351 (32.76%), Postives = 169/351 (48.15%), Query Frame = 2
Query:  818 IDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCP----------DDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDK-IICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLS-----KLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPN-CHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGKPEK----------MCQLMITNEQ---LKEAACNKDVCGTTA-LCEQHYKEYLVQFINRYKIDPADFVD 1759
            +D A+  L++ CE+C   YP+ +M   + C H+ CK C   +    I  +     SCP C           +D ++    NL    LK  L ++V    +F+ KL    L++  NF WC    C++GF A    K +ICP C +  C +C + W+  HE  +C+ +  W  +NDP L      + L   GI+CP C  RY+LA GGC+HF C  C  +FC GC + F+   KC     C  + +H+HHPRNCL++LRD     L+ +LK+    FD   +Q K E            C + +  E    L +  CN +V    A +C  HY EYL   + +  IDP    D
Sbjct: 2409 LDQAIAMLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIF-LKSILDNDVH--ELFQRKLRDRSLLQDPNFKWCIQ--CSSGFFARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLAQNGIDCPKCKFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVSTYCAKLGLHAHHPRNCLFYLRDKIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKARAQARCPIPLQKETPQGLVDTVCNTEVPDKHAGMCRTHYVEYLAGKVAKAGIDPLPIFD 2754          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: LUBEL (gene:FBgn0031857 transcript:FBtr0331218)

HSP 1 Score: 192.971 bits (489), Expect = 6.989e-51
Identity = 115/351 (32.76%), Postives = 169/351 (48.15%), Query Frame = 2
Query:  818 IDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCP----------DDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDK-IICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLS-----KLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPN-CHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGKPEK----------MCQLMITNEQ---LKEAACNKDVCGTTA-LCEQHYKEYLVQFINRYKIDPADFVD 1759
            +D A+  L++ CE+C   YP+ +M   + C H+ CK C   +    I  +     SCP C           +D ++    NL    LK  L ++V    +F+ KL    L++  NF WC    C++GF A    K +ICP C +  C +C + W+  HE  +C+ +  W  +NDP L      + L   GI+CP C  RY+LA GGC+HF C  C  +FC GC + F+   KC     C  + +H+HHPRNCL++LRD     L+ +LK+    FD   +Q K E            C + +  E    L +  CN +V    A +C  HY EYL   + +  IDP    D
Sbjct: 2462 LDQAIAMLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIF-LKSILDNDVH--ELFQRKLRDRSLLQDPNFKWCIQ--CSSGFFARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLAQNGIDCPKCKFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVSTYCAKLGLHAHHPRNCLFYLRDKIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKARAQARCPIPLQKETPQGLVDTVCNTEVPDKHAGMCRTHYVEYLAGKVAKAGIDPLPIFD 2807          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: LUBEL (gene:FBgn0031857 transcript:FBtr0331220)

HSP 1 Score: 192.586 bits (488), Expect = 7.242e-51
Identity = 115/351 (32.76%), Postives = 169/351 (48.15%), Query Frame = 2
Query:  818 IDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCP----------DDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDK-IICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLS-----KLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPN-CHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGKPEK----------MCQLMITNEQ---LKEAACNKDVCGTTA-LCEQHYKEYLVQFINRYKIDPADFVD 1759
            +D A+  L++ CE+C   YP+ +M   + C H+ CK C   +    I  +     SCP C           +D ++    NL    LK  L ++V    +F+ KL    L++  NF WC    C++GF A    K +ICP C +  C +C + W+  HE  +C+ +  W  +NDP L      + L   GI+CP C  RY+LA GGC+HF C  C  +FC GC + F+   KC     C  + +H+HHPRNCL++LRD     L+ +LK+    FD   +Q K E            C + +  E    L +  CN +V    A +C  HY EYL   + +  IDP    D
Sbjct: 2450 LDQAIAMLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIF-LKSILDNDVH--ELFQRKLRDRSLLQDPNFKWCIQ--CSSGFFARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLAQNGIDCPKCKFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVSTYCAKLGLHAHHPRNCLFYLRDKIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKARAQARCPIPLQKETPQGLVDTVCNTEVPDKHAGMCRTHYVEYLAGKVAKAGIDPLPIFD 2795          
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Match: LUBEL (gene:FBgn0031857 transcript:FBtr0331216)

HSP 1 Score: 192.586 bits (488), Expect = 7.275e-51
Identity = 115/351 (32.76%), Postives = 169/351 (48.15%), Query Frame = 2
Query:  818 IDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCP----------DDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDK-IICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLS-----KLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPN-CHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGKPEK----------MCQLMITNEQ---LKEAACNKDVCGTTA-LCEQHYKEYLVQFINRYKIDPADFVD 1759
            +D A+  L++ CE+C   YP+ +M   + C H+ CK C   +    I  +     SCP C           +D ++    NL    LK  L ++V    +F+ KL    L++  NF WC    C++GF A    K +ICP C +  C +C + W+  HE  +C+ +  W  +NDP L      + L   GI+CP C  RY+LA GGC+HF C  C  +FC GC + F+   KC     C  + +H+HHPRNCL++LRD     L+ +LK+    FD   +Q K E            C + +  E    L +  CN +V    A +C  HY EYL   + +  IDP    D
Sbjct: 2503 LDQAIAMLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIF-LKSILDNDVH--ELFQRKLRDRSLLQDPNFKWCIQ--CSSGFFARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLAQNGIDCPKCKFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVSTYCAKLGLHAHHPRNCLFYLRDKIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKARAQARCPIPLQKETPQGLVDTVCNTEVPDKHAGMCRTHYVEYLAGKVAKAGIDPLPIFD 2848          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: FO834800.1 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:100334178])

HSP 1 Score: 175.252 bits (443), Expect = 3.171e-45
Identity = 105/316 (33.23%), Postives = 155/316 (49.05%), Query Frame = 2
Query:  656 RFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCC--PDDN---YINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF--DAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLK 1567
            R L+   DL S G  +L+   +RD           P  +  L  + QA+ +    D     L K C IC   +P  +MR   +CQ  +C  C  Q     +  K      CP C  PD N   ++N   +    QL+D L   V    +F  KL ++ L+K   F WC++  C+ GF  D + + K+ C  C+   C +C + W+  H   +C++F+LW  +NDP      L+  L D GI CPNC  +YALA GGC+HF C  C  +FC GC   F   C    C +  +H+HHPR+CL++LRD+    L+ +L+
Sbjct:  633 RRLLAVFDLPSWGRCELILSLLRD-----------PAANYTLEDVVQAVRESPDRDFIRRVLNKECPICLSVFPHSKMRSLTSCQCSVCCGCFQQHFTIAVRDKHIRDMVCPVCTEPDINDPEHLNSYFSTLDIQLRDCLEQEV--YELFHKKLTEQALIKDPKFLWCSH--CSYGFIYDDDQL-KVTCSQCRKSFCAQCKKTWEPQHMGLSCEQFQLWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALARGGCMHFSCSQCRYQFCSGCNNPFHTTCAVNQCTVTGLHAHHPRDCLFYLRDWEPARLQALLQ 932          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-181m9.8 (si:dkey-181m9.8 [Source:ZFIN;Acc:ZDB-GENE-070912-399])

HSP 1 Score: 169.088 bits (427), Expect = 4.259e-44
Identity = 114/379 (30.08%), Postives = 173/379 (45.65%), Query Frame = 2
Query:  818 IDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCC--PDDNYINVNKNLHY-----AQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLF--VNKCN-KPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDY-------PK--LQGKPEKMCQLMITNE--QLKEAACNKDVCGT-TALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
            +  A+ +L   C IC        M     C    C+ C  ++ +  I+ K      CP C  PD         + Y      Q++ +L   +    +F+ KL    L +  NF WCA+  C  G   E    ++ CPSC    C KC R W   HE  +C++F+ W   N P      L +LL+   I+CP C  R+ LA GGC+HF C  C  +FCGGC Q F   + CN    C    +H+HHPRNCLY LRD++   L  +L+ +         PK  +    + +C +M   E   +KE AC +      +  C  HYKE LV+ IN   +DP   +D  +L   + +  +    +   E +  + +R+++ +KE
Sbjct:  207 LPSALKYLCHDCPICQEQVSFNRMVTMTHCSCTFCESCFKKYFSSVIKEKNIVHAVCPLCNLPDVRGGRREDTMEYFSLLDTQIRYYLDSQIH--ELFQRKLRDRALQEMPNFRWCAH--CCFGLLHEADRLRMDCPSCGKSTCFKCKRPWAPQHEGISCEKFKEWEQLNSPEYQNSRLEQLLSRNKIDCPKCKFRFFLARGGCLHFRCTQCQHEFCGGCSQPFKQGSTCNFSIECAAKGLHAHHPRNCLYHLRDWSVPRLRTLLQRYGVSHPLMFSPKHPMGRHSKGICGVMEFQETGAVKEEACGRQAFPEYSGYCTLHYKEVLVELINSNGLDPVVLLDGAELRAEMDRWKVPLPERHPLEPDQRYDDRLRQILKE 581          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: FO834800.2 (E3 ubiquitin-protein ligase RNF31-like [Source:NCBI gene;Acc:108179742])

HSP 1 Score: 151.369 bits (381), Expect = 6.825e-41
Identity = 85/239 (35.56%), Postives = 125/239 (52.30%), Query Frame = 2
Query:  887 MRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCC--PDDN---YINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF--DAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLK 1567
            MR   +CQ  +C  C  Q     +  K      CP C  PD N   ++N   +    QL+D L   V    +F  KL ++ L+K   F WC++  C+ GF  D + + K+ C  C+   C +C + W+  H   +C++F+LW  +NDP      L+  L D GI CPNC  +YALA GGC+HF C  C  +FC GC   F   C    C +  +H+HHPR+CL++LRD+    L+ +L+
Sbjct:    1 MRSLTSCQCSVCCGCFQQHFTIAVRDKHIRDMVCPVCTEPDINDPEHLNSYFSTLDIQLRDCLEQEV--YELFHKKLTEQALIKDPKFLWCSH--CSYGFIYDDDQL-KVTCSQCRKSFCAQCKKTWEPQHMGLSCEQFQLWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALARGGCMHFSCSQCRYQFCSGCNNPFHTTCAVNQCTVTGLHAHHPRDCLFYLRDWEPARLQALLQ 234          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-278j3.3 (si:ch211-278j3.3 [Source:ZFIN;Acc:ZDB-GENE-041014-147])

HSP 1 Score: 60.077 bits (144), Expect = 6.943e-9
Identity = 58/250 (23.20%), Postives = 93/250 (37.20%), Query Frame = 2
Query:  851 CEICSFDYPIPEMRGFITCQHELCKDCMSQWL-AETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICP-------SCKTQMCVKCNRMWKEAHENKTCQEFE---------------LWMLKNDPNLSKLLNDIGIECPNCTMRYALAP--GGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYF 1525
            C +C    P        +CQH  C DC+ Q+L  E  E +     +CP CP+         L    ++  L D  +L+  FE   L+  L    +  WC    C+    A G  +  CP        C+T+ C  C ++W   H ++TC +                 L++   +P  ++ +      CP C   Y +    G C   +C  C  +FC  C Q            + +VH   P  C ++
Sbjct:  112 CPLCLLSQPRAHFPRLSSCQHRACTDCLRQYLRIEISESRV--GIACPQCPE--------ALALPDVRAILDDG-ALLERFEEFQLRRFLAADPDTRWCPAPDCSYAVIAYGCAE--CPKLSCGREGCETEFCYHCRQLW---HPDQTCDQARRQRARHTSGANDVSTLYVFNEEPGDAEEIKP----CPRCGA-YIMKTNDGSCNRMNCTVCACQFCWLCMQ-----------EITDVHYLSPSGCTFW 329          
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Match: rnf19a (ring finger protein 19A, RBR E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-030131-9414])

HSP 1 Score: 53.1434 bits (126), Expect = 9.980e-7
Identity = 52/198 (26.26%), Postives = 75/198 (37.88%), Query Frame = 2
Query:  896 FITCQHELCKDCMSQWLA-ETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEAC---TNGFDAEGIDKIICP--SCKTQMCVKCNRMWKEAHENKTC-------------QEFELWMLKNDPNLSKLLNDIGIECPNCTMR-YALAPGGCIHFDCKACGTKFC 1429
             +TC H  C DC+ Q+L  E  E +     SCP C        ++  +   ++  L D V L+  +E  +L+  L+   +  WC    C      F      KI C    C T+ C  C ++W   H N+TC             + F    L          +DI   CP C      +  G C H  C  CG +FC
Sbjct:  214 IMTCHHRSCADCLRQYLRIEISESRV--NISCPEC--------SERFNPHDIRMILNDRV-LMEKYEEFMLRRWLVADPDCRWCPAPDCGYAVIAFGCASCPKITCGRDGCGTEFCYHCKQLW---HPNQTCDAARQQRAQSLRLRPFRSSSLSYSQESGAAADDI-KPCPRCAAYIIKMNDGSCNHMTCAVCGCEFC 396          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: rnf31 (ring finger protein 31 [Source:NCBI gene;Acc:100036616])

HSP 1 Score: 211.846 bits (538), Expect = 1.548e-57
Identity = 131/404 (32.43%), Postives = 206/404 (50.99%), Query Frame = 2
Query:  704 LLREFMRDMSLGEYLRQECP-------DGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFL---TDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF--DAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLF--VNKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNEQLKEAACNKDVC-GTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERV 1852
            +LR  + + SL  + R E         +G  +L  + +A+ +    D     L + C +C ++ P  +MR   +C+  +C DC        ++ K      CP C +    +  + LHY    D L   T  V   ++F  KL +  LMK   F WC +  C+ GF  + + +D + CP C+   C KC R W+E H +  C +F+ W  +ND       L+  L + GI CP+C   YALA GGC+HF C  C  +FC GCY  F   NKC  P+C + M++H+HHPR+CL++LRD+  T L+++L+     +++G    M Q  I +  L++ AC K    G   LCE HYKEYLV  IN + +DP    D  +   +  + +    +++  E EA+++ER+
Sbjct:  508 VLRRLLAEHSLHSWGRAELALSLLIEGEGRYELQDVVEAVRESQDRDFIKRMLTQECAVCGWELPRNKMRSLTSCECCICPDCFRMHFTVAVKEKHIRDMICPACEEPEISDEGELLHYFSTLDILLRDTLEVDAYDLFHKKLTERTLMKDPKFLWCTH--CSFGFIYERDQLD-VKCPQCQCSFCRKCKRPWEEQHRSLNCDDFQNWKRENDAEYQAQGLAVYLLENGITCPHCKFSYALARGGCMHFICSQCRHQFCSGCYNTFHQRNKCTVPSCTVRMSLHAHHPRDCLFYLRDWDVTRLQRLLQVSKLSEVKGGCRVMEQKEIPD-GLRDEACGKITPPGYAGLCESHYKEYLVSRINAHSLDPCVLYDLAETMNVCQRYLPVLPLQDPTENEASYRERL 907          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: rnf31 (ring finger protein 31 [Source:NCBI gene;Acc:100036616])

HSP 1 Score: 211.846 bits (538), Expect = 1.658e-57
Identity = 131/404 (32.43%), Postives = 206/404 (50.99%), Query Frame = 2
Query:  704 LLREFMRDMSLGEYLRQECP-------DGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFL---TDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF--DAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLF--VNKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNEQLKEAACNK-DVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERV 1852
            +LR  + + SL  + R E         +G  +L  + +A+ +    D     L + C +C ++ P  +MR   +C+  +C DC        ++ K      CP C +    +  + LHY    D L   T  V   ++F  KL +  LMK   F WC +  C+ GF  + + +D + CP C+   C KC R W+E H +  C +F+ W  +ND       L+  L + GI CP+C   YALA GGC+HF C  C  +FC GCY  F   NKC  P+C + M++H+HHPR+CL++LRD+  T L+++L+     +++G    M Q  I +  L++ AC K    G   LCE HYKEYLV  IN + +DP    D  +   +  + +    +++  E EA+++ER+
Sbjct:  504 VLRRLLAEHSLHSWGRAELALSLLIEGEGRYELQDVVEAVRESQDRDFIKRMLTQECAVCGWELPRNKMRSLTSCECCICPDCFRMHFTVAVKEKHIRDMICPACEEPEISDEGELLHYFSTLDILLRDTLEVDAYDLFHKKLTERTLMKDPKFLWCTH--CSFGFIYERDQLD-VKCPQCQCSFCRKCKRPWEEQHRSLNCDDFQNWKRENDAEYQAQGLAVYLLENGITCPHCKFSYALARGGCMHFICSQCRHQFCSGCYNTFHQRNKCTVPSCTVRMSLHAHHPRDCLFYLRDWDVTRLQRLLQVSKLSEVKGGCRVMEQKEIPD-GLRDEACGKITPPGYAGLCESHYKEYLVSRINAHSLDPCVLYDLAETMNVCQRYLPVLPLQDPTENEASYRERL 903          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: rnf31 (ring finger protein 31 [Source:NCBI gene;Acc:100036616])

HSP 1 Score: 211.846 bits (538), Expect = 2.222e-57
Identity = 131/404 (32.43%), Postives = 206/404 (50.99%), Query Frame = 2
Query:  704 LLREFMRDMSLGEYLRQECP-------DGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFL---TDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF--DAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLF--VNKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNEQLKEAACNK-DVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERV 1852
            +LR  + + SL  + R E         +G  +L  + +A+ +    D     L + C +C ++ P  +MR   +C+  +C DC        ++ K      CP C +    +  + LHY    D L   T  V   ++F  KL +  LMK   F WC +  C+ GF  + + +D + CP C+   C KC R W+E H +  C +F+ W  +ND       L+  L + GI CP+C   YALA GGC+HF C  C  +FC GCY  F   NKC  P+C + M++H+HHPR+CL++LRD+  T L+++L+     +++G    M Q  I +  L++ AC K    G   LCE HYKEYLV  IN + +DP    D  +   +  + +    +++  E EA+++ER+
Sbjct:  558 VLRRLLAEHSLHSWGRAELALSLLIEGEGRYELQDVVEAVRESQDRDFIKRMLTQECAVCGWELPRNKMRSLTSCECCICPDCFRMHFTVAVKEKHIRDMICPACEEPEISDEGELLHYFSTLDILLRDTLEVDAYDLFHKKLTERTLMKDPKFLWCTH--CSFGFIYERDQLD-VKCPQCQCSFCRKCKRPWEEQHRSLNCDDFQNWKRENDAEYQAQGLAVYLLENGITCPHCKFSYALARGGCMHFICSQCRHQFCSGCYNTFHQRNKCTVPSCTVRMSLHAHHPRDCLFYLRDWDVTRLQRLLQVSKLSEVKGGCRVMEQKEIPD-GLRDEACGKITPPGYAGLCESHYKEYLVSRINAHSLDPCVLYDLAETMNVCQRYLPVLPLQDPTENEASYRERL 957          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: rnf31 (ring finger protein 31 [Source:NCBI gene;Acc:100036616])

HSP 1 Score: 211.46 bits (537), Expect = 2.526e-57
Identity = 131/407 (32.19%), Postives = 207/407 (50.86%), Query Frame = 2
Query:  704 LLREFMRDMSLGEYLRQECP-------DGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFL---TDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF--DAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLF--VNKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNE---QLKEAACNK-DVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERV 1852
            +LR  + + SL  + R E         +G  +L  + +A+ +    D     L + C +C ++ P  +MR   +C+  +C DC        ++ K      CP C +    +  + LHY    D L   T  V   ++F  KL +  LMK   F WC +  C+ GF  + + +D + CP C+   C KC R W+E H +  C +F+ W  +ND       L+  L + GI CP+C   YALA GGC+HF C  C  +FC GCY  F   NKC  P+C + M++H+HHPR+CL++LRD+  T L+++L+     +++G     C++M   E    L++ AC K    G   LCE HYKEYLV  IN + +DP    D  +   +  + +    +++  E EA+++ER+
Sbjct:  557 VLRRLLAEHSLHSWGRAELALSLLIEGEGRYELQDVVEAVRESQDRDFIKRMLTQECAVCGWELPRNKMRSLTSCECCICPDCFRMHFTVAVKEKHIRDMICPACEEPEISDEGELLHYFSTLDILLRDTLEVDAYDLFHKKLTERTLMKDPKFLWCTH--CSFGFIYERDQLD-VKCPQCQCSFCRKCKRPWEEQHRSLNCDDFQNWKRENDAEYQAQGLAVYLLENGITCPHCKFSYALARGGCMHFICSQCRHQFCSGCYNTFHQRNKCTVPSCTVRMSLHAHHPRDCLFYLRDWDVTRLQRLLQVSKLSEVKGTLLCGCRVMEQKEIPDGLRDEACGKITPPGYAGLCESHYKEYLVSRINAHSLDPCVLYDLAETMNVCQRYLPVLPLQDPTENEASYRERL 960          
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Match: rnf31 (ring finger protein 31 [Source:NCBI gene;Acc:100036616])

HSP 1 Score: 203.756 bits (517), Expect = 1.015e-54
Identity = 134/414 (32.37%), Postives = 208/414 (50.24%), Query Frame = 2
Query:  704 LLREFMRDMSLGEYLRQECP-------DGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFL---TDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF--DAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLF--VNKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLK------DFDYPK-LQGKPEKMCQLMITNE---QLKEAACNK-DVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERV 1852
            +LR  + + SL  + R E         +G  +L  + +A+ +    D     L + C +C ++ P  +MR   +C+  +C DC        ++ K      CP C +    +  + LHY    D L   T  V   ++F  KL +  LMK   F WC +  C+ GF  + + +D + CP C+   C KC R W+E H +  C +F+ W  +ND       L+  L + GI CP+C   YALA GGC+HF C  C  +FC GCY  F   NKC  P+C + M++H+HHPR+CL++LRD+  T L+++L+      + D P   Q  P   C++M   E    L++ AC K    G   LCE HYKEYLV  IN + +DP    D  +   +  + +    +++  E EA+++ER+
Sbjct:  519 VLRRLLAEHSLHSWGRAELALSLLIEGEGRYELQDVVEAVRESQDRDFIKRMLTQECAVCGWELPRNKMRSLTSCECCICPDCFRMHFTVAVKEKHIRDMICPACEEPEISDEGELLHYFSTLDILLRDTLEVDAYDLFHKKLTERTLMKDPKFLWCTH--CSFGFIYERDQLD-VKCPQCQCSFCRKCKRPWEEQHRSLNCDDFQNWKRENDAEYQAQGLAVYLLENGITCPHCKFSYALARGGCMHFICSQCRHQFCSGCYNTFHQRNKCTVPSCTVRMSLHAHHPRDCLFYLRDWDVTRLQRLLQMLLVQFNTDPPAGTQTAPGGGCRVMEQKEIPDGLRDEACGKITPPGYAGLCESHYKEYLVSRINAHSLDPCVLYDLAETMNVCQRYLPVLPLQDPTENEASYRERL 929          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf31 (ring finger protein 31 [Source:MGI Symbol;Acc:MGI:1934704])

HSP 1 Score: 211.846 bits (538), Expect = 2.091e-57
Identity = 123/371 (33.15%), Postives = 185/371 (49.87%), Query Frame = 2
Query:  833 NFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHY-----AQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGK---PEKMCQLMITNE---QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
              L + C +C +  P   M+  I+C+  +C +C  Q     ++ K      CP C   +  +  + L Y      QL++ L  +     +F  KL +  LM+   F WCA   C+ GF  E    +  CP C    CV+C R W+E H  ++C++F+ W   NDP      L+  L + GI+CP C   YALA GGC+HF C  C  +FC GCY  F   NKC  PNC +  ++H HHPR+CL++LRD+T   L+K+L+D    F+     G    P   C++M   E     ++ AC K+   G   LC+ HYKEYLV  IN + +DPA   +  +L     + +         E   A++ R+ +K++E
Sbjct:  687 RLLAQECAVCGWALPRNRMQALISCECTICPECFRQHFTIALKEKHITDMVCPACGRPDLTDDAQLLSYFSTLDIQLRESLDPDA--YALFHKKLTEAVLMRDPKFLWCAQ--CSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRTNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPDPNCKVKKSLHGHHPRDCLFYLRDWTAARLQKLLQDNNVMFNTEPPAGTRAVPGGGCRVMEQKEVHSGFRDEACGKETPPGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATIRYLHLAPQPADGEDLPAYQARLLQKLRE 1053          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf31 (ring finger protein 31 [Source:MGI Symbol;Acc:MGI:1934704])

HSP 1 Score: 210.305 bits (534), Expect = 2.981e-57
Identity = 123/371 (33.15%), Postives = 185/371 (49.87%), Query Frame = 2
Query:  833 NFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHY-----AQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGK---PEKMCQLMITNE---QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
              L + C +C +  P   M+  I+C+  +C +C  Q     ++ K      CP C   +  +  + L Y      QL++ L  +     +F  KL +  LM+   F WCA   C+ GF  E    +  CP C    CV+C R W+E H  ++C++F+ W   NDP      L+  L + GI+CP C   YALA GGC+HF C  C  +FC GCY  F   NKC  PNC +  ++H HHPR+CL++LRD+T   L+K+L+D    F+     G    P   C++M   E     ++ AC K+   G   LC+ HYKEYLV  IN + +DPA   +  +L     + +         E   A++ R+ +K++E
Sbjct:  533 RLLAQECAVCGWALPRNRMQALISCECTICPECFRQHFTIALKEKHITDMVCPACGRPDLTDDAQLLSYFSTLDIQLRESLDPDA--YALFHKKLTEAVLMRDPKFLWCAQ--CSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRTNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPDPNCKVKKSLHGHHPRDCLFYLRDWTAARLQKLLQDNNVMFNTEPPAGTRAVPGGGCRVMEQKEVHSGFRDEACGKETPPGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATIRYLHLAPQPADGEDLPAYQARLLQKLRE 899          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf31 (ring finger protein 31 [Source:MGI Symbol;Acc:MGI:1934704])

HSP 1 Score: 90.1225 bits (222), Expect = 2.972e-21
Identity = 42/81 (51.85%), Postives = 55/81 (67.90%), Query Frame = 2
Query: 1337 GIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKD 1570
            GI+CP C   YALA GGC+HF C  C  +FC GCY  F   NKC  PNC +  ++H HHPR+CL++LRD+T   L+K+L+ 
Sbjct:    2 GIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPDPNCKVKKSLHGHHPRDCLFYLRDWTAARLQKLLQG 82          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf19b (ring finger protein 19B [Source:MGI Symbol;Acc:MGI:1922484])

HSP 1 Score: 56.6102 bits (135), Expect = 8.683e-8
Identity = 55/212 (25.94%), Postives = 86/212 (40.57%), Query Frame = 2
Query:  851 CEICSFDYPIPEMRGFITCQHELCKDCMSQWLA-ETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEG---IDKIIC--PSCKTQMCVKCNRMWKEAHENKTC----QEFELWMLKNDPNLSKL--------LNDIGIECPNCTMR-YALAPGGCIHFDCKACGTKFC 1429
            C +C    P       ++C H  C+DC+  +L  E  E + P   SCP C        ++ L+   ++  L D   L++ +E  +L+  L    +  WC    C     A G     K+ C    C+T+ C  C ++W   H N+TC    Q+    +     + S L         +DI   CP C+     +  G C H  C  CG +FC
Sbjct:  116 CPLCLVRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRVPI--SCPEC--------SERLNPHDIRLLLADP-PLMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASCPKLTCEREGCQTEFCYHCKQIW---HPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPADDIK-PCPRCSAYIIKMNDGSCNHMTCAVCGCEFC 312          
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Match: Rnf19b (ring finger protein 19B [Source:MGI Symbol;Acc:MGI:1922484])

HSP 1 Score: 56.6102 bits (135), Expect = 9.215e-8
Identity = 55/211 (26.07%), Postives = 86/211 (40.76%), Query Frame = 2
Query:  851 CEICSFDYPIPEMRGFITCQHELCKDCMSQWLA-ETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEG---IDKIIC--PSCKTQMCVKCNRMWKEAHENKTC----QEFELWMLKNDPNLSKL-------LNDIGIECPNCTMR-YALAPGGCIHFDCKACGTKFC 1429
            C +C    P       ++C H  C+DC+  +L  E  E + P   SCP C        ++ L+   ++  L D   L++ +E  +L+  L    +  WC    C     A G     K+ C    C+T+ C  C ++W   H N+TC    Q+    +     + S L        +DI   CP C+     +  G C H  C  CG +FC
Sbjct:  116 CPLCLVRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRVPI--SCPEC--------SERLNPHDIRLLLADP-PLMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASCPKLTCEREGCQTEFCYHCKQIW---HPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPDDIK-PCPRCSAYIIKMNDGSCNHMTCAVCGCEFC 311          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96EP0|RNF31_HUMAN (E3 ubiquitin-protein ligase RNF31 OS=Homo sapiens OX=9606 GN=RNF31 PE=1 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 2.299e-57
Identity = 139/434 (32.03%), Postives = 212/434 (48.85%), Query Frame = 2
Query:  656 RFLMTEMDLQSHG----PLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHY-----AQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGK---PEKMCQLMITNE---QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
            R L+    L S G     L LL+E  R+  LG+ +       +V+ H   +A + ++        L + C +C +  P   M+   +C+  +C DC  Q     ++ K      CP C   +  +  + L Y      QL++ L  +     +F  KL +  LM+   F WCA   C+ GF  E    +  CP C    CV+C R W+E H  ++C++F+ W   NDP      L+  L + GI+CP C   YALA GGC+HF C  C  +FC GCY  F   NKC +PNC +  ++H HHPR+CL++LRD+T   L+K+L+D    F+     G    P   C+++   E    L++ AC K+   G   LC+ HYKEYLV  IN + +DPA   +  +L     + +  R      E   A++ R+ +K+ E
Sbjct:  645 RRLLAVYALPSWGRAELALSLLQETPRNYELGDVVE------AVR-HSQDRAFLRRL--------LAQECAVCGWALPHNRMQALTSCECTICPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDA--YALFHKKLTEGVLMRDPKFLWCAQ--CSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRMNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPEPNCRVKKSLHGHHPRDCLFYLRDWTALRLQKLLQDNNVMFNTEPPAGARAVPGGGCRVIEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATERYLHVRPQPLAGEDPPAYQARLLQKLTE 1059          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q924T7|RNF31_MOUSE (E3 ubiquitin-protein ligase RNF31 OS=Mus musculus OX=10090 GN=Rnf31 PE=1 SV=2)

HSP 1 Score: 211.846 bits (538), Expect = 1.463e-56
Identity = 123/371 (33.15%), Postives = 185/371 (49.87%), Query Frame = 2
Query:  833 NFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHY-----AQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPNCHM-MNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGK---PEKMCQLMITNE---QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
              L + C +C +  P   M+  I+C+  +C +C  Q     ++ K      CP C   +  +  + L Y      QL++ L  +     +F  KL +  LM+   F WCA   C+ GF  E    +  CP C    CV+C R W+E H  ++C++F+ W   NDP      L+  L + GI+CP C   YALA GGC+HF C  C  +FC GCY  F   NKC  PNC +  ++H HHPR+CL++LRD+T   L+K+L+D    F+     G    P   C++M   E     ++ AC K+   G   LC+ HYKEYLV  IN + +DPA   +  +L     + +         E   A++ R+ +K++E
Sbjct:  687 RLLAQECAVCGWALPRNRMQALISCECTICPECFRQHFTIALKEKHITDMVCPACGRPDLTDDAQLLSYFSTLDIQLRESLDPDA--YALFHKKLTEAVLMRDPKFLWCAQ--CSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRTNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPDPNCKVKKSLHGHHPRDCLFYLRDWTAARLQKLLQDNNVMFNTEPPAGTRAVPGGGCRVMEQKEVHSGFRDEACGKETPPGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATIRYLHLAPQPADGEDLPAYQARLLQKLRE 1053          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IPJ3|LUBEL_DROME (E3 ubiquitin-protein ligase lubel OS=Drosophila melanogaster OX=7227 GN=LUBEL PE=1 SV=2)

HSP 1 Score: 192.586 bits (488), Expect = 7.293e-50
Identity = 115/351 (32.76%), Postives = 169/351 (48.15%), Query Frame = 2
Query:  818 IDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCP----------DDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDK-IICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLS-----KLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNKPN-CHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGKPEK----------MCQLMITNEQ---LKEAACNKDVCGTTA-LCEQHYKEYLVQFINRYKIDPADFVD 1759
            +D A+  L++ CE+C   YP+ +M   + C H+ CK C   +    I  +     SCP C           +D ++    NL    LK  L ++V    +F+ KL    L++  NF WC    C++GF A    K +ICP C +  C +C + W+  HE  +C+ +  W  +NDP L      + L   GI+CP C  RY+LA GGC+HF C  C  +FC GC + F+   KC     C  + +H+HHPRNCL++LRD     L+ +LK+    FD   +Q K E            C + +  E    L +  CN +V    A +C  HY EYL   + +  IDP    D
Sbjct: 2503 LDQAIAMLQQECELCMNSYPMNQMVSMLKCLHKCCKQCAKSYFTVQITDRSINDCSCPFCKLPELSNEAQHEDEHLEYFSNLDIF-LKSILDNDVH--ELFQRKLRDRSLLQDPNFKWCIQ--CSSGFFARPKQKRLICPDCGSVTCAQCRKPWERQHEGSSCEAYLEWKRENDPELQAQGVQEHLAQNGIDCPKCKFRYSLARGGCMHFTCTQCKFEFCYGCARPFMMGAKCTVSTYCAKLGLHAHHPRNCLFYLRDKIPLQLQFLLKEQNVKFDTEPMQIKDESSSSSKARAQARCPIPLQKETPQGLVDTVCNTEVPDKHAGMCRTHYVEYLAGKVAKAGIDPLPIFD 2848          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IWT3|CUL9_HUMAN (Cullin-9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=2)

HSP 1 Score: 61.2326 bits (147), Expect = 3.215e-8
Identity = 54/218 (24.77%), Postives = 77/218 (35.32%), Query Frame = 2
Query:  899 ITCQHELCKDCMSQWLAETIEVKFPCKWSCPCC-----PDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPS---CKTQMCVKC------NRMWKEAHENKTCQEFELWM--------LKNDPNLSKLLNDIGIECPNCTMRYALAP----GGCIHFDCKACGTKFCGGCYQLFVNKCNKPN 1474
            + C H  CK C +++L   IE       +CP       P   +I              +  +  +I+ +E  LL+  +    N  WC N         +G D+I+C     C T  C KC      N  + EAH   +C     W+        +  +     L   I   CP+C      AP     GC+H  C  C   FC  C      K  KPN
Sbjct: 2086 LCCMHYCCKSCWNEYLTTRIEQNLVLNCTCPIADCPAQPTGAFIRA------------IVSSPEVISKYEKALLRGYVESCSNLTWCTN--------PQGCDRILCRQGLGCGT-TCSKCGWASCFNCSFPEAHYPASCGHMSQWVDDGGYYDGMSVEAQSKHLAKLISKRCPSCQ-----APIEKNEGCLHMTCAKCNHGFCWRCL-----KSWKPN 2272          
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6ZMZ0|RN19B_HUMAN (E3 ubiquitin-protein ligase RNF19B OS=Homo sapiens OX=9606 GN=RNF19B PE=1 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 5.386e-7
Identity = 56/227 (24.67%), Postives = 91/227 (40.09%), Query Frame = 2
Query:  806 DQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLA-ETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEG---IDKIIC--PSCKTQMCVKCNRMWKEAHENKTC----QEFELWMLKNDPNLSKL--------LNDIGIECPNCTMR-YALAPGGCIHFDCKACGTKFC 1429
            ++ +  G     +  C +C    P       ++C H  C+DC+  +L  E  E + P   SCP C        ++ L+   ++  L D   L++ +E  +L+  L    +  WC    C     A G     K+ C    C+T+ C  C ++W   H N+TC    Q+    +     + S L         +DI   CP C+     +  G C H  C  CG +FC
Sbjct:  104 EEAAEGGGPGAEEVECPLCLVRLPPERAPRLLSCPHRSCRDCLRHYLRLEISESRVPI--SCPEC--------SERLNPHDIRLLLADP-PLMHKYEEFMLRRYLASDPDCRWCPAPDCGYAVIAYGCASCPKLTCEREGCQTEFCYHCKQIW---HPNQTCDMARQQRAQTLRVRTKHTSGLSYGQESGPADDI-KPCPRCSAYIIKMNDGSCNHMTCAVCGCEFC 315          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A1Z5L4B1 (RING-type domain-containing protein (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 2.577e-63
Identity = 127/346 (36.71%), Postives = 186/346 (53.76%), Query Frame = 2
Query:  815 SIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNV---SLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDK-IICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPN-----LSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLF--VNKCNK-PNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDY-----PKLQGKPEKMCQLMITNEQLKEAACNKDVCG------TTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLML 1783
            SI  A+NFL+  CE+C+ +YPI +M   + C H+ CK+CM  +    I  +   +  CP C + +  + +  L+Y    D L  ++      ++F+ KL    LMK  NF WC+   C++GF      K ++CP C    C  C ++W++ HEN TC++F+ W+  NDP+     +++ L D GI+CPNC  +Y+LA GGC+HF C  C   FC GC Q F    KC + P C    +H+HHPRNCL++LRD    DL K+L + D      P     P K+CQ  +  ++   A    D+CG      T  LC +HY EYL Q I R  +DP    D  +L L+L
Sbjct:   29 SIYQAVNFLQHECELCAANYPISQMISLLNCVHKACKECMKAYFTIQIRDRNIMELLCPFCNEPDLSDEDVELNYFNNLDILLKSLVEEEYYDLFQRKLRDRALMKDPNFRWCSQ--CSSGFITYPDQKRLVCPDCHAVTCALCRKVWQKQHENITCEQFQDWLDANDPDNQAEGITRYLEDNGIDCPNCKFKYSLARGGCMHFKCYQCSFDFCCGCNQPFKMGEKCGRTPACARYGLHAHHPRNCLFYLRDKEIADLRKLLMEKDVAFNTDPPPHWSPTKLCQ--VPEQKETSAGLRDDICGRDVEDDTAGLCRKHYVEYLGQLIFRNHVDPLPVFDIDELELVL 370          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A2T7NIC0 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19059 PE=4 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 6.226e-62
Identity = 155/468 (33.12%), Postives = 243/468 (51.92%), Query Frame = 2
Query:  572 ESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMT--EMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGS---VKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCC--PDDN-------YINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID---KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPN-----LSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNK--CNK-PNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKDFD-----YPKLQGKPEKMCQLMITNE---QLKEAACNKDVC-GTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKES 1873
            +S  + + + +D  + +   D   D E+R  M   E  L+S G  +L+ + +       Y  Q   +G      L  + +A+ +      A+ +L + C+IC   YP+ ++R    CQ ++C DC+ Q     I  K    W+CP C  PD N       YIN    L   Q+   + D      +FE+K+    L K  +F WCA+  C NGF A+G D   K++CP C  + C +C + W+E HE  TC++F  W + NDPN     L++ L + GI+CP+C MRYALA GGC+HF C  CG +FC GC Q F  +  CN+  NC M  +H+HHPR+C ++LRD     L+ +L++ +      P    +    C ++   E     ++ +C KD   G   LC  HYKEYLV  IN+  IDPA  ++  +L  +L +  ++   ++ NE+ AA+ +R+ K+V+E+
Sbjct: 1374 QSVSTSVISHEDFQQRV--KDKTLDRERRIRMVLVEGKLRSWGRAELVIKLLDHDLPAAYSSQGITNGEDYYCTLEDVVEAVRNCEDKRSALVYLMQECQICFSHYPMSKIRNLNFCQCKICSDCLKQNFEVVIREKHVRHWTCPLCSKPDLNDEELGSEYINFLGMLLQMQVDKEVYD------LFETKVRDWHLQKDPHFRWCAH--CGNGFIADGGDRQLKMVCPHCSQKTCYQCKKQWEEQHEGVTCEQFAQWKIDNDPNNQAVGLARHLEENGIDCPSCKMRYALAKGGCMHFKCPQCGHEFCSGCCQPFYQRGMCNRLKNCKMNGLHAHHPRDCFFYLRDCDVQHLQVLLQNANVEFNTVPPANQEETSRCPVIEQKEFDSGKRDESCGKDSGDGLAGLCLLHYKEYLVGLINKNNIDPAMSMNIEELRKVLARGEMNVPKQKHNESSAAYHKRIIKEVEET 1831          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: C3XU40 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_121963 PE=4 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 3.106e-60
Identity = 131/391 (33.50%), Postives = 203/391 (51.92%), Query Frame = 2
Query:  794 QAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCP------DDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF---DAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPN-----LSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNK-PNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKD--FDY----PKLQGKPEK-------MCQLM---ITNEQLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
            +A+   + ++    +L+  C++C+   P  ++     C  E+C  CM Q+   TI  K      CP C       D++  +   NL    LK+ L D+V    +F+ KL    LM+  NF WC+N  C++G      E   +++C  C    C KC + W++ HEN TC++F+ W   NDP      L+ +LND GI+CPNC  RYALA GGC+HF C  C  +FC GCY  F + C +  +C    +H+HHPR+CL+++RD     L+++L+D   DY    P    +  +        C++M    TN+ L++  C  D   G   LC  HY EYLV  IN +KIDP   +DS +L  +L +        ++ E E AF +R+ ++V++
Sbjct: 1237 EAVRSCLGLESCKKYLQHECQVCTDVLPQHKLLVLTHCSCEVCVSCMKQYFTITIRDKNIKDMICPVCSQPDLDDDEDAESEFFNLLDIMLKNILDDDVH--ELFQQKLRDRTLMRLPNFRWCSN--CSSGMINDQPEQRLRMLCADCGRSTCYKCKKPWEDQHENVTCEQFQEWKELNDPEFQAAGLAAILNDCGIDCPNCKFRYALAKGGCMHFKCVQCKHEFCSGCYNTFRHNCTRFASCARKGLHAHHPRDCLFYMRDRDPIQLQRLLQDNGIDYDTEPPAAAAQTAEDNEAGGSRCKVMEQKETNDGLRDDFCGLDAPAGYAGLCRLHYIEYLVGLINAHKIDPVVIMDSDELRALLLREEKQVPQPQRREGERAFWQRLVQEVQQ 1623          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A067R5D9 (RING finger protein 31 OS=Zootermopsis nevadensis OX=136037 GN=L798_07494 PE=4 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 2.617e-59
Identity = 132/381 (34.65%), Postives = 197/381 (51.71%), Query Frame = 2
Query:  815 SIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQ-----LKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDK-IICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPN-----LSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCNK-PNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDY---PKLQGKP---EKM-CQLMITNEQ---LKEAACNKDVC-GTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
            +++ A++FL++ CE+C+  YP+ +M   + C H  CK+C   +    I  +      CP C +    N ++ L Y       LK FL   V    +F+ KL    LM+  NF WC    C++GF A    K ++CP C++  C  C R W++ HE  TC++F  W   NDP      L+K L + GI+CP C   Y+LA GGC+HF C  C  +FC GC + F    KC+  PNC  + +H+HHPRNCL++LRD   T L+ +LK+    FD    P L+ +    EK+ C + +  E    + +  C +D+  G   LC  HY EYLV  I R+K+DP    D   +   L +  +    KE N T+  ++    K V+E
Sbjct: 1845 NLNTALSFLQQECELCTGKYPMKQMVSMLKCTHCCCKECAKNYYTIQITDRNINDAVCPFCKEPEMQNDDEALEYFSNLDILLKSFLDPAVH--ELFQRKLRDRTLMQDPNFKWCVK--CSSGFIANPRQKRLVCPDCRSVTCASCRRPWEKQHEGITCEKFAEWKEANDPEIQAAGLAKHLAEHGIDCPKCKFSYSLARGGCMHFTCSQCKYEFCCGCGKTFTMGAKCSMGPNCAKLGLHAHHPRNCLFYLRDKEPTQLQTLLKEHNISFDTELPPNLKTQEQNGEKLKCLVQLQRETPAGVIDTVCKEDIAEGQAGLCRLHYIEYLVGLIARHKVDPISIFDLTDVQQELRRRGMALPAKEANTTDDEYRILCAKVVQE 2221          
BLAST of RING-type domain-containing protein vs. TrEMBL
Match: A0A2J7PUT1 (RING-type domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G05255 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 6.682e-59
Identity = 138/423 (32.62%), Postives = 206/423 (48.70%), Query Frame = 2
Query:  710 REFMRDMSLGEYLRQECPDGSVKLHHLK-------QAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQ-----LKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDK-IICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPN-----LSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCN-KPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLK------DFDYP-----KLQGKPEKMCQLMITNEQ---LKEAACNKDVC-GTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
            R+  R ++ G     E  + +VKL  LK        A  +  +++ A++FL++ CE+C+  YP+ +M   + C H  CKDC   +    I  +      CP C +    + ++ L Y       LK FL   +    +F+ KL    LM+  NF WC    C +GF A    K ++CP C++  C  C R W++ HE  TC++F  W   NDP      L+K L + GI+CP C  RY+LA GGCIHF C  C  +FC GC + F    KC   PNC  + +H+HHPRNC+++LRD     L+++LK      D + P     + Q      C + +  E    + +  CN D   G   LC QHY EYLV  I R+K+DP    D   +   + +  +    K  N T+  ++    K V+E
Sbjct: 1986 RQVRRFLAEGLVKTYEQAELAVKLMDLKFEQDEALNAAQECSTLNAALSFLQQECELCTGKYPMKQMVSMLKCIHCCCKDCAKNYFTIQITDRNINDAVCPFCKEPEMQDDDEALEYFSNLDILLKSFLDPPIH--ELFQRKLRDRTLMQDPNFKWCVK--CCSGFIANPRQKRLVCPDCRSVTCASCRRPWEKQHEGITCEKFAEWKEANDPEIQAAGLAKHLAEHGIDCPKCKFRYSLARGGCIHFTCSQCKHEFCCGCGKTFTMGAKCTVGPNCAKLGLHAHHPRNCIFYLRDKEPAQLQELLKEHNIAFDTELPTNLKTQEQNGETLKCLVQVQKETPAGMIDTVCNGDTAEGQAGLCRQHYTEYLVGLIARHKVDPISIFDLTDIQQEIRRRGMALPAKGANTTDDEYRILCAKVVQE 2404          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000014446.2 (ring finger protein 31 [Source:NCBI gene;Acc:103030581])

HSP 1 Score: 210.305 bits (534), Expect = 5.477e-57
Identity = 131/424 (30.90%), Postives = 203/424 (47.88%), Query Frame = 2
Query:  656 RFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCC--PDDN---YINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGKPEKMCQLMITNEQ---LKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
            R L+   DL S G  +L+   +RD           P     L  + QA+ +    D     L K C IC   +P  +M+   +CQ  +C  C  Q     +  K      CP C  PD N   ++N   +    QL++ +   V    +F  KL ++ L+K   F WC++  C+ GF  +G   K+ C  C+   C +C + W+  H   +C++F+LW  +NDP      L+  L D GI CPNC  +YALA GGC+HF C  C  +FC GC   F   C    C +  +H+HHPR+CL++LRD+    L+ +L+     ++     G    +C ++   ++     ++AC      G   LCE+HY+EYLV  IN + IDPA    S +L L   +  +D   + + E +  +  R+ KK+ E
Sbjct:  645 RRLLAVYDLPSWGRCELVLSLLRD-----------PAAPYTLEDVVQAVRESHDRDFIRRVLAKECPICLSVFPHSKMQSLTSCQCSVCSGCFKQHFTIAVRDKHIRDMVCPVCWEPDINNPEHLNSYFSTLDIQLRECVEPEV--YELFHKKLTEQALIKDPKFLWCSH--CSYGFIYDGDQLKVTCLQCRNSFCAQCKKPWEAQHNGLSCEQFQLWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALARGGCMHFSCSQCRYQFCSGCNNPFHTTCAVAQCSVTGLHAHHPRDCLFYLRDWEPARLQALLQKNGVAYNTDTAPGTQTGVCGVIEQKDEGPRQTDSACGAQTQPGQAGLCEKHYREYLVSLINGHSIDPAPLFSSNELVLACKRYQVDH-ARGEGEDDRPYCSRLMKKLME 1052          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000018785.2 (E3 ubiquitin-protein ligase RNF31-like [Source:NCBI gene;Acc:103042649])

HSP 1 Score: 197.978 bits (502), Expect = 7.923e-53
Identity = 123/355 (34.65%), Postives = 177/355 (49.86%), Query Frame = 2
Query:  761 PDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSL--------INIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNK-CNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLK----DFDYPKLQGKPEKMCQLMITNE--QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVD 1759
            PD    +  + QA+ +    D     LKK C+IC   +P  +M+    CQ  +C +C  Q     +  K      CP C ++  IN  + L       F T +V L         ++F  KL++  L K   F WC +  CTNGF  E  + K+ C +C+   C KC + W++ HE  TC +F+ W  +NDP      L   L + GI+CP+C  +YALA GGC+HF C  C  +FC GC   F  K C    C     H+HHPR+CLY+LRD+    L+ +L+    +F+     G    +C +M   E  Q  + AC   V  G   LC++HY+EYLV  IN + +DPAD +D
Sbjct:  651 PDAEYSVEDVIQAVREHHDKDFINRILKKECQICYASFPQRKMQALTFCQCSMCSECFIQHFTVALRDKHIRDMVCPVC-EEPEINDPEALETY----FFTLDVQLRLNLEPEVYDLFGKKLMEHTLKKDPKFLWCCH--CTNGFIYEKDELKVTCQNCRKSFCSKCKKAWEDQHEGLTCNDFQKWKRENDPEYQKQGLVGFLRENGIKCPSCKFQYALAKGGCMHFTCSQCRYEFCCGCNNPFHKKPCPGNQCISKGFHAHHPRDCLYYLRDWEPVRLQALLQKHKVEFNTDHPDGTGNGLCGVMEQKEGGQALDDACGIQVEEGHAGLCDKHYREYLVSLINAHSLDPADLMD 998          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-181m9.8 (E3 ubiquitin-protein ligase RNF31-like [Source:NCBI gene;Acc:103040600])

HSP 1 Score: 154.451 bits (389), Expect = 1.141e-38
Identity = 107/398 (26.88%), Postives = 172/398 (43.22%), Query Frame = 2
Query:  818 IDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNK--------NLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVN--KCN-KPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLK--DFDYP--------KLQGKPEKMCQLMITNEQLKEAACNKDVCGTTAL------CEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYIPKGLVAAE 1912
            +  A+ +L   C IC       +M     C    C+ C   + +  I+ K      CP C   +     +        +L   Q++ +L        +F+ KL  + L +  NF WCA+  C+ G   E    ++ CP+C    C  C   W   HE  +C++F+ W   N P      L  LL+   I+CP C  R+ L+ GGC+HF C  C  +FCGGC + F N   CN    C    +H+HHPR+CLY LRD+    L  +L+     +P         + G    +C +    E  +  +  ++ CG  AL      C  HYKE LV+ I +  +DP       +L   L +  I    K+  E++  + +R+++ + +      P    A++
Sbjct:  446 LPSALKYLSHDCPICQEQMSFGKMITMTHCSCTFCESCFKAYFSSVIKEKSIVHAVCPMCNQPDVRGAGRREESMEYFSLLDTQIRHYLDPQTH--ELFQRKLRDQALQEMPNFRWCAH--CSFGLLHEADRLRMDCPNCGKSTCFNCKSPWASQHEGLSCEKFKEWQQLNSPEYQNSRLELLLSRNKIDCPKCRFRFFLSKGGCLHFKCTQCQHEFCGGCSRPFRNGSACNFSAECGTKGLHAHHPRDCLYHLRDWDVARLCSLLQHHGVAHPLIYSQRDGSVLGSQRVVCAVF---EHKELGSPREEPCGRVALPEYNGYCTLHYKECLVELIKQNGLDPVVLFTEPELRAELDRWKIPVPEKQPPESDRLYSDRLRQILVQRVGLTRPSAAAASQ 836          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-278j3.3 (E3 ubiquitin-protein ligase RNF19B-like [Source:NCBI gene;Acc:103027424])

HSP 1 Score: 53.9138 bits (128), Expect = 5.063e-7
Identity = 58/249 (23.29%), Postives = 91/249 (36.55%), Query Frame = 2
Query:  851 CEICSFDYPIPEMRGFITCQHELCKDCMSQWLA-ETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICP-------SCKTQMCVKCNRMWKEAHENKTCQEFE--------------LWMLKNDPNLSKLLNDIGIECPNCTMRYALAP--GGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYF 1525
            C +C    P        +C H  C DC+ Q+L  E  E +     +CP CP+         L    ++  L D+ +L+  FE   L+  L    +  WC    C+    A G  +  CP        C T+ C  C ++W   H ++TC +                L++   +P       +I   CP C   Y +    G C   +C  C  +FC  C Q            + +VH   P  C ++
Sbjct:  111 CPLCLLSQPRGHFPRLSSCPHRACADCLRQYLRIEISESRV--GIACPQCPE--------ALAPPDVRAIL-DDGALLERFEEFQLRRFLASDPDTRWCPAPDCSYAVIAYGCAE--CPKLSCGREGCDTEFCYHCRQLW---HPDQTCDQARRQRARHTSGADASTLYVFSEEPGGDA--EEIKA-CPRCGA-YIMKTNDGSCNRMNCTVCACQFCWLCMQ-----------EITDVHYLSPSGCTFW 328          
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Match: rnf19a (ring finger protein 19A, RBR E3 ubiquitin protein ligase [Source:NCBI gene;Acc:103022576])

HSP 1 Score: 52.7582 bits (125), Expect = 1.092e-6
Identity = 53/198 (26.77%), Postives = 76/198 (38.38%), Query Frame = 2
Query:  896 FITCQHELCKDCMSQWLA-ETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEG---IDKIICP--SCKTQMCVKCNRMWKEAHENKTC-------------QEFELWMLKNDPNLSKLLNDIGIECPNCTMR-YALAPGGCIHFDCKACGTKFC 1429
             +TC H  C DC+ Q+L  E  E +     SCP C        ++  +   ++  L D V L+  +E  +L+  L+   +  WC    C     A G     KI C    C T+ C  C ++W   H N+TC             + F    L          +DI   CP C      +  G C H  C  CG +FC
Sbjct:  213 IMTCHHRSCADCLRQYLRIEISESRV--NISCPEC--------SERFNPHDIRMILGDRV-LMEKYEEFMLRRWLVADPDCRWCPAPDCGYAVIAFGCASCPKITCGRDGCGTEFCYHCKQLW---HPNQTCDAARQQRAQSLRLRPFRSSSLSYSQESGAAADDI-KPCPRCAAYIIKMNDGSCNHMTCAVCGCEFC 395          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006434.1 (pep scaffold:Pmarinus_7.0:GL492086:439:5313:1 gene:ENSPMAG00000005812.1 transcript:ENSPMAT00000006434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.724 bits (330), Expect = 6.184e-35
Identity = 72/194 (37.11%), Postives = 102/194 (52.58%), Query Frame = 2
Query: 1043 QLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCY----QLFVNKCNKP------NCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKDFD 1576
            Q +++L   V    +FE+K+    L    NF WCA+  C NG   + +  ++ C  C    C KC + W+  HE  TC+ F  W L NDP      L+  L + GI CP C  RYALA GGC+HF C  C  +FC GCY    +  V++   P       C  M +H+HHPR+CL++LRD+    L+ +L D +
Sbjct:    1 QFRNYLDPEV--FRLFENKMRDRALYMMPNFRWCAH--CPNGSIHDALRLRMDCTYCNKSTCSKCKKPWEVQHEGLTCEAFHTWKLDNDPEMQAAGLAAFLKENGIACPKCKFRYALAKGGCMHFTCGQCKHEFCSGCYNPAAERSVHRDVNPESECGMGCTHMGLHAHHPRDCLHYLRDWDIARLQALLTDHN 190          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007741.1 (pep scaffold:Pmarinus_7.0:GL477427:676:25209:1 gene:ENSPMAG00000006996.1 transcript:ENSPMAT00000007741.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 1.764e-11
Identity = 54/224 (24.11%), Postives = 85/224 (37.95%), Query Frame = 2
Query:  821 DGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPC--CPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCAN-EACTNGF--DAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWM--------LKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV 1453
            DGA    + +C IC       E+   + C H  CK C   +L  +I+     K +CP   CP             A ++  + D+   + +++  LL+  +    N  WCAN + C      D  G     C  C    C  C+ +  EAH   +C +   W+        + +D     L   I   CP+C  +      GC+H  C  C   FC  C + + 
Sbjct: 1383 DGAAADQQPTCPICLGVTGEVELLAPLYCTHRCCKSCWRAYLKTSIDQNMLAKCTCPIMDCPAQPT--------GAFIRTMMEDDSDRLELYKRALLRGYVESCSNLAWCANPQGCDRVLCKDGTGGHAATCAKCHWSTCFSCSFL--EAHCPASCNQIAWWVDEGGYYEGMSSDALSKHLAKLISKPCPSCHAQIE-KNEGCLHMTCAKCNHSFCWRCLKAWA 1595          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006333.1 (pep scaffold:Pmarinus_7.0:GL479789:448:31336:-1 gene:ENSPMAG00000005679.1 transcript:ENSPMAT00000006333.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 5.441e-10
Identity = 52/222 (23.42%), Postives = 79/222 (35.59%), Query Frame = 2
Query:  848 SCEIC---SFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCC------PDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEA------CTNGFDAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLK-------NDPNLSKLLND-IGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQ 1444
            +C +C   + D+  P     + C+H  CK C  ++L+  +E        CP        P D   ++ + + +A  +            +   L++  +    N  WC N        CT+     G     C  C    C  CN +  EAH   +C     WM         N   LSK L   I   CP+C  +      GC+H  C  C   FC  C +
Sbjct: 1991 TCPVCLLTTVDHIAP-----LCCRHSCCKSCWREYLSMRVEQNMVTNCKCPISECLAQPPPDFIRSILECMRFAPPQ------------YNRGLVRCYVESCTNLTWCTNPQGCDRILCTDSIGHAG----TCAKCHWSSCFSCNFL--EAHYPASCGHMSQWMDDGGYYEGMNSEALSKHLAKLISKRCPSCQAQIE-KNEGCLHMTCAKCNHGFCWRCLK 2188          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: rnf19a (ring finger protein 19A, RBR E3 ubiquitin protein ligase [Source:ZFIN;Acc:ZDB-GENE-030131-9414])

HSP 1 Score: 53.5286 bits (127), Expect = 1.187e-7
Identity = 51/198 (25.76%), Postives = 76/198 (38.38%), Query Frame = 2
Query:  896 FITCQHELCKDCMSQWL-AETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICP-------SCKTQMCVKCNRMWKEAHENKTC-----QEFELWMLKNDPNLSKLLNDIGI------ECPNCTMRY-ALAPGGCIHFDCKACGTKFC 1429
             ++C H  C DC+ Q+L  E  E +        CCP+       + L+   ++  L D  +L+  +E  +L+  L+   +  WC    C  GF         CP        C T+ C  C  MW   H N+TC     Q      L++  + S   +  G        CP C      +  G C H  C  CG +FC
Sbjct:  125 LLSCPHRSCLDCLRQYLRIEISESRVNI-----CCPE-----CAERLNPHDIQRILAD-ATLMGKYEEFMLRRFLVADPDCRWCPAPDC--GFAVIATGCASCPKLTCEREGCGTEFCYHCKAMW---HPNQTCDAARQQRSATLRLRSIQSASASYSQDGAHADDIKPCPRCAAYIMKMNDGSCNHMTCAVCGCEFC 306          
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Match: RBCK1 (RANBP2-type and C3HC4-type zinc finger containing 1 [Source:HGNC Symbol;Acc:HGNC:15864])

HSP 1 Score: 50.8322 bits (120), Expect = 7.754e-7
Identity = 50/208 (24.04%), Postives = 83/208 (39.90%), Query Frame = 2
Query:  848 SCEICSFDYPIPEMRGFITCQHELCKDCMSQWLA--ETIEVKFPCKWSCPCCPD-DNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWM-LKNDPNLSKLLNDI----------GIECPNCTMRYALAPGGCIHFDCKACGTKFC 1429
            +C IC  DY   E      C H  CKDC+   +   E  EV          CP+ D  I+    LH  ++K  +++ V         L   +   +D++H    +     F  + ++  +CP CK   C+ C    K  HE   CQE++  + L++D + + +  ++           + CP C +       GC    C  C T+ C
Sbjct:  291 TCPICFVDYEPGEGVTLRECLHNFCKDCLHGTIVNCEDAEVT---------CPNQDGEISCEFKLHQREIKALVSE-VEYCRFLGKGLAIAENRSADSYHCVTADCLGWCFYEDMVNDFLCPICKKSNCLTC----KAIHEGMDCQEYQDDLKLRSDNDQAAMQTNLMLQTMVQTGDAMHCPTCKV-IVQKKDGCDWICCSICKTEIC 483          
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Match: EDO46475 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ03])

HSP 1 Score: 209.149 bits (531), Expect = 3.533e-57
Identity = 128/370 (34.59%), Postives = 188/370 (50.81%), Query Frame = 2
Query:  797 AMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPD-----DNYINVNKNLHYAQLKDFL----TDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF--DAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCN---KPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKD----FDYPKLQGKPEKMCQLMITNEQLKE-AACNKDVC-GTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETE 1831
            A  D   ++ +  FL++ C +C    P   M   + CQ   C DC+SQ++ + I+ +      CP C +     D+ +  N    Y  L D L     DN +  ++F+ KL    LMK  NF WC++  C++GF  +  GI K+ CP C    C +C + W++ HE  +C++F  W   NDP      L+  L   GIECPNC  RY LA GGC+HF C  C  ++C GCY  F +  +    P+C M  +H+HHPR+CL++LRD    +L+++L +    FD  +        C++M   E   E   C +    G   LC  HY EYLV+ +N   IDP   + S QL L L +   D+ V +K ETE
Sbjct:  628 AAQDNGDLERSKKFLQRECIVCMDLKPENRMITMLNCQCRFCSDCVSQYVKQIIQEQNIMHLVCPACSEPKNLEDDTVATN----YFNLLDILIRPLVDNPTH-DLFQRKLRDRTLMKEPNFRWCSH--CSSGFINERPGILKMPCPHCHKYTCFQCKKQWEDQHEGISCEQFAAWKEANDPEAQATGLAAHLKQNGIECPNCKFRYDLAKGGCMHFKCGQCSHEYCSGCYGPFRHGAHCPVSPHCAMRGLHAHHPRDCLFYLRDRDPEELQQLLAENNVAFDTEEGAAAAPGHCRVMEQAEAGTEDKECGRPTPDGYAGLCRMHYIEYLVERVNANLIDPVSIMTSDQLKLALERE--DQAVPQKKETE 988          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028853.1 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:101155382])

HSP 1 Score: 203.371 bits (516), Expect = 1.276e-54
Identity = 133/422 (31.52%), Postives = 201/422 (47.63%), Query Frame = 2
Query:  656 RFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCC--PDDN---YINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLK----DFDYPKLQGKPEKMCQLMITNE---QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKV 1864
            R L+   DL S G  +L    + + S               L  + QA+ +    +     L K C IC   +P  +M+   +CQ  +C DC  Q     +  K      CP C  PD N   ++N   +    QL++ L   V    +F  KL ++ L+K   F WC +  C+ GF  +G   K+ C  C+   C +C + W+  HE  +C++++ W  +NDP      L+  L D GI CPNC  +YAL+ GGC+HF C  C  +FC GC   F   C    C +  +H+HHPR+CL++LRD+    L+ +L+    DF+     G    +C ++   +   Q  +AAC      G  ALCE+HY+EYLV  IN + IDPA    S +L L   +  ++   KE  E    F  R+ +K+
Sbjct:  661 RRLLAVYDLPSWGRCELALSLLLEHS-----------APYSLEDVVQAVRESHDREFIRRVLAKECPICLSVFPHSKMQSLTSCQCSVCCDCFQQHFTIAVRDKHIRDMVCPVCWEPDINDPEHLNSYFSTLDIQLRECLEPEV--YELFHKKLTEQALIKDPKFLWCCH--CSYGFIYDGDQLKVTCFQCRNSFCAQCKKPWEPQHEGLSCEQYQTWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALSKGGCMHFCCSQCRYQFCSGCNNPFHTTCAVDGCSVSGLHAHHPRDCLFYLRDWEPARLQALLQNNGVDFNTEPPPGTQTGLCGVIEQKDEGGQQSDAACGAQTQSGHAALCEKHYREYLVSLINSHSIDPAPLYSSNELLLACKRYKVEDSRKE-GEDSFTFYSRLLQKL 1066          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000005329.2 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:101155382])

HSP 1 Score: 202.986 bits (515), Expect = 1.999e-54
Identity = 129/410 (31.46%), Postives = 196/410 (47.80%), Query Frame = 2
Query:  656 RFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCC--PDDN---YINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLK----DFDYPKLQGKPEKMCQLMITNE---QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNET 1828
            R L+   DL S G  +L    + + S               L  + QA+ +    +     L K C IC   +P  +M+   +CQ  +C DC  Q     +  K      CP C  PD N   ++N   +    QL++ L   V    +F  KL ++ L+K   F WC +  C+ GF  +G   K+ C  C+   C +C + W+  HE  +C++++ W  +NDP      L+  L D GI CPNC  +YAL+ GGC+HF C  C  +FC GC   F   C    C +  +H+HHPR+CL++LRD+    L+ +L+    DF+     G    +C ++   +   Q  +AAC      G  ALCE+HY+EYLV  IN + IDPA    S +L L   +  ++   KE  ++
Sbjct:  661 RRLLAVYDLPSWGRCELALSLLLEHS-----------APYSLEDVVQAVRESHDREFIRRVLAKECPICLSVFPHSKMQSLTSCQCSVCCDCFQQHFTIAVRDKHIRDMVCPVCWEPDINDPEHLNSYFSTLDIQLRECLEPEV--YELFHKKLTEQALIKDPKFLWCCH--CSYGFIYDGDQLKVTCFQCRNSFCAQCKKPWEPQHEGLSCEQYQTWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALSKGGCMHFCCSQCRYQFCSGCNNPFHTTCAVDGCSVSGLHAHHPRDCLFYLRDWEPARLQALLQNNGVDFNTEPPPGTQTGLCGVIEQKDEGGQQSDAACGAQTQSGHAALCEKHYREYLVSLINSHSIDPAPLYSSNELLLACKRYKVEDSRKEGEDS 1055          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044452.1 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:101155382])

HSP 1 Score: 202.986 bits (515), Expect = 1.999e-54
Identity = 129/410 (31.46%), Postives = 196/410 (47.80%), Query Frame = 2
Query:  656 RFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCC--PDDN---YINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLK----DFDYPKLQGKPEKMCQLMITNE---QLKEAACNKDV-CGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNET 1828
            R L+   DL S G  +L    + + S               L  + QA+ +    +     L K C IC   +P  +M+   +CQ  +C DC  Q     +  K      CP C  PD N   ++N   +    QL++ L   V    +F  KL ++ L+K   F WC +  C+ GF  +G   K+ C  C+   C +C + W+  HE  +C++++ W  +NDP      L+  L D GI CPNC  +YAL+ GGC+HF C  C  +FC GC   F   C    C +  +H+HHPR+CL++LRD+    L+ +L+    DF+     G    +C ++   +   Q  +AAC      G  ALCE+HY+EYLV  IN + IDPA    S +L L   +  ++   KE  ++
Sbjct:  661 RRLLAVYDLPSWGRCELALSLLLEHS-----------APYSLEDVVQAVRESHDREFIRRVLAKECPICLSVFPHSKMQSLTSCQCSVCCDCFQQHFTIAVRDKHIRDMVCPVCWEPDINDPEHLNSYFSTLDIQLRECLEPEV--YELFHKKLTEQALIKDPKFLWCCH--CSYGFIYDGDQLKVTCFQCRNSFCAQCKKPWEPQHEGLSCEQYQTWKRENDPEYQRQGLAGYLRDNGITCPNCRFQYALSKGGCMHFCCSQCRYQFCSGCNNPFHTTCAVDGCSVSGLHAHHPRDCLFYLRDWEPARLQALLQNNGVDFNTEPPPGTQTGLCGVIEQKDEGGQQSDAACGAQTQSGHAALCEKHYREYLVSLINSHSIDPAPLYSSNELLLACKRYKVEDSRKEGEDS 1055          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000016758.2 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:101174057])

HSP 1 Score: 194.512 bits (493), Expect = 1.333e-51
Identity = 128/425 (30.12%), Postives = 194/425 (45.65%), Query Frame = 2
Query:  656 RFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHY-----AQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGID-KIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDP-----NLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLF-VNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLK----DFDYPKLQGKPEKMCQLM----ITNEQLKEAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKE 1870
            R L+   DL S G  +L+   + +           PD S  L  +  A+ +    D     L   C IC   +P  +M+   +CQ  +C +C SQ     I  K      CP C + +  +  +   Y      QL+D L  +V    +F  KL +  LMK   F WC +  CT+GF  +G   K+ C SC    C KC + W+  H++ +C++F+ W   NDP      L+  L D GI C  C  +YAL  GGC+HF C  C  +FC GC   +    C  P C    +H+HHPR+CL++LRD+    L+ +L+     ++     G     C +M       +Q+      +   G   LC++HY+EYLV  IN + +DPA    S +L     +  +D    E  E +  +  R+ KK+ E
Sbjct:  693 RRLLALYDLPSWGRCELVLSLLLE-----------PDVSYSLEDVVHAVKESHDKDFIRRLLNNECPICLSIFPRSKMQSLTSCQCSVCHECFSQHFTVAIRDKHIRDMVCPVCGEPDINDPQQLDSYFSTLDIQLRDCLLHDV--YELFHKKLTEHTLMKDPKFLWCCH--CTSGFINDGDQLKVTCLSCHKSFCAKCKKAWEPQHQDVSCEQFQQWKRDNDPEYQKQGLAGYLRDNGITCLQCGFQYALTKGGCMHFTCSQCRYQFCSGCNNPYHKTACKAPQCSYPGLHAHHPRDCLFYLRDWDAARLQALLQRNRVGYNTDPSSGAQTDACGVMEQKDEGGQQVDSPCGVQTQPGQAGLCDKHYREYLVSLINAHSLDPAPLYQSQELTRACERYQVDTQRAEA-EDDNDYHARLLKKLME 1101          
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Match: si:dkey-181m9.8 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:101162956])

HSP 1 Score: 150.984 bits (380), Expect = 1.290e-37
Identity = 103/373 (27.61%), Postives = 172/373 (46.11%), Query Frame = 2
Query:  821 DGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNK--------NLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGF--DAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKN--DPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFV--NKCN-KPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEK----------MCQLMITNE--QLKEAACNKDVC-GTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVK 1855
              A+ FL  +C IC       ++     C   LC+ C + + +  I+ +   +  CP C                  NL   Q++ +L  ++    +F+ KL    L +  +F WCA+  C+ G   +AE + ++ CPSCK   C +C   W   H+  +C++F+ W  +N  D + S  +++  IECP C   ++LA GGC+HF C  C  +FCGGC + F   + C     C    +H+HHPR+CL+ LRD++ + L  +L+ +       KP            +C ++   +    +E  C +    G    C+ HYKE LV+ INR+  DPA      ++   L +  I       +E E  +  R++
Sbjct:  393 SSALKFLTHTCPICHEQVSFSKIVTMTHCSCFLCQVCFTAFFSVAIKERSVDQLVCPQCGKPEVRAQGGLEDATEYFNLLDTQIRHYLPRDIH--ELFQRKLRDRTLREMPDFCWCAH--CSFGILHEAERL-RMDCPSCKKSTCSRCRSPWAPQHQRLSCEQFKAWQEQNQLDHHGSTPISN-SIECPGCRSVFSLARGGCLHFTCTQCQHQFCGGCARTFTAGSACGFSAECGTKGLHAHHPRDCLFHLRDWSVSRLLLLLQHYRISPAWIKPASGSSSDGTQTAVCSVLELRDDGSKREEPCGRPTPQGFQGYCQLHYKERLVELINRFHCDPAVLFSPAEMVAELQRWRIPVPSMRPDEPEPLYAHRLR 759          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000015148.1 (SMESG000015148.1)

HSP 1 Score: 1122.07 bits (2901), Expect = 0.000e+0
Identity = 539/544 (99.08%), Postives = 542/544 (99.63%), Query Frame = 2
Query:  290 MHCYYRSRSKDIDICDWYPKFYPVRKNHSMMKRIFNKHGFKIPTNRLDRLYNEEIKSQNNKLKSMFINTDILSKLSINQEVINFQELNKMNYIPESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNEQLKEAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYIPKGLVAAEPDQ 1921
            MHCYYRSRSKDIDICDWYPKFYPVRKNHSMMKRIFNKHGFKIPTNRLDRLYNEEIKSQNNKLKSMFINTDILSKLSINQEVINFQELNKMNYIPESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEIC FDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCN+MWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHT+LEKMLKDFDYPKLQGKPEKMCQLMITNEQ K+AACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYIPKGLVAAEPDQ
Sbjct:    1 MHCYYRSRSKDIDICDWYPKFYPVRKNHSMMKRIFNKHGFKIPTNRLDRLYNEEIKSQNNKLKSMFINTDILSKLSINQEVINFQELNKMNYIPESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICCFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNQMWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTELEKMLKDFDYPKLQGKPEKMCQLMITNEQPKDAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYIPKGLVAAEPDQ 544          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000015148.1 (SMESG000015148.1)

HSP 1 Score: 987.252 bits (2551), Expect = 0.000e+0
Identity = 475/480 (98.96%), Postives = 478/480 (99.58%), Query Frame = 2
Query:  482 MFINTDILSKLSINQEVINFQELNKMNYIPESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNEQLKEAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYIPKGLVAAEPDQ 1921
            MFINTDILSKLSINQEVINFQELNKMNYIPESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEIC FDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCN+MWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHT+LEKMLKDFDYPKLQGKPEKMCQLMITNEQ K+AACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYIPKGLVAAEPDQ
Sbjct:    1 MFINTDILSKLSINQEVINFQELNKMNYIPESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICCFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNQMWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTELEKMLKDFDYPKLQGKPEKMCQLMITNEQPKDAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYIPKGLVAAEPDQ 480          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000015146.1 (SMESG000015146.1)

HSP 1 Score: 956.051 bits (2470), Expect = 0.000e+0
Identity = 473/616 (76.79%), Postives = 517/616 (83.93%), Query Frame = 2
Query:   92 TAEIDEWICSLCGTSN-FRGKECEICGEMQI----NIEYEAKLTNFKQYSLEIFIKLNVLNEKN-DLYFENIMHCYYRSRSKDIDICDWYPKFYPVRKNHSMMKRIFNKHGFKIPTNRLDRLYNEEIKSQNNKLKSMFINTDILSKLSINQEVINFQELNKMNYIPESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNEQLKEAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYIPKGLVAAEPDQ 1921
            ++E   WIC  C  +N    + C +C  +++      EY+ KL +F+   L  F+KL+ +  K+ ++ FENI+ CY R +     I +WY ++YP +K  S++  I  K GF I  N LD  YNE +  +   L     N +  +++ IN   +N  ++N+ N I  S + K   D D+W  I   +++T SEKRFLMTEMDLQSHG LDLLR FMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCM QWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLT NVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGC+HFDCKACGTKFCGGCYQLFVNKCNKPNCHM N HSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNEQLKEAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDS+QLNLMLFQMVID+LVKEKNETEAAFKER+KKKVKESCLFYIPKGLVAAEPDQ
Sbjct:   94 SSEALGWICDQCTYNNPISARRCNMCYNIRMIEAEYKEYDTKLESFRIKMLGQFLKLDEIYVKSPEIPFENIVCCYIRDKGGKGMIDEWYCRYYPQKKYFSIVNEIMRKSGFSIGLNELDTKYNEILNKRKETLLRSVTNQEFKNEI-INSPELNSLDINRHNKIIVSDLIKDVKDSDLWNVIATKETYTSSEKRFLMTEMDLQSHGSLDLLRAFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMLQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTSNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCLHFDCKACGTKFCGGCYQLFVNKCNKPNCHMTNFHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNEQLKEAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSYQLNLMLFQMVIDKLVKEKNETEAAFKERLKKKVKESCLFYIPKGLVAAEPDQ 708          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000015146.1 (SMESG000015146.1)

HSP 1 Score: 950.273 bits (2455), Expect = 0.000e+0
Identity = 468/616 (75.97%), Postives = 513/616 (83.28%), Query Frame = 2
Query:   92 TAEIDEWICSLCGTSN-FRGKECEICGEMQI----NIEYEAKLTNFKQYSLEIFIKLNVLNEKN-DLYFENIMHCYYRSRSKDIDICDWYPKFYPVRKNHSMMKRIFNKHGFKIPTNRLDRLYNEEIKSQNNKLKSMFINTDILSKLSINQEVINFQELNKMNYIPESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNEQLKEAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYIPKGLVAAEPDQ 1921
            ++E   WIC  C  +N    + C +C  +++      EY+ KL +F+   L  F+KL+ +  K+ ++ FENI+ CY R +     I +WY ++YP +K  S++  I  K GF I  N LD  YNE +  +   L     N +  +++ IN   +N  ++N+ N I  S + K   D D+W  I   +++T SEKRFLMTEMDLQSHG LDLLR FMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCM QWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLT NVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGC+HFDCKACGTKFCGGCYQLFVNKCNKPNCHM N HSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNEQLKEAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDS+QLNLMLFQMVID+LVKEKNETEAAFKER+KKKVKESCLFYIPKGL A   D+
Sbjct:   94 SSEALGWICDQCTYNNPISARRCNMCYNIRMIEAEYKEYDTKLESFRIKMLGQFLKLDEIYVKSPEIPFENIVCCYIRDKGGKGMIDEWYCRYYPQKKYFSIVNEIMRKSGFSIGLNELDTKYNEILNKRKETLLRSVTNQEFKNEI-INSPELNSLDINRHNKIIVSDLIKDVKDSDLWNVIATKETYTSSEKRFLMTEMDLQSHGSLDLLRAFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMLQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTSNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCLHFDCKACGTKFCGGCYQLFVNKCNKPNCHMTNFHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNEQLKEAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSYQLNLMLFQMVIDKLVKEKNETEAAFKERLKKKVKESCLFYIPKGLTADRIDE 708          
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Match: SMESG000015148.1 (SMESG000015148.1)

HSP 1 Score: 939.102 bits (2426), Expect = 0.000e+0
Identity = 450/455 (98.90%), Postives = 453/455 (99.56%), Query Frame = 2
Query:  557 MNYIPESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKLQGKPEKMCQLMITNEQLKEAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYIPKGLVAAEPDQ 1921
            MNYIPESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEIC FDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCN+MWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHT+LEKMLKDFDYPKLQGKPEKMCQLMITNEQ K+AACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYIPKGLVAAEPDQ
Sbjct:    1 MNYIPESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMTEMDLQSHGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNFLKKSCEICCFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSCPCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFHWCANEACTNGFDAEGIDKIICPSCKTQMCVKCNQMWKEAHENKTCQEFELWMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGCYQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTELEKMLKDFDYPKLQGKPEKMCQLMITNEQPKDAACNKDVCGTTALCEQHYKEYLVQFINRYKIDPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYIPKGLVAAEPDQ 455          
The following BLAST results are available for this feature:
BLAST of RING-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RNF313.970e-5832.03ring finger protein 31 [Source:HGNC Symbol;Acc:HGN... [more]
RNF313.970e-5832.03ring finger protein 31 [Source:HGNC Symbol;Acc:HGN... [more]
RNF314.678e-5832.03ring finger protein 31 [Source:HGNC Symbol;Acc:HGN... [more]
RNF314.678e-5832.03ring finger protein 31 [Source:HGNC Symbol;Acc:HGN... [more]
AL136295.104.786e-5832.03novel transcript[more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y49F6B.91.723e-1225.81RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
Y49F6B.91.723e-1225.81RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
Y49F6B.92.764e-1227.57RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
C17H11.65.452e-925.00RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
C17H11.65.452e-925.00RBR-type E3 ubiquitin transferase [Source:UniProt... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
LUBEL6.892e-5132.76gene:FBgn0031857 transcript:FBtr0331221[more]
LUBEL6.989e-5132.76gene:FBgn0031857 transcript:FBtr0331218[more]
LUBEL7.242e-5132.76gene:FBgn0031857 transcript:FBtr0331220[more]
LUBEL7.275e-5132.76gene:FBgn0031857 transcript:FBtr0331216[more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FO834800.13.171e-4533.23E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
si:dkey-181m9.84.259e-4430.08si:dkey-181m9.8 [Source:ZFIN;Acc:ZDB-GENE-070912-3... [more]
FO834800.26.825e-4135.56E3 ubiquitin-protein ligase RNF31-like [Source:NCB... [more]
si:ch211-278j3.36.943e-923.20si:ch211-278j3.3 [Source:ZFIN;Acc:ZDB-GENE-041014-... [more]
rnf19a9.980e-726.26ring finger protein 19A, RBR E3 ubiquitin protein ... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf311.548e-5732.43ring finger protein 31 [Source:NCBI gene;Acc:10003... [more]
rnf311.658e-5732.43ring finger protein 31 [Source:NCBI gene;Acc:10003... [more]
rnf312.222e-5732.43ring finger protein 31 [Source:NCBI gene;Acc:10003... [more]
rnf312.526e-5732.19ring finger protein 31 [Source:NCBI gene;Acc:10003... [more]
rnf311.015e-5432.37ring finger protein 31 [Source:NCBI gene;Acc:10003... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnf312.091e-5733.15ring finger protein 31 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf312.981e-5733.15ring finger protein 31 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf312.972e-2151.85ring finger protein 31 [Source:MGI Symbol;Acc:MGI:... [more]
Rnf19b8.683e-825.94ring finger protein 19B [Source:MGI Symbol;Acc:MGI... [more]
Rnf19b9.215e-826.07ring finger protein 19B [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of RING-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96EP0|RNF31_HUMAN2.299e-5732.03E3 ubiquitin-protein ligase RNF31 OS=Homo sapiens ... [more]
sp|Q924T7|RNF31_MOUSE1.463e-5633.15E3 ubiquitin-protein ligase RNF31 OS=Mus musculus ... [more]
sp|Q8IPJ3|LUBEL_DROME7.293e-5032.76E3 ubiquitin-protein ligase lubel OS=Drosophila me... [more]
sp|Q8IWT3|CUL9_HUMAN3.215e-824.77Cullin-9 OS=Homo sapiens OX=9606 GN=CUL9 PE=1 SV=2[more]
sp|Q6ZMZ0|RN19B_HUMAN5.386e-724.67E3 ubiquitin-protein ligase RNF19B OS=Homo sapiens... [more]
back to top
BLAST of RING-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z5L4B12.577e-6336.71RING-type domain-containing protein (Fragment) OS=... [more]
A0A2T7NIC06.226e-6233.12Uncharacterized protein OS=Pomacea canaliculata OX... [more]
C3XU403.106e-6033.50Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A067R5D92.617e-5934.65RING finger protein 31 OS=Zootermopsis nevadensis ... [more]
A0A2J7PUT16.682e-5932.62RING-type domain-containing protein OS=Cryptoterme... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000014446.25.477e-5730.90ring finger protein 31 [Source:NCBI gene;Acc:10303... [more]
ENSAMXT00000018785.27.923e-5334.65E3 ubiquitin-protein ligase RNF31-like [Source:NCB... [more]
si:dkey-181m9.81.141e-3826.88E3 ubiquitin-protein ligase RNF31-like [Source:NCB... [more]
si:ch211-278j3.35.063e-723.29E3 ubiquitin-protein ligase RNF19B-like [Source:NC... [more]
rnf19a1.092e-626.77ring finger protein 19A, RBR E3 ubiquitin protein ... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006434.16.184e-3537.11pep scaffold:Pmarinus_7.0:GL492086:439:5313:1 gene... [more]
ENSPMAT00000007741.11.764e-1124.11pep scaffold:Pmarinus_7.0:GL477427:676:25209:1 gen... [more]
ENSPMAT00000006333.15.441e-1023.42pep scaffold:Pmarinus_7.0:GL479789:448:31336:-1 ge... [more]
rnf19a1.187e-725.76ring finger protein 19A, RBR E3 ubiquitin protein ... [more]
RBCK17.754e-724.04RANBP2-type and C3HC4-type zinc finger containing ... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO464753.533e-5734.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RING-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000028853.11.276e-5431.52E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
ENSORLT00000005329.21.999e-5431.46E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
ENSORLT00000044452.11.999e-5431.46E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
ENSORLT00000016758.21.333e-5130.12E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
si:dkey-181m9.81.290e-3727.61E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
back to top
BLAST of RING-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015148.10.000e+099.08SMESG000015148.1[more]
SMESG000015148.10.000e+098.96SMESG000015148.1[more]
SMESG000015146.10.000e+076.79SMESG000015146.1[more]
SMESG000015146.10.000e+075.97SMESG000015146.1[more]
SMESG000015148.10.000e+098.90SMESG000015148.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013035 ID=SMED30013035|Name=RING-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2077bp
AAATATCATGTTTGTTTTAATATATACTATTTTCAATTTAACATCCTGAA
GTTTTTTAAAATTAAAATTAGTTTGTCGTCTGAAACTTATGACAGCTGAA
ATTGACGAATGGATATGCTCATTATGTGGTACAAGTAATTTCAGAGGCAA
AGAATGTGAAATATGTGGAGAAATGCAAATTAATATCGAATATGAGGCAA
AATTAACAAATTTTAAACAATATAGTTTGGAAATTTTTATTAAACTTAAT
GTTTTGAATGAAAAAAATGATTTATATTTTGAAAATATTATGCATTGCTA
TTATCGAAGTCGATCCAAAGATATCGACATATGCGATTGGTATCCAAAAT
TTTATCCTGTAAGGAAAAATCACTCAATGATGAAAAGAATTTTTAATAAA
CATGGATTTAAAATTCCAACCAACCGATTGGATCGCTTGTACAACGAAGA
AATCAAATCACAAAACAATAAGTTAAAAAGCATGTTTATAAATACAGATA
TTTTATCAAAATTATCAATCAACCAAGAAGTTATTAATTTCCAAGAATTA
AATAAAATGAATTATATCCCAGAAAGTCGTATTAGTAAAATTTTTACCGA
TAAAGATATTTGGGAGTTCATTATTGGAATGGATTCATTTACAGATTCTG
AAAAAAGATTTTTGATGACCGAAATGGACTTACAGTCACATGGGCCTCTT
GATCTTCTTCGTGAATTTATGAGAGATATGAGTTTAGGAGAATATTTGAG
ACAGGAATGTCCTGATGGAAGTGTGAAATTGCATCACCTTAAACAGGCTA
TGATTGATCAAATATCAATTGATGGAGCAATGAATTTTTTAAAAAAGTCC
TGTGAGATTTGTAGTTTCGATTATCCAATACCCGAGATGAGAGGATTTAT
TACGTGTCAGCATGAGTTGTGCAAAGACTGCATGTCGCAGTGGCTGGCTG
AGACGATTGAAGTAAAGTTTCCATGCAAATGGAGTTGTCCATGTTGTCCA
GATGATAATTATATTAATGTGAATAAAAATCTACATTACGCACAATTAAA
AGACTTCTTAACAGATAATGTAAGTCTAATTAATATTTTTGAATCGAAAC
TTCTCCAAGAACAGTTGATGAAATCTGATAATTTTCATTGGTGTGCTAAT
GAAGCGTGTACTAATGGGTTTGACGCTGAAGGTATAGACAAAATAATATG
TCCGTCATGTAAAACACAAATGTGTGTCAAATGTAATCGAATGTGGAAAG
AAGCCCATGAAAACAAAACCTGTCAAGAATTTGAATTGTGGATGTTAAAA
AATGATCCAAATCTCTCAAAGTTATTAAATGATATTGGCATAGAATGTCC
CAATTGCACAATGAGATATGCTTTAGCCCCAGGAGGTTGTATTCATTTTG
ACTGCAAAGCTTGTGGAACTAAATTTTGTGGAGGTTGCTACCAGTTATTT
GTTAACAAATGTAATAAACCTAACTGTCATATGATGAATGTCCATAGTCA
TCATCCTCGAAATTGTTTGTATTTTCTTCGAGATTATACACATACTGATT
TGGAAAAAATGCTAAAAGATTTCGATTATCCTAAATTACAAGGTAAGCCT
GAGAAAATGTGCCAGCTTATGATCACGAATGAACAACTAAAAGAGGCTGC
TTGTAATAAAGATGTTTGTGGAACTACTGCATTGTGCGAACAGCACTACA
AAGAATATTTGGTTCAATTTATCAATCGCTACAAGATAGATCCAGCGGAT
TTTGTTGATTCTTTTCAACTTAATCTCATGCTATTCCAAATGGTTATTGA
TAGATTGGTTAAAGAAAAAAATGAGACTGAGGCCGCATTCAAAGAACGGG
TGAAGAAAAAAGTGAAAGAATCATGTTTGTTTTATATTCCGAAAGGCCTG
GTAGCTGCGGAACCGGATCAGTAGTGAAATTGAAGAACAATTACTCTGAC
TTGGTTAATTATCAAATACATTTTTAAATGGGACGTTATTTTTGCTTATT
ACCGACGAATTTGTAACAAATTTCAATTTTTATTCAATTTAGTCCATTTT
TTGATATTAAAATTTCATATTTATTTC
back to top

protein sequence of SMED30013035-orf-1

>SMED30013035-orf-1 ID=SMED30013035-orf-1|Name=SMED30013035-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=612bp
MTAEIDEWICSLCGTSNFRGKECEICGEMQINIEYEAKLTNFKQYSLEIF
IKLNVLNEKNDLYFENIMHCYYRSRSKDIDICDWYPKFYPVRKNHSMMKR
IFNKHGFKIPTNRLDRLYNEEIKSQNNKLKSMFINTDILSKLSINQEVIN
FQELNKMNYIPESRISKIFTDKDIWEFIIGMDSFTDSEKRFLMTEMDLQS
HGPLDLLREFMRDMSLGEYLRQECPDGSVKLHHLKQAMIDQISIDGAMNF
LKKSCEICSFDYPIPEMRGFITCQHELCKDCMSQWLAETIEVKFPCKWSC
PCCPDDNYINVNKNLHYAQLKDFLTDNVSLINIFESKLLQEQLMKSDNFH
WCANEACTNGFDAEGIDKIICPSCKTQMCVKCNRMWKEAHENKTCQEFEL
WMLKNDPNLSKLLNDIGIECPNCTMRYALAPGGCIHFDCKACGTKFCGGC
YQLFVNKCNKPNCHMMNVHSHHPRNCLYFLRDYTHTDLEKMLKDFDYPKL
QGKPEKMCQLMITNEQLKEAACNKDVCGTTALCEQHYKEYLVQFINRYKI
DPADFVDSFQLNLMLFQMVIDRLVKEKNETEAAFKERVKKKVKESCLFYI
PKGLVAAEPDQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016567protein ubiquitination
GO:0000209protein polyubiquitination
GO:0010803regulation of tumor necrosis factor-mediated signaling pathway
GO:0023035CD40 signaling pathway
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0050852T cell receptor signaling pathway
GO:0051092positive regulation of NF-kappaB transcription factor activity
GO:0097039protein linear polyubiquitination
GO:1903955positive regulation of protein targeting to mitochondrion
GO:0007249I-kappaB kinase/NF-kappaB signaling
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR041031RNF31_C
IPR026254RNF31-like
IPR002867IBR_dom
IPR013083Znf_RING/FYVE/PHD
IPR017907Znf_RING_CS
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0016740transferase activity
GO:0031625ubiquitin protein ligase binding
GO:0043130ubiquitin binding
GO:0046872metal ion binding
GO:0004842ubiquitin-protein transferase activity
Vocabulary: cellular component
TermDefinition
GO:0009898cytoplasmic side of plasma membrane
GO:0035631CD40 receptor complex
GO:0071797LUBAC complex
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002867IBR domainSMARTSM00647ibrneu5coord: 265..328
e-value: 7.5E-5
score: 32.1
IPR002867IBR domainPFAMPF01485IBRcoord: 267..328
e-value: 1.1E-7
score: 31.9
IPR041031RNF31, C-terminalPFAMPF18091E3_UbLigase_RBRcoord: 435..495
e-value: 6.3E-13
score: 48.7
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 184..277
e-value: 1.7E-7
score: 33.1
IPR026254E3 ubiquitin-protein ligase RNF31-likePANTHERPTHR16004RING FINGER PROTEIN 31-RELATEDcoord: 175..530
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 206..215
NoneNo IPR availablePROSITEPS51873TRIADcoord: 184..408
score: 19.723
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 268..335
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 187..240
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 188..236
score: 9.73