SMED30013027

Overview
NameSMED30013027
Smed IDSMED30013027
Length (bp)3699
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30013027 (SMED30013027) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30013027 (SMED30013027) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30013027 (SMED30013027) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30013027 (SMED30013027) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013027

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30013027SMESG000076350.1 dd_Smed_v4_7379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013027SMESG000076350.1 dd_Smed_v4_7379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30013027SMESG000076350.1 dd_Smed_v4_7379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30013027SMESG000076350.1 dd_Smed_v4_7379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30013027SMESG000076350.1 dd_Smed_v4_7379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013027SMESG000076350.1 dd_Smed_v4_7379_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30013027 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.003680:23852..34662 -17803
Homology
BLAST of SMED30013027 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 213.001 bits (541), Expect = 3.810e-55
Identity = 119/453 (26.27%), Postives = 219/453 (48.34%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L+++    N  N +  +P+  A  +G  E+AK L+ NK  +N   +  + P+H A+ +G T +  +L++   +    T     P+ IA+   +VE V  L+    +  C+  +   P+HVA + G V V +LL++   + N A    + P+H+A  +  ++IVK+LL  G   +       TPL++A ++   +V++ L+  G +   +S++   P+H A Q G  E+  LL+    + +  N +   P+HL    G++ +  +L+ HG  ++   R    P+H A   GN+ L+K L+ +   ++ K     +PL      G+ D V+ L K
Sbjct:  306 LSPIHMAAQGDHLDCVRLLL--QYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKT-GASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 755          

HSP 2 Score: 202.601 bits (514), Expect = 7.269e-52
Identity = 124/507 (24.46%), Postives = 229/507 (45.17%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIIN 2003
             T LH A   G+H + ++L+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  N +   P+H+A + GH E+AK L++   ++N+  K + +P+  A   G   + KLL+ N  + N +T     P+H A+  G  E    L++++    C T     P+ +A+    V +  LL+    +          P+HVA     +++V+LL+    + +        P+HIA++  +VE+ + LL++G   N       TPL+LA ++GH ++  +L+    N    +     P+H   Q G   +A +L+     +D        P+H+A   GN+ +VK L+ H +++    +    P+H A + G+ D++  L+ N  + +  +   +TPL + K  GY      L  V D    +    +H   + F E  D   +  +  D G  ++      R SR ++
Sbjct:  339 LTPLHVAAHCGHHRVAKVLLDKG--AKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHR--MSFPETVD--EILDVSEDEGEELISFKAERRDSRDVD 838          

HSP 3 Score: 197.208 bits (500), Expect = 2.987e-50
Identity = 121/459 (26.36%), Postives = 221/459 (48.15%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSKVLDAN 1856
            FT LH A    N ++ +LL++      +N   ++    +H A    +  +V +L+ +  +I  K  +E+ PLH A  NG+  I+++L+D     +  K      PIH+A Q  H +  +LL++ + E++ +     +P+  A + G   +AK+L+      N        P+H A       V  +L+     I+  T     P+ +AS   ++ IV+ L+    +    N + E P+H+A + G  EV + L+ N   +N        P+H A+  G   +VK+LLE+ A+ N   T   TPL++A  +GH +    L++   +  C + K + P+H A + G   +A+LL++     +    N   P+H+A    NL+IVKLL+  G +   P  +   P+H A +   +++ ++L+    + + ++    TPL L    G+ + V+  LSK  + N
Sbjct:  207 FTPLHIAAHYENLNVAQLLLNRG--ASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDH-GAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGN 662          

HSP 4 Score: 182.956 bits (463), Expect = 9.479e-46
Identity = 115/451 (25.50%), Postives = 216/451 (47.89%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  L+  ++   +   TK  N A+H A ++  +E+V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI       +  K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R   +         P+ IAS   NV +VRLL+     I+    +   P+H A + G V + ++L+D+   I       + PIH+A++   ++ V++LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     + +LL+ +  SID   ++   P+H+A   G+L IVK L+  G++    +   + P+H A   G+ ++ K L+ N   ++ K     TPL      G+ + V  L
Sbjct:   46 LNGLHLASKEGHVKMVVELLHKEI--ILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLL 489          

HSP 5 Score: 176.792 bits (447), Expect = 6.437e-44
Identity = 112/470 (23.83%), Postives = 217/470 (46.17%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID--------VPDCNVNCKNAEESQ--------------------PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFG 1811
            TALH A   G  ++VR LV+      +N  ++     ++ A      E+V+ L+      N   ++   PL  A   G++ +   LI+        +P  ++  +N +                       P+H+A  + +  +A+LL+ +   +N   +   +P+  A   G + + +LL+     I   T+ +  P+H A+  G   ++ +L+D    I+ +T     PI +A+  ++++ VRLL+     I  I  ++  P+HVA   G   V ++L+D     N        P+HIA +   V ++++LL+ GA  + +     TPL++A+  GH  + K L+  G +    ++K   P+H A + G  E+A+ L+ +   ++ +  + Q P+H A   G+ N+VKLL+++ +N      +   P+H A   G+++ + AL+    +  C      TPL +   +G
Sbjct:   80 TALHIAALAGQDEVVRELVN--YGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYG 547          

HSP 6 Score: 125.176 bits (313), Expect = 4.659e-28
Identity = 74/332 (22.29%), Postives = 164/332 (49.40%), Query Frame = 3
Query:  762 NVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            +V  + A+ +     A + G+ + A   +    ++N+ N+   + +  A   G +++   L+  +  +  +T+     +H A+  G  EV   L++   ++  ++     P+++A+  N++E+V+ L+ N  N     ++   P+ VA Q+G   VV  LI    N        +  +HIA+ N       +LL++  + + +     TPL++A    + +V+++L++ G ++         P+H A + G   + +LL+D    I+T+  ++  P+H A  +G++ I ++L+DHG+ ++   ++   PIH A +  +LD ++ L+  +  I
Sbjct:    4 SVGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEI 331          

HSP 7 Score: 121.709 bits (304), Expect = 5.082e-27
Identity = 82/313 (26.20%), Postives = 147/313 (46.96%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            L A  SG ++ A   + N  DIN   +     +H AS  G  ++   L+ ++  +E  T      + IA+     E+VR L+    N+   + +   P+++A Q+  +EVV+ L++N  N N A +    P+ +A + G   +V  L+ +G          R P L++A        + VL+ N  N +  S   + P+H A       +AQLL++   S++    N   P+H+A   GN+ +V+LL+D G+ +E   +    P+H A  NG++ + + L+ +   I  K     +P+ +     + DCV  L
Sbjct:   17 LRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 324          
BLAST of SMED30013027 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 213.001 bits (541), Expect = 3.878e-55
Identity = 119/453 (26.27%), Postives = 219/453 (48.34%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L+++    N  N +  +P+  A  +G  E+AK L+ NK  +N   +  + P+H A+ +G T +  +L++   +    T     P+ IA+   +VE V  L+    +  C+  +   P+HVA + G V V +LL++   + N A    + P+H+A  +  ++IVK+LL  G   +       TPL++A ++   +V++ L+  G +   +S++   P+H A Q G  E+  LL+    + +  N +   P+HL    G++ +  +L+ HG  ++   R    P+H A   GN+ L+K L+ +   ++ K     +PL      G+ D V+ L K
Sbjct:  306 LSPIHMAAQGDHLDCVRLLL--QYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKT-GASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 755          

HSP 2 Score: 202.601 bits (514), Expect = 7.210e-52
Identity = 124/507 (24.46%), Postives = 229/507 (45.17%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIIN 2003
             T LH A   G+H + ++L+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  N +   P+H+A + GH E+AK L++   ++N+  K + +P+  A   G   + KLL+ N  + N +T     P+H A+  G  E    L++++    C T     P+ +A+    V +  LL+    +          P+HVA     +++V+LL+    + +        P+HIA++  +VE+ + LL++G   N       TPL+LA ++GH ++  +L+    N    +     P+H   Q G   +A +L+     +D        P+H+A   GN+ +VK L+ H +++    +    P+H A + G+ D++  L+ N  + +  +   +TPL + K  GY      L  V D    +    +H   + F E  D   +  +  D G  ++      R SR ++
Sbjct:  339 LTPLHVAAHCGHHRVAKVLLDKG--AKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHR--MSFPETVD--EILDVSEDEGEELISFKAERRDSRDVD 838          

HSP 3 Score: 197.208 bits (500), Expect = 2.989e-50
Identity = 121/459 (26.36%), Postives = 221/459 (48.15%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSKVLDAN 1856
            FT LH A    N ++ +LL++      +N   ++    +H A    +  +V +L+ +  +I  K  +E+ PLH A  NG+  I+++L+D     +  K      PIH+A Q  H +  +LL++ + E++ +     +P+  A + G   +AK+L+      N        P+H A       V  +L+     I+  T     P+ +AS   ++ IV+ L+    +    N + E P+H+A + G  EV + L+ N   +N        P+H A+  G   +VK+LLE+ A+ N   T   TPL++A  +GH +    L++   +  C + K + P+H A + G   +A+LL++     +    N   P+H+A    NL+IVKLL+  G +   P  +   P+H A +   +++ ++L+    + + ++    TPL L    G+ + V+  LSK  + N
Sbjct:  207 FTPLHIAAHYENLNVAQLLLNRG--ASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDH-GAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGN 662          

HSP 4 Score: 182.57 bits (462), Expect = 1.033e-45
Identity = 115/451 (25.50%), Postives = 216/451 (47.89%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  L+  ++   +   TK  N A+H A ++  +E+V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI       +  K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R   +         P+ IAS   NV +VRLL+     I+    +   P+H A + G V + ++L+D+   I       + PIH+A++   ++ V++LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     + +LL+ +  SID   ++   P+H+A   G+L IVK L+  G++    +   + P+H A   G+ ++ K L+ N   ++ K     TPL      G+ + V  L
Sbjct:   46 LNGLHLASKEGHVKMVVELLHKEI--ILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLL 489          

HSP 5 Score: 176.792 bits (447), Expect = 6.607e-44
Identity = 112/470 (23.83%), Postives = 217/470 (46.17%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID--------VPDCNVNCKNAEESQ--------------------PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFG 1811
            TALH A   G  ++VR LV+      +N  ++     ++ A      E+V+ L+      N   ++   PL  A   G++ +   LI+        +P  ++  +N +                       P+H+A  + +  +A+LL+ +   +N   +   +P+  A   G + + +LL+     I   T+ +  P+H A+  G   ++ +L+D    I+ +T     PI +A+  ++++ VRLL+     I  I  ++  P+HVA   G   V ++L+D     N        P+HIA +   V ++++LL+ GA  + +     TPL++A+  GH  + K L+  G +    ++K   P+H A + G  E+A+ L+ +   ++ +  + Q P+H A   G+ N+VKLL+++ +N      +   P+H A   G+++ + AL+    +  C      TPL +   +G
Sbjct:   80 TALHIAALAGQDEVVRELVN--YGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYG 547          

HSP 6 Score: 125.176 bits (313), Expect = 4.821e-28
Identity = 74/332 (22.29%), Postives = 164/332 (49.40%), Query Frame = 3
Query:  762 NVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            +V  + A+ +     A + G+ + A   +    ++N+ N+   + +  A   G +++   L+  +  +  +T+     +H A+  G  EV   L++   ++  ++     P+++A+  N++E+V+ L+ N  N     ++   P+ VA Q+G   VV  LI    N        +  +HIA+ N       +LL++  + + +     TPL++A    + +V+++L++ G ++         P+H A + G   + +LL+D    I+T+  ++  P+H A  +G++ I ++L+DHG+ ++   ++   PIH A +  +LD ++ L+  +  I
Sbjct:    4 SVGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEI 331          

HSP 7 Score: 121.709 bits (304), Expect = 5.348e-27
Identity = 82/314 (26.11%), Postives = 147/314 (46.82%), Query Frame = 3
Query:  897 ILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             L A  SG ++ A   + N  DIN   +     +H AS  G  ++   L+ ++  +E  T      + IA+     E+VR L+    N+   + +   P+++A Q+  +EVV+ L++N  N N A +    P+ +A + G   +V  L+ +G          R P L++A        + VL+ N  N +  S   + P+H A       +AQLL++   S++    N   P+H+A   GN+ +V+LL+D G+ +E   +    P+H A  NG++ + + L+ +   I  K     +P+ +     + DCV  L
Sbjct:   16 FLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 324          
BLAST of SMED30013027 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 213.001 bits (541), Expect = 4.298e-55
Identity = 119/453 (26.27%), Postives = 219/453 (48.34%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L+++    N  N +  +P+  A  +G  E+AK L+ NK  +N   +  + P+H A+ +G T +  +L++   +    T     P+ IA+   +VE V  L+    +  C+  +   P+HVA + G V V +LL++   + N A    + P+H+A  +  ++IVK+LL  G   +       TPL++A ++   +V++ L+  G +   +S++   P+H A Q G  E+  LL+    + +  N +   P+HL    G++ +  +L+ HG  ++   R    P+H A   GN+ L+K L+ +   ++ K     +PL      G+ D V+ L K
Sbjct:  339 LSPIHMAAQGDHLDCVRLLL--QYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKT-GASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 788          

HSP 2 Score: 201.445 bits (511), Expect = 1.759e-51
Identity = 119/478 (24.90%), Postives = 218/478 (45.61%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYD 1916
             T LH A   G+H + ++L+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  N +   P+H+A + GH E+AK L++   ++N+  K + +P+  A   G   + KLL+ N  + N +T     P+H A+  G  E    L++++    C T     P+ +A+    V +  LL+    +          P+HVA     +++V+LL+    + +        P+HIA++  +VE+ + LL++G   N       TPL+LA ++GH ++  +L+    N    +     P+H   Q G   +A +L+     +D        P+H+A   GN+ +VK L+ H +++    +    P+H A + G+ D++  L+ N  + +  +   +TPL + K  GY      L  V D    +    +H   + F E  D
Sbjct:  372 LTPLHVAAHCGHHRVAKVLLDKG--AKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHR--MSFPETVD 844          

HSP 3 Score: 197.208 bits (500), Expect = 3.423e-50
Identity = 121/459 (26.36%), Postives = 221/459 (48.15%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSKVLDAN 1856
            FT LH A    N ++ +LL++      +N   ++    +H A    +  +V +L+ +  +I  K  +E+ PLH A  NG+  I+++L+D     +  K      PIH+A Q  H +  +LL++ + E++ +     +P+  A + G   +AK+L+      N        P+H A       V  +L+     I+  T     P+ +AS   ++ IV+ L+    +    N + E P+H+A + G  EV + L+ N   +N        P+H A+  G   +VK+LLE+ A+ N   T   TPL++A  +GH +    L++   +  C + K + P+H A + G   +A+LL++     +    N   P+H+A    NL+IVKLL+  G +   P  +   P+H A +   +++ ++L+    + + ++    TPL L    G+ + V+  LSK  + N
Sbjct:  240 FTPLHIAAHYENLNVAQLLLNRG--ASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDH-GAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGN 695          

HSP 4 Score: 182.57 bits (462), Expect = 1.066e-45
Identity = 115/451 (25.50%), Postives = 216/451 (47.89%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  L+  ++   +   TK  N A+H A ++  +E+V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI       +  K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R   +         P+ IAS   NV +VRLL+     I+    +   P+H A + G V + ++L+D+   I       + PIH+A++   ++ V++LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     + +LL+ +  SID   ++   P+H+A   G+L IVK L+  G++    +   + P+H A   G+ ++ K L+ N   ++ K     TPL      G+ + V  L
Sbjct:   79 LNGLHLASKEGHVKMVVELLHKEI--ILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLL 522          

HSP 5 Score: 176.792 bits (447), Expect = 7.553e-44
Identity = 112/470 (23.83%), Postives = 217/470 (46.17%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID--------VPDCNVNCKNAEESQ--------------------PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFG 1811
            TALH A   G  ++VR LV+      +N  ++     ++ A      E+V+ L+      N   ++   PL  A   G++ +   LI+        +P  ++  +N +                       P+H+A  + +  +A+LL+ +   +N   +   +P+  A   G + + +LL+     I   T+ +  P+H A+  G   ++ +L+D    I+ +T     PI +A+  ++++ VRLL+     I  I  ++  P+HVA   G   V ++L+D     N        P+HIA +   V ++++LL+ GA  + +     TPL++A+  GH  + K L+  G +    ++K   P+H A + G  E+A+ L+ +   ++ +  + Q P+H A   G+ N+VKLL+++ +N      +   P+H A   G+++ + AL+    +  C      TPL +   +G
Sbjct:  113 TALHIAALAGQDEVVRELVN--YGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYG 580          

HSP 6 Score: 124.02 bits (310), Expect = 1.091e-27
Identity = 72/317 (22.71%), Postives = 158/317 (49.84%), Query Frame = 3
Query:  807 ACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            A + G+ + A   +    ++N+ N+   + +  A   G +++   L+  +  +  +T+     +H A+  G  EV   L++   ++  ++     P+++A+  N++E+V+ L+ N  N     ++   P+ VA Q+G   VV  LI    N        +  +HIA+ N       +LL++  + + +     TPL++A    + +V+++L++ G ++         P+H A + G   + +LL+D    I+T+  ++  P+H A  +G++ I ++L+DHG+ ++   ++   PIH A +  +LD ++ L+  +  I
Sbjct:   52 AARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEI 364          

HSP 7 Score: 121.709 bits (304), Expect = 5.412e-27
Identity = 82/313 (26.20%), Postives = 147/313 (46.96%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            L A  SG ++ A   + N  DIN   +     +H AS  G  ++   L+ ++  +E  T      + IA+     E+VR L+    N+   + +   P+++A Q+  +EVV+ L++N  N N A +    P+ +A + G   +V  L+ +G          R P L++A        + VL+ N  N +  S   + P+H A       +AQLL++   S++    N   P+H+A   GN+ +V+LL+D G+ +E   +    P+H A  NG++ + + L+ +   I  K     +P+ +     + DCV  L
Sbjct:   50 LRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 357          
BLAST of SMED30013027 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 199.904 bits (507), Expect = 1.809e-51
Identity = 120/486 (24.69%), Postives = 217/486 (44.65%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLV--SGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTN---------------------------------GNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             T LH A ++GN ++V+LL+   G++  K  D        +H A  S  +++VE+L+ +   +  +    + PLH A                                    G+  + +LL+D    N N +      PIH+A   GH  I  LL++     +  N +  + +  A  +GQ+E+ + L+ N   ++   R ++ P+H AS LG TE+  +L+      +  T     P+ I++    V++  +L+           +   P+HVA + G ++V +LL+      + A      P+HIA++  +++I   LL +GA+TN +     TPL+LA+++GH D+  +L+D G NI   +      +H A Q     +A +L       D        P+ +AC  GN+ +V  L+  G+N+    ++   P+H A + G+  +I  L+ +    +      +T L + K  GY   V  L
Sbjct:  222 ITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTP----LHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLD-KRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 702          

HSP 2 Score: 197.593 bits (501), Expect = 9.898e-51
Identity = 136/542 (25.09%), Postives = 242/542 (44.65%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI----------NDATKSAN-----------------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPIN 2027
            FT L  A QQG++  V +L+    + K+           D TKSA                    +H A    +  +  +L+ +   ++      + PLH A   GN  + +LL+D     ++ K  +   P+H A + GH ++ +LL+E+   + +  K   SP+  A     +E  K L+ +K  ++  T      +H A+  G   V  +L+D++ +     +    PI +A+   ++ IV LL+ N  +    N   E  +H+A + G VEVV+ L+ N   ++    +   P+HIAS  G+ EIV++LL+H A  +   T   TPL+++  +G  DV+ VL++ G      + K + P+H A + G  ++A+LL+    + D+   N   P+H+A     + I   L+++G+      +    P+H A + G+ D++  L+     IH    +  T L L      +D V+                  D + K     DAHT        G + L VA    + +++N++L Q  N
Sbjct:  127 FTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDR-GGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHL---AAQEDKVNVA----------------DILTKHGADQDAHTKL------GYTPLIVACHYGNVKMVNFLLKQGAN 642          

HSP 3 Score: 178.333 bits (451), Expect = 1.049e-44
Identity = 119/497 (23.94%), Postives = 219/497 (44.06%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLH------------YACTNG----------------------NKAIAQLL-------IDVP--------------------DCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
              ALH A ++G+  +V+ L+       ++ ATK  N A+H A ++   E+V++L+ +   IN ++     PL+            Y   NG                      N+A+A LL       + +P                    D N + ++     P+H+A  +G+  +A LL+ +   ++   +   +P+  A   G   + KLL+     I+  TR    P+H A+  G  +V  +L++R   +   T     P+ +A+  ++VE V+ L+ +   +  +  +    +HVA   G   V +LL+D   N N      + PIH+A+  G + IV +LL++GA  +       T L++A   G  +V + L+ NG  ++ ++ ++  P+H A + G  EI QLL+      D    N   P+H++   G +++  +L++ G+      +    P+H A + G+LD+ K L+    A         TPL
Sbjct:   28 LNALHLAAKEGHVGLVQELLG--RGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPL 522          

HSP 4 Score: 170.244 bits (430), Expect = 4.228e-42
Identity = 113/474 (23.84%), Postives = 210/474 (44.30%), Query Frame = 3
Query:  501 ACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQ-----------------------------IEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A + GN D V   + G +   IN   ++   A+H A       +V+ L+G+   ++    +    LH A   G   + ++L+     N+N ++     P+++A Q  H ++ K L+E     ++  +  F+P+  AL  G                               + A LL+ N  + +  +++   P+H A+  G   VA +L++R   ++        P+ +AS   N  +V+LL+     I     +   P+H A + G  +VV+LL++    +       + P+H+A++   VE VK LL+H A  + +     T L++A   GHY V+K+L+D   N   +++    PIH A   G   I  LL+ +  S D  N   +  +H+A  +G + +V+ L+ +G+ ++   R  + P+H A   G  ++++ L+ +            TPL +    G  D  S L
Sbjct:    1 AARAGNLDKVVEYLKGGID--INTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVK-EGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL 471          
BLAST of SMED30013027 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 197.593 bits (501), Expect = 2.469e-50
Identity = 138/560 (24.64%), Postives = 254/560 (45.36%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCE-----------------------------MNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREI----------FHRVRHDDIVKFNELY-------DAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPIN 2027
            ALH A ++G+  +V+ LL  G     ++ ATK  N A+H A ++   E+V++L+ +   IN ++     PL+ A    +  + + L++    N +    +   P+ +A Q GH +   +L+E + +                              +  +K  F+P+  A + G + +A LL+     ++ + R    P+H AS  G T +  +L+DR   I+ +T     P+  A+ + + ++V LL+     +       E  +H+A + G VEVV+ L+ N   ++    +   P+HIAS  G+ EIV++LL+H A  +   T   TPL+++  +G  DV+ VL++ G      + K + P+H A + G  ++A+LL+    + D+   N   P+H+A    N  +  LL++ G++     ++   P+H A +   + +   L++     +       TPL L    G+ D V+ L   LD    I           H    +D V   ++        DAHT        G + L VA    + +++N++L Q  N
Sbjct:   46 ALHLAAKEGHVGLVQELLGRG---SSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLEN-GANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLL---LDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKL------GYTPLIVACHYGNVKMVNFLLKQGAN 592          

HSP 2 Score: 186.808 bits (473), Expect = 5.525e-47
Identity = 120/511 (23.48%), Postives = 222/511 (43.44%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI----------NDATKSAN-----------------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIAS----------------------ENG-----------RVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT L  A QQG++  V +L+    + K+           D TKSA                    +H A    +  +  +L+ +   ++      + PLH A   GN  + +LL+D     ++ K  +   P+H A + GH ++ +LL+E+   + +  K+  + +  A  +GQ+E+ + L+ N   ++   R ++ P+H AS LG TE+  +L+      +  T     P+ I++    V++  +L+           +   P+HVA + G ++V +LL+      + A    + P+H+A+                      +NG           +++I   LL +GA+TN +     TPL+LA+++GH D+  +L+D G NI   +      +H A Q     +A +L       D        P+ +AC  GN+ +V  L+  G+N+    ++   P+H A + G+  +I  L+ +    +      +T L + K  GY   V  L
Sbjct:  143 FTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDR-GGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 652          

HSP 3 Score: 139.813 bits (351), Expect = 1.673e-32
Identity = 86/364 (23.63%), Postives = 173/364 (47.53%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ID+  CN N  NA     +HLA + GH  + + L+ +   ++S  K+  + +  A  +GQ E+ K+L+    +IN  ++    P++ A+     +V   L++   +    T     P+ +A    + + V +L+ N    K         +H+A +K   +   LL+ N  N +  +     P+HIA+  G V +  +LL  GA  +       TPL++A+++G+ ++ K+L+D G  I+ ++     P+H A ++G  ++ +LL++    +       +  +H+A  +G + +V+ L+ +G+ ++   R  + P+H A   G  ++++ L+ +            TPL +    G  D  S L
Sbjct:   34 IDINTCNQNGLNA-----LHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKV----RLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL 388          

HSP 4 Score: 124.02 bits (310), Expect = 8.874e-28
Identity = 79/311 (25.40%), Postives = 141/311 (45.34%), Query Frame = 3
Query:  897 ILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCV 1826
             L A  +G ++     +    DIN   +     +H A+  G   +   L+ R   ++  T      + IAS     E+V++L+    NI   +     P+++A Q+  ++VV+ L++N  N + A +    P+ +A + G  + V ILLE     N      R P L++A  K     + +L+ N  N + QS   + P+H A   G   +A LL++   ++D    N   P+H+A   GN N+VKLL+D G  ++   R    P+H A  +G+  +++ L+     +  +     T L +    G  + V
Sbjct:   14 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKRGETALHMAARAGQVEVV 319          

HSP 5 Score: 117.472 bits (293), Expect = 1.031e-25
Identity = 73/273 (26.74%), Postives = 126/273 (46.15%), Query Frame = 3
Query: 1104 ASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGF-----------------------------CEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A+   N++ V   +    +I   N      +H+A ++G V +VQ L+    +++ A  K    +HIAS  G+ E+VK+L++ GA+ N       TPLY+A ++ H DV K L++NG N    +   + P+  A Q G                               + A LL+ +  + D ++ +   P+H+A   GN+N+  LL++ G+ ++   R+   P+H A + GN +++K L+     I  K     TPL      G+D  V  L
Sbjct:   17 AARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELL 289          
BLAST of SMED30013027 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 202.601 bits (514), Expect = 2.670e-52
Identity = 122/454 (26.87%), Postives = 224/454 (49.34%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRR---PIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             T LH A   G+  + +LL+        N    +    +H AC     ++VE+L+  +  I    +  + PLH A   G   I   L+     N + +      P+HLA +    ++ ++LI    ++++  ++  +P+  A   G  +I  LL+    + N +TR    P+H A+  G  EVA +L+D   D   +T+L ++   P+ +AS   N+E+VRLL+     +         P+HVA      +V  LL++N  +   A      P+HIA++  ++EI   LL+  AD N       TPL+L+ ++GH ++S +LI+NG ++  ++      +H   Q     +AQ+L ++   I+++ +    P+H+AC  G LN+VK LV++G+++    R++  P+H A + G+ + ++ L+ N  + + +     TPL + +  GY   V  L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLD--RSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ-GANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD---KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 187.578 bits (475), Expect = 1.367e-47
Identity = 112/451 (24.83%), Postives = 216/451 (47.89%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A   G+ ++ +LL+  +    +N   +     +H A       +  +L+ +   I+ +  + + PLH A  +G+  +  LL+ V    ++ K      P+H+A Q  H + A+ L+     ++ +     +P+  A + G + +AKLL+    D N        P+H A      +V  +L+  +  IE  T     P+ +A+    + IV  L+    N        E P+H+A +    +VV++LI N   ++    +L  P+HIAS  G  +IV +LL+ GA++N       +PL++A ++G  +V+ +L+D+  +    + K + P+H A + G  E+ +LL++    +D E  N+  P+H+A    N  +  LL+++G++ +   ++   P+H A +   +++   L+      + K+ A  TPL L    G+ +    L
Sbjct:  228 FTPLHIAAHYGHENVGQLLL--EKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 3 Score: 181.8 bits (460), Expect = 7.408e-46
Identity = 126/526 (23.95%), Postives = 235/526 (44.68%), Query Frame = 3
Query:  441 AGVDVSNS*LLT*KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCK--------------NDEEMF-------------------PLHYACTNGNKAIAQLLID--------VPDCNVNCKNAEES--------------------QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            AG D++ S        +LH A ++G+ ++VR L+  K Q +++ AT+  N A+H A ++    IV IL+     +N +              N EE+                    PL  A   G+  +  +L++        +P  ++  K  + +                     P+H+A  +GH  + +LL+EK   +N   +   SP+  A   G+  +A LL++    I+  T+    P+H A+  G  +V  +L+ +   I  +T     P+ +A+  ++V+  R L+ +   +  +  +   P+HVA   G V V +LL+D   + N        P+HIA +  R+++V++LL++ A          TPL++A   G  ++   L+  G N + ++++   P+H A +    ++ ++L+ +   +D +    Q P+H+A   GN +IV LL+  G+N     R N  P+H A + G  ++   L+ +N           TPL L   +G  + V  L
Sbjct:   55 AGTDINTS--NANGLNSLHLASKEGHSEVVRELI--KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 4 Score: 165.622 bits (418), Expect = 6.160e-41
Identity = 104/466 (22.32%), Postives = 206/466 (44.21%), Query Frame = 3
Query:  525 IVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEI-----------------------------AKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ++ LL +G     IN +  +   ++H A      E+V  LI ++ +++    +    LH A   G   I  +L++    NVN ++     P+++A Q  H E+ K L++         +  F+P+  AL  G   +                             A LL+ N+ + + ++++   P+H A+  G   V  +L+++  ++  +      P+ +A+      +  LL++    I     +   P+H A + G  +VV LL+     I+      + P+H+A++   V+  + LL H A  + +     TPL++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    +I+   ++   P+H+A   G +NIV  L+  G+N +      + P+H A      D+++ L+ N   +  +     TPL +    G  D V  L
Sbjct:   49 VLELLRAG---TDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVEN-GANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL 510          

HSP 5 Score: 133.265 bits (334), Expect = 5.697e-31
Identity = 96/424 (22.64%), Postives = 190/424 (44.81%), Query Frame = 3
Query:  780 AEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL--------SKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPIN 2027
            AE S     A + G  E    L+    ++N+ N    + +  A   G  E+ + LI  +  ++ +TR     +H AS  G + +  +L++   ++  +++    P+++A+  N+ E+V+ L+ +  N     ++   P+ VA Q+G   VV +L++N    +      +  +HIA++        +LL++  + +       TPL++A   GH +V ++L++ G N+  Q+     P+H A + G   +A LL+     ID+   +   P+H A  SG+  +V LLV  G+ +    ++   P+H A +  ++D  + L+++   +        TPL +    G+      L        S+ L+    +    + + I     L           ++GL+ L VA    +  I+ Y+L Q  N
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGAN 450          
BLAST of SMED30013027 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 202.601 bits (514), Expect = 2.670e-52
Identity = 122/454 (26.87%), Postives = 224/454 (49.34%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRR---PIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             T LH A   G+  + +LL+        N    +    +H AC     ++VE+L+  +  I    +  + PLH A   G   I   L+     N + +      P+HLA +    ++ ++LI    ++++  ++  +P+  A   G  +I  LL+    + N +TR    P+H A+  G  EVA +L+D   D   +T+L ++   P+ +AS   N+E+VRLL+     +         P+HVA      +V  LL++N  +   A      P+HIA++  ++EI   LL+  AD N       TPL+L+ ++GH ++S +LI+NG ++  ++      +H   Q     +AQ+L ++   I+++ +    P+H+AC  G LN+VK LV++G+++    R++  P+H A + G+ + ++ L+ N  + + +     TPL + +  GY   V  L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLD--RSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ-GANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD---KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 187.578 bits (475), Expect = 1.367e-47
Identity = 112/451 (24.83%), Postives = 216/451 (47.89%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A   G+ ++ +LL+  +    +N   +     +H A       +  +L+ +   I+ +  + + PLH A  +G+  +  LL+ V    ++ K      P+H+A Q  H + A+ L+     ++ +     +P+  A + G + +AKLL+    D N        P+H A      +V  +L+  +  IE  T     P+ +A+    + IV  L+    N        E P+H+A +    +VV++LI N   ++    +L  P+HIAS  G  +IV +LL+ GA++N       +PL++A ++G  +V+ +L+D+  +    + K + P+H A + G  E+ +LL++    +D E  N+  P+H+A    N  +  LL+++G++ +   ++   P+H A +   +++   L+      + K+ A  TPL L    G+ +    L
Sbjct:  228 FTPLHIAAHYGHENVGQLLL--EKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 3 Score: 181.8 bits (460), Expect = 7.408e-46
Identity = 126/526 (23.95%), Postives = 235/526 (44.68%), Query Frame = 3
Query:  441 AGVDVSNS*LLT*KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCK--------------NDEEMF-------------------PLHYACTNGNKAIAQLLID--------VPDCNVNCKNAEES--------------------QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            AG D++ S        +LH A ++G+ ++VR L+  K Q +++ AT+  N A+H A ++    IV IL+     +N +              N EE+                    PL  A   G+  +  +L++        +P  ++  K  + +                     P+H+A  +GH  + +LL+EK   +N   +   SP+  A   G+  +A LL++    I+  T+    P+H A+  G  +V  +L+ +   I  +T     P+ +A+  ++V+  R L+ +   +  +  +   P+HVA   G V V +LL+D   + N        P+HIA +  R+++V++LL++ A          TPL++A   G  ++   L+  G N + ++++   P+H A +    ++ ++L+ +   +D +    Q P+H+A   GN +IV LL+  G+N     R N  P+H A + G  ++   L+ +N           TPL L   +G  + V  L
Sbjct:   55 AGTDINTS--NANGLNSLHLASKEGHSEVVRELI--KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 4 Score: 165.622 bits (418), Expect = 6.160e-41
Identity = 104/466 (22.32%), Postives = 206/466 (44.21%), Query Frame = 3
Query:  525 IVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEI-----------------------------AKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ++ LL +G     IN +  +   ++H A      E+V  LI ++ +++    +    LH A   G   I  +L++    NVN ++     P+++A Q  H E+ K L++         +  F+P+  AL  G   +                             A LL+ N+ + + ++++   P+H A+  G   V  +L+++  ++  +      P+ +A+      +  LL++    I     +   P+H A + G  +VV LL+     I+      + P+H+A++   V+  + LL H A  + +     TPL++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    +I+   ++   P+H+A   G +NIV  L+  G+N +      + P+H A      D+++ L+ N   +  +     TPL +    G  D V  L
Sbjct:   49 VLELLRAG---TDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVEN-GANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL 510          

HSP 5 Score: 133.265 bits (334), Expect = 5.697e-31
Identity = 96/424 (22.64%), Postives = 190/424 (44.81%), Query Frame = 3
Query:  780 AEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL--------SKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPIN 2027
            AE S     A + G  E    L+    ++N+ N    + +  A   G  E+ + LI  +  ++ +TR     +H AS  G + +  +L++   ++  +++    P+++A+  N+ E+V+ L+ +  N     ++   P+ VA Q+G   VV +L++N    +      +  +HIA++        +LL++  + +       TPL++A   GH +V ++L++ G N+  Q+     P+H A + G   +A LL+     ID+   +   P+H A  SG+  +V LLV  G+ +    ++   P+H A +  ++D  + L+++   +        TPL +    G+      L        S+ L+    +    + + I     L           ++GL+ L VA    +  I+ Y+L Q  N
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGAN 450          
BLAST of SMED30013027 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 202.216 bits (513), Expect = 3.591e-52
Identity = 122/454 (26.87%), Postives = 224/454 (49.34%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRR---PIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             T LH A   G+  + +LL+        N    +    +H AC     ++VE+L+  +  I    +  + PLH A   G   I   L+     N + +      P+HLA +    ++ ++LI    ++++  ++  +P+  A   G  +I  LL+    + N +TR    P+H A+  G  EVA +L+D   D   +T+L ++   P+ +AS   N+E+VRLL+     +         P+HVA      +V  LL++N  +   A      P+HIA++  ++EI   LL+  AD N       TPL+L+ ++GH ++S +LI+NG ++  ++      +H   Q     +AQ+L ++   I+++ +    P+H+AC  G LN+VK LV++G+++    R++  P+H A + G+ + ++ L+ N  + + +     TPL + +  GY   V  L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLD--RSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ-GANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD---KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 187.193 bits (474), Expect = 1.617e-47
Identity = 112/451 (24.83%), Postives = 216/451 (47.89%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A   G+ ++ +LL+  +    +N   +     +H A       +  +L+ +   I+ +  + + PLH A  +G+  +  LL+ V    ++ K      P+H+A Q  H + A+ L+     ++ +     +P+  A + G + +AKLL+    D N        P+H A      +V  +L+  +  IE  T     P+ +A+    + IV  L+    N        E P+H+A +    +VV++LI N   ++    +L  P+HIAS  G  +IV +LL+ GA++N       +PL++A ++G  +V+ +L+D+  +    + K + P+H A + G  E+ +LL++    +D E  N+  P+H+A    N  +  LL+++G++ +   ++   P+H A +   +++   L+      + K+ A  TPL L    G+ +    L
Sbjct:  228 FTPLHIAAHYGHENVGQLLL--EKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 3 Score: 181.415 bits (459), Expect = 9.713e-46
Identity = 126/526 (23.95%), Postives = 235/526 (44.68%), Query Frame = 3
Query:  441 AGVDVSNS*LLT*KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCK--------------NDEEMF-------------------PLHYACTNGNKAIAQLLID--------VPDCNVNCKNAEES--------------------QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            AG D++ S        +LH A ++G+ ++VR L+  K Q +++ AT+  N A+H A ++    IV IL+     +N +              N EE+                    PL  A   G+  +  +L++        +P  ++  K  + +                     P+H+A  +GH  + +LL+EK   +N   +   SP+  A   G+  +A LL++    I+  T+    P+H A+  G  +V  +L+ +   I  +T     P+ +A+  ++V+  R L+ +   +  +  +   P+HVA   G V V +LL+D   + N        P+HIA +  R+++V++LL++ A          TPL++A   G  ++   L+  G N + ++++   P+H A +    ++ ++L+ +   +D +    Q P+H+A   GN +IV LL+  G+N     R N  P+H A + G  ++   L+ +N           TPL L   +G  + V  L
Sbjct:   55 AGTDINTS--NANGLNSLHLASKEGHSEVVRELI--KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 4 Score: 165.622 bits (418), Expect = 6.934e-41
Identity = 104/466 (22.32%), Postives = 206/466 (44.21%), Query Frame = 3
Query:  525 IVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEI-----------------------------AKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ++ LL +G     IN +  +   ++H A      E+V  LI ++ +++    +    LH A   G   I  +L++    NVN ++     P+++A Q  H E+ K L++         +  F+P+  AL  G   +                             A LL+ N+ + + ++++   P+H A+  G   V  +L+++  ++  +      P+ +A+      +  LL++    I     +   P+H A + G  +VV LL+     I+      + P+H+A++   V+  + LL H A  + +     TPL++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    +I+   ++   P+H+A   G +NIV  L+  G+N +      + P+H A      D+++ L+ N   +  +     TPL +    G  D V  L
Sbjct:   49 VLELLRAG---TDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVEN-GANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL 510          

HSP 5 Score: 132.88 bits (333), Expect = 6.820e-31
Identity = 96/424 (22.64%), Postives = 190/424 (44.81%), Query Frame = 3
Query:  780 AEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL--------SKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPIN 2027
            AE S     A + G  E    L+    ++N+ N    + +  A   G  E+ + LI  +  ++ +TR     +H AS  G + +  +L++   ++  +++    P+++A+  N+ E+V+ L+ +  N     ++   P+ VA Q+G   VV +L++N    +      +  +HIA++        +LL++  + +       TPL++A   GH +V ++L++ G N+  Q+     P+H A + G   +A LL+     ID+   +   P+H A  SG+  +V LLV  G+ +    ++   P+H A +  ++D  + L+++   +        TPL +    G+      L        S+ L+    +    + + I     L           ++GL+ L VA    +  I+ Y+L Q  N
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGAN 450          
BLAST of SMED30013027 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 202.216 bits (513), Expect = 3.591e-52
Identity = 122/454 (26.87%), Postives = 224/454 (49.34%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRR---PIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             T LH A   G+  + +LL+        N    +    +H AC     ++VE+L+  +  I    +  + PLH A   G   I   L+     N + +      P+HLA +    ++ ++LI    ++++  ++  +P+  A   G  +I  LL+    + N +TR    P+H A+  G  EVA +L+D   D   +T+L ++   P+ +AS   N+E+VRLL+     +         P+HVA      +V  LL++N  +   A      P+HIA++  ++EI   LL+  AD N       TPL+L+ ++GH ++S +LI+NG ++  ++      +H   Q     +AQ+L ++   I+++ +    P+H+AC  G LN+VK LV++G+++    R++  P+H A + G+ + ++ L+ N  + + +     TPL + +  GY   V  L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLD--RSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ-GANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD---KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 187.193 bits (474), Expect = 1.617e-47
Identity = 112/451 (24.83%), Postives = 216/451 (47.89%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A   G+ ++ +LL+  +    +N   +     +H A       +  +L+ +   I+ +  + + PLH A  +G+  +  LL+ V    ++ K      P+H+A Q  H + A+ L+     ++ +     +P+  A + G + +AKLL+    D N        P+H A      +V  +L+  +  IE  T     P+ +A+    + IV  L+    N        E P+H+A +    +VV++LI N   ++    +L  P+HIAS  G  +IV +LL+ GA++N       +PL++A ++G  +V+ +L+D+  +    + K + P+H A + G  E+ +LL++    +D E  N+  P+H+A    N  +  LL+++G++ +   ++   P+H A +   +++   L+      + K+ A  TPL L    G+ +    L
Sbjct:  228 FTPLHIAAHYGHENVGQLLL--EKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 3 Score: 181.415 bits (459), Expect = 9.713e-46
Identity = 126/526 (23.95%), Postives = 235/526 (44.68%), Query Frame = 3
Query:  441 AGVDVSNS*LLT*KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCK--------------NDEEMF-------------------PLHYACTNGNKAIAQLLID--------VPDCNVNCKNAEES--------------------QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            AG D++ S        +LH A ++G+ ++VR L+  K Q +++ AT+  N A+H A ++    IV IL+     +N +              N EE+                    PL  A   G+  +  +L++        +P  ++  K  + +                     P+H+A  +GH  + +LL+EK   +N   +   SP+  A   G+  +A LL++    I+  T+    P+H A+  G  +V  +L+ +   I  +T     P+ +A+  ++V+  R L+ +   +  +  +   P+HVA   G V V +LL+D   + N        P+HIA +  R+++V++LL++ A          TPL++A   G  ++   L+  G N + ++++   P+H A +    ++ ++L+ +   +D +    Q P+H+A   GN +IV LL+  G+N     R N  P+H A + G  ++   L+ +N           TPL L   +G  + V  L
Sbjct:   55 AGTDINTS--NANGLNSLHLASKEGHSEVVRELI--KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 4 Score: 165.622 bits (418), Expect = 6.934e-41
Identity = 104/466 (22.32%), Postives = 206/466 (44.21%), Query Frame = 3
Query:  525 IVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEI-----------------------------AKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ++ LL +G     IN +  +   ++H A      E+V  LI ++ +++    +    LH A   G   I  +L++    NVN ++     P+++A Q  H E+ K L++         +  F+P+  AL  G   +                             A LL+ N+ + + ++++   P+H A+  G   V  +L+++  ++  +      P+ +A+      +  LL++    I     +   P+H A + G  +VV LL+     I+      + P+H+A++   V+  + LL H A  + +     TPL++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    +I+   ++   P+H+A   G +NIV  L+  G+N +      + P+H A      D+++ L+ N   +  +     TPL +    G  D V  L
Sbjct:   49 VLELLRAG---TDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVEN-GANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL 510          

HSP 5 Score: 132.88 bits (333), Expect = 6.820e-31
Identity = 96/424 (22.64%), Postives = 190/424 (44.81%), Query Frame = 3
Query:  780 AEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL--------SKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPIN 2027
            AE S     A + G  E    L+    ++N+ N    + +  A   G  E+ + LI  +  ++ +TR     +H AS  G + +  +L++   ++  +++    P+++A+  N+ E+V+ L+ +  N     ++   P+ VA Q+G   VV +L++N    +      +  +HIA++        +LL++  + +       TPL++A   GH +V ++L++ G N+  Q+     P+H A + G   +A LL+     ID+   +   P+H A  SG+  +V LLV  G+ +    ++   P+H A +  ++D  + L+++   +        TPL +    G+      L        S+ L+    +    + + I     L           ++GL+ L VA    +  I+ Y+L Q  N
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGAN 450          
BLAST of SMED30013027 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 201.83 bits (512), Expect = 4.605e-52
Identity = 122/454 (26.87%), Postives = 224/454 (49.34%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRR---PIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             T LH A   G+  + +LL+        N    +    +H AC     ++VE+L+  +  I    +  + PLH A   G   I   L+     N + +      P+HLA +    ++ ++LI    ++++  ++  +P+  A   G  +I  LL+    + N +TR    P+H A+  G  EVA +L+D   D   +T+L ++   P+ +AS   N+E+VRLL+     +         P+HVA      +V  LL++N  +   A      P+HIA++  ++EI   LL+  AD N       TPL+L+ ++GH ++S +LI+NG ++  ++      +H   Q     +AQ+L ++   I+++ +    P+H+AC  G LN+VK LV++G+++    R++  P+H A + G+ + ++ L+ N  + + +     TPL + +  GY   V  L
Sbjct:  360 LTPLHVAAHCGHVRVAKLLLD--RSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQ-GANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNAD---KTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 2 Score: 186.808 bits (473), Expect = 2.175e-47
Identity = 112/451 (24.83%), Postives = 216/451 (47.89%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A   G+ ++ +LL+  +    +N   +     +H A       +  +L+ +   I+ +  + + PLH A  +G+  +  LL+ V    ++ K      P+H+A Q  H + A+ L+     ++ +     +P+  A + G + +AKLL+    D N        P+H A      +V  +L+  +  IE  T     P+ +A+    + IV  L+    N        E P+H+A +    +VV++LI N   ++    +L  P+HIAS  G  +IV +LL+ GA++N       +PL++A ++G  +V+ +L+D+  +    + K + P+H A + G  E+ +LL++    +D E  N+  P+H+A    N  +  LL+++G++ +   ++   P+H A +   +++   L+      + K+ A  TPL L    G+ +    L
Sbjct:  228 FTPLHIAAHYGHENVGQLLL--EKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV-VQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLL 675          

HSP 3 Score: 181.03 bits (458), Expect = 1.208e-45
Identity = 126/526 (23.95%), Postives = 235/526 (44.68%), Query Frame = 3
Query:  441 AGVDVSNS*LLT*KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCK--------------NDEEMF-------------------PLHYACTNGNKAIAQLLID--------VPDCNVNCKNAEES--------------------QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            AG D++ S        +LH A ++G+ ++VR L+  K Q +++ AT+  N A+H A ++    IV IL+     +N +              N EE+                    PL  A   G+  +  +L++        +P  ++  K  + +                     P+H+A  +GH  + +LL+EK   +N   +   SP+  A   G+  +A LL++    I+  T+    P+H A+  G  +V  +L+ +   I  +T     P+ +A+  ++V+  R L+ +   +  +  +   P+HVA   G V V +LL+D   + N        P+HIA +  R+++V++LL++ A          TPL++A   G  ++   L+  G N + ++++   P+H A +    ++ ++L+ +   +D +    Q P+H+A   GN +IV LL+  G+N     R N  P+H A + G  ++   L+ +N           TPL L   +G  + V  L
Sbjct:   55 AGTDINTS--NANGLNSLHLASKEGHSEVVRELI--KRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLL 576          

HSP 4 Score: 165.236 bits (417), Expect = 9.437e-41
Identity = 104/466 (22.32%), Postives = 206/466 (44.21%), Query Frame = 3
Query:  525 IVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEI-----------------------------AKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ++ LL +G     IN +  +   ++H A      E+V  LI ++ +++    +    LH A   G   I  +L++    NVN ++     P+++A Q  H E+ K L++         +  F+P+  AL  G   +                             A LL+ N+ + + ++++   P+H A+  G   V  +L+++  ++  +      P+ +A+      +  LL++    I     +   P+H A + G  +VV LL+     I+      + P+H+A++   V+  + LL H A  + +     TPL++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    +I+   ++   P+H+A   G +NIV  L+  G+N +      + P+H A      D+++ L+ N   +  +     TPL +    G  D V  L
Sbjct:   49 VLELLRAG---TDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVEN-GANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILL 510          

HSP 5 Score: 132.494 bits (332), Expect = 9.539e-31
Identity = 96/424 (22.64%), Postives = 190/424 (44.81%), Query Frame = 3
Query:  780 AEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL--------SKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPIN 2027
            AE S     A + G  E    L+    ++N+ N    + +  A   G  E+ + LI  +  ++ +TR     +H AS  G + +  +L++   ++  +++    P+++A+  N+ E+V+ L+ +  N     ++   P+ VA Q+G   VV +L++N    +      +  +HIA++        +LL++  + +       TPL++A   GH +V ++L++ G N+  Q+     P+H A + G   +A LL+     ID+   +   P+H A  SG+  +V LLV  G+ +    ++   P+H A +  ++D  + L+++   +        TPL +    G+      L        S+ L+    +    + + I     L           ++GL+ L VA    +  I+ Y+L Q  N
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGAN 450          
BLAST of SMED30013027 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 195.282 bits (495), Expect = 1.209e-52
Identity = 115/452 (25.44%), Postives = 217/452 (48.01%), Query Frame = 3
Query:  483 FTALHYACQQGN-HDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
              ALH A + G+ H +  LL  G +   ++ ATK  N A+H A ++  EE+V++L+     +N ++     PL+ A    + A+ +LL+     N +    +   P+ +A Q GH ++  +L+E +       K     +  A     ++ A LL+ N  + + ++++   P+H AS  G   +A++LI +  D+         P+ +A+      +V LL+    NI+    +   P+H A + G  +VV +L++    I+      + P+H+A++   V+  +ILL H A  + +     T L++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    SI    ++   P+H+A   G +NIV  L+ H ++ + P    + P+H A      D+I+ L+ N   +  +     TPL +    G  D V  L
Sbjct:   45 LNALHLASKDGHIHVVSELLRRGAI---VDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLS-NGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR----GKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 488          

HSP 2 Score: 179.104 bits (453), Expect = 3.652e-47
Identity = 115/420 (27.38%), Postives = 209/420 (49.76%), Query Frame = 3
Query:  483 FTALHYACQQGNHD-IVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALV 1739
            FT L+ A Q+ NHD +VRLL+S      +  AT+     +  A     +++V +L+    E + +    +  LH A    +   A LL+D  D N +  +     P+H+A  +G+  IA LLI+K  ++N   K   SP+  A   G+  +  LL+    +I   TR    P+H A+  G  +V  ML++R   I  +T     P+ +A+   +V+  R+L+ +   +  +  +    +HVA   G V V +LL+D + + N        P+HIA +  R+++V++LL HGA  +       TPL++A   G  ++   L+ +  + +  +++   P+H A +    +I ++L+ +   +D     +Q P+H+A   GN++IV LL+ HG+ ++   +     +H A + G  D +K L+
Sbjct:  111 FTPLYMAAQE-NHDAVVRLLLSNGANQSL--ATEDGFTPLAVAMQQGHDKVVAVLL----ESDTRGKVRLPALHIAAKKDDVKAATLLLD-NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQ-DEVKDLI 521          

HSP 3 Score: 129.028 bits (323), Expect = 1.336e-30
Identity = 88/405 (21.73%), Postives = 172/405 (42.47%), Query Frame = 3
Query:  807 ACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVV-----------------------------QLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSS---------------------------------GNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A + G+ E     ++ N ++N+ N    + +  A   G I +   L+     ++ +T+     +H AS  G  EV  +L++    +  ++     P+++A+  N+  +VRLL++N  N     ++   P+ VA Q+G  +VV                              LL+DN  N +  +     P+HIAS  G   I  +L++ GAD N    +  +PL++A + G  ++  +L++ G NIE ++     P+H A ++G  ++  +L++    I  +  N   P+H+A                                    G++ + KLL+D  ++      +   P+H AC+   L +++ L+ +  +I     +  TPL +    G  + V +L
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYL 422          

HSP 4 Score: 123.635 bits (309), Expect = 7.039e-29
Identity = 87/335 (25.97%), Postives = 150/335 (44.78%), Query Frame = 3
Query:  891 SPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDI 1892
            +  L A  +G +E     + N  DIN S       +H AS  G   V   L+ R   ++  T      + IAS     E+V+LL+ ++ ++   +     P+++A Q+    VV+LL+ N  N + A +    P+ +A + G  ++V +LLE  +DT       R P L++A +K     + +L+DN  N +  S   + P+H A   G   IA LL+     ++    +   P+H+A   G  N+V LL++ G N+E   R    P+H A  +G+  ++  L+     I  K      PL +     + D    L         ++HR   D++
Sbjct:   13 TSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLE--SDTRG---KVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL---------LYHRAPVDEV 333          
BLAST of SMED30013027 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303120)

HSP 1 Score: 191.045 bits (484), Expect = 3.799e-50
Identity = 115/452 (25.44%), Postives = 217/452 (48.01%), Query Frame = 3
Query:  483 FTALHYACQQGN-HDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
              ALH A + G+ H +  LL  G +   ++ ATK  N A+H A ++  EE+V++L+     +N ++     PL+ A    + A+ +LL+     N +    +   P+ +A Q GH ++  +L+E +       K     +  A     ++ A LL+ N  + + ++++   P+H AS  G   +A++LI +  D+         P+ +A+      +V LL+    NI+    +   P+H A + G  +VV +L++    I+      + P+H+A++   V+  +ILL H A  + +     T L++A   GH  V+K+L+D   +   +++  + P+H AC+    ++ +LL+    SI    ++   P+H+A   G +NIV  L+ H ++ + P    + P+H A      D+I+ L+ N   +  +     TPL +    G  D V  L
Sbjct:  195 LNALHLASKDGHIHVVSELLRRGAI---VDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLS-NGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR----GKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLL 638          

HSP 2 Score: 175.637 bits (444), Expect = 4.294e-45
Identity = 115/420 (27.38%), Postives = 209/420 (49.76%), Query Frame = 3
Query:  483 FTALHYACQQGNHD-IVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALV 1739
            FT L+ A Q+ NHD +VRLL+S      +  AT+     +  A     +++V +L+    E + +    +  LH A    +   A LL+D  D N +  +     P+H+A  +G+  IA LLI+K  ++N   K   SP+  A   G+  +  LL+    +I   TR    P+H A+  G  +V  ML++R   I  +T     P+ +A+   +V+  R+L+ +   +  +  +    +HVA   G V V +LL+D + + N        P+HIA +  R+++V++LL HGA  +       TPL++A   G  ++   L+ +  + +  +++   P+H A +    +I ++L+ +   +D     +Q P+H+A   GN++IV LL+ HG+ ++   +     +H A + G  D +K L+
Sbjct:  261 FTPLYMAAQE-NHDAVVRLLLSNGANQSL--ATEDGFTPLAVAMQQGHDKVVAVLL----ESDTRGKVRLPALHIAAKKDDVKAATLLLD-NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQ-DEVKDLI 671          

HSP 3 Score: 128.257 bits (321), Expect = 7.123e-30
Identity = 97/452 (21.46%), Postives = 189/452 (41.81%), Query Frame = 3
Query:  681 EEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEES-----QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVV-----------------------------QLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSS---------------------------------GNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            E++F  H+   NG  +  Q     P+ + +C    +S          A + G+ E     ++ N ++N+ N    + +  A   G I +   L+     ++ +T+     +H AS  G  EV  +L++    +  ++     P+++A+  N+  +VRLL++N  N     ++   P+ VA Q+G  +VV                              LL+DN  N +  +     P+HIAS  G   I  +L++ GAD N    +  +PL++A + G  ++  +L++ G NIE ++     P+H A ++G  ++  +L++    I  +  N   P+H+A                                    G++ + KLL+D  ++      +   P+H AC+   L +++ L+ +  +I     +  TPL +    G  + V +L
Sbjct:  123 EQIF--HHEGANGGASHKQQTHHHPNKHEHCPTGHQSAGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYL 572          

HSP 4 Score: 121.709 bits (304), Expect = 8.578e-28
Identity = 87/333 (26.13%), Postives = 149/333 (44.74%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIV 1895
            L A  +G +E     + N  DIN S       +H AS  G   V   L+ R   ++  T      + IAS     E+V+LL+ ++ ++   +     P+++A Q+    VV+LL+ N  N + A +    P+ +A + G  ++V +LLE  +DT       R P L++A +K     + +L+DN  N +  S   + P+H A   G   IA LL+     ++    +   P+H+A   G  N+V LL++ G N+E   R    P+H A  +G+  ++  L+     I  K      PL +     + D    L         ++HR   D++ 
Sbjct:  166 LRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLE--SDTRGKV---RLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL---------LYHRAPVDEVT 484          
BLAST of SMED30013027 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 194.126 bits (492), Expect = 1.155e-49
Identity = 137/490 (27.96%), Postives = 235/490 (47.96%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID----VPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVR-------------HDDIVKF 1901
             T LH AC+ G   +  LL+      KI+ AT+     +H A  S   E+++ L+ +   I  K    +  LH A    +   A LL+D    V +  V+   A     +H+A   GH ++AKLL++     N+     F+P+  A    +I++ +LLI +  +I  +T +   P+H AS +G   +   L+  +   +  TI    P+ +A+  N  +I+R+L+ +   +  I  E + P+HVA + G + ++ LL+ +   IN  ++     +HIA++ G+  IV++LLE+GA+ N +     TPL+LA + G  +V ++L+ NG +I+ Q      P+H A       I +LL+ +  S +    N Q  IH+AC    L I   L+ HG+++    +S   P+H A + GN+D+++ L+     I        TPL +    G+   V     +L+    I  R R             H D+VKF
Sbjct:  268 ITPLHVACKWGKLSLCTLLLCRG--AKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTA-----LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGH---VLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKF 745          

HSP 2 Score: 176.022 bits (445), Expect = 4.528e-44
Identity = 108/418 (25.84%), Postives = 204/418 (48.80%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKAL 1736
            FT LH AC++    +V LL+  K    I   T+S    +H A       IV  L+  +   +        PLH A       I ++L+      V+    E   P+H+A + G+  I  LL++   E+N+ +  ++S +  A   GQ  I ++L+ N  + N  T+    P+H A   G   V  +L+     I+ +      P+ +A+  NN  IV LL+ N  +        +  IH+AC+K ++E+   L+ +  ++N  +     P+H+A++ G V++V++LLE+G   +       TPL++A ++GH  VS++L+++G NI  ++   + P+H A   G  ++ +  +++   I+  ++    P+H A   G++ I+ LL+ H +N     +     +H A   G + ++++L
Sbjct:  400 FTPLHIACKKNRIKMVELLI--KHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLR--SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 3 Score: 164.081 bits (414), Expect = 2.527e-40
Identity = 120/509 (23.58%), Postives = 224/509 (44.01%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLI----------------------TNKCDI----------NCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIAS----------------------ENGR-----------VEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGY 1814
             T LH A + G+ ++++ L+  +    I   TK+   A+H A   E +E   +L+  K  ++    + +  LH A   G+  +A+LL+D    N N +      P+H+AC+    ++ +LLI+    + +  +   +P+  A   G I I   L+                       N+ DI          +   R  + P+H AS LG   +  +L+    +I  ++  K   + IA+      IV++L+ N      +  +   P+H+AC+ G   VVQ+L+ N  +I+      + P+H+A+                       NG+           +EI   LL+HGAD N I     +PL+LA + G+ D+ ++L++ G  I   +     P+H A Q G   ++Q+L++   +I     N   P+H+A   G+L++VK  +++ +++E        P+H A + G++ +I  L+ +    +      +T L +    GY
Sbjct:  301 LTPLHCASRSGHVEVIKHLL--QQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDY-KANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGY 805          

HSP 4 Score: 160.614 bits (405), Expect = 2.528e-39
Identity = 128/514 (24.90%), Postives = 227/514 (44.16%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIV-RLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEI-----------------------------AKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITN---------------HCNIKCINDE-------NEQPI-----------HVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
              ALH A + G  DI   LL  G    KI++ATK  N A+H A ++   +++  LI     +N ++     PL+ A    +    + L+     N +    +   P+ +A Q GH +I                             AKLL++ +   + ++K  F+P+  A + G ++IA LL+ NK D+N   +    P+H A   G   +  +L+ R   I+  T     P+  AS + +VE+++ L+                 H   +  +DE       N+ P+           HVA   G V+V +LL+D   N N        P+HIA +  R+++V++L++HGA+         TPL++A+  G  ++   L+ +  + +  +I+   P+H A +    +I ++L+ S   +D      Q P+H+A   GN+NI+ LL+ HG+ +          +H A + G  ++++ L+ N    +       TPL L   +G  + V  L
Sbjct:   74 LNALHLAAKDGYVDICCELLRRG---IKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLL-ANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQIL 582          

HSP 5 Score: 121.324 bits (303), Expect = 3.130e-27
Identity = 94/392 (23.98%), Postives = 180/392 (45.92%), Query Frame = 3
Query:  747 DVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFAS---------TL-------------GFTEVAHMLI---DRQCDIECETILK---RRP-IFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            D+  CN N  NA     +HLA + G+ +I   L+ +  ++++  K+  + +  A  +GQ ++   LI    ++N  +     P++ A+         TL             GFT +A  +    D+   +  E  ++   R P + IA+  N+V   +LL+ +  N   ++     P+H+A   G V++  LL++N  ++N      + P+H+A + G++ +  +LL  GA  +       TPL+ A+  GH +V K L+     I  ++      +H A Q    E A LL+D+   +D    +    +H+A   G++ + KLL+D+ +N      +   P+H AC+   + +++ L+ +   I     +  TPL +    G  + V +L
Sbjct:   65 DINSCNANGLNA-----LHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYL 451          

HSP 6 Score: 90.1225 bits (222), Expect = 1.056e-17
Identity = 75/312 (24.04%), Postives = 141/312 (45.19%), Query Frame = 3
Query: 1149 NHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANREIF------HRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILD--QPINYQEIRFL 2048
            N CN   +N      +H+A + G+V++   L+     I+ A  K    +HIAS  G+ +++  L+ + A+ N       TPLY+A ++ H +  + L+ NG N    +   + P+  A Q G  +I  +L+++    D     +   +H+A    ++N  KLL+ H  N +   +S   P+H A   GN+D+   L++N   ++     + TPL +   +G     + L    +K+  A R+         R  H +++K   L   +   + +   GLS L +A         + +LD   P++   + +L
Sbjct:   67 NSCNANGLN-----ALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIK--HLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYL 367          
BLAST of SMED30013027 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 194.126 bits (492), Expect = 1.155e-49
Identity = 137/490 (27.96%), Postives = 235/490 (47.96%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID----VPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVR-------------HDDIVKF 1901
             T LH AC+ G   +  LL+      KI+ AT+     +H A  S   E+++ L+ +   I  K    +  LH A    +   A LL+D    V +  V+   A     +H+A   GH ++AKLL++     N+     F+P+  A    +I++ +LLI +  +I  +T +   P+H AS +G   +   L+  +   +  TI    P+ +A+  N  +I+R+L+ +   +  I  E + P+HVA + G + ++ LL+ +   IN  ++     +HIA++ G+  IV++LLE+GA+ N +     TPL+LA + G  +V ++L+ NG +I+ Q      P+H A       I +LL+ +  S +    N Q  IH+AC    L I   L+ HG+++    +S   P+H A + GN+D+++ L+     I        TPL +    G+   V     +L+    I  R R             H D+VKF
Sbjct:  268 ITPLHVACKWGKLSLCTLLLCRG--AKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTA-----LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGH---VLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKF 745          

HSP 2 Score: 176.022 bits (445), Expect = 4.528e-44
Identity = 108/418 (25.84%), Postives = 204/418 (48.80%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKAL 1736
            FT LH AC++    +V LL+  K    I   T+S    +H A       IV  L+  +   +        PLH A       I ++L+      V+    E   P+H+A + G+  I  LL++   E+N+ +  ++S +  A   GQ  I ++L+ N  + N  T+    P+H A   G   V  +L+     I+ +      P+ +A+  NN  IV LL+ N  +        +  IH+AC+K ++E+   L+ +  ++N  +     P+H+A++ G V++V++LLE+G   +       TPL++A ++GH  VS++L+++G NI  ++   + P+H A   G  ++ +  +++   I+  ++    P+H A   G++ I+ LL+ H +N     +     +H A   G + ++++L
Sbjct:  400 FTPLHIACKKNRIKMVELLI--KHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLR--SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 3 Score: 164.081 bits (414), Expect = 2.527e-40
Identity = 120/509 (23.58%), Postives = 224/509 (44.01%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLI----------------------TNKCDI----------NCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIAS----------------------ENGR-----------VEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGY 1814
             T LH A + G+ ++++ L+  +    I   TK+   A+H A   E +E   +L+  K  ++    + +  LH A   G+  +A+LL+D    N N +      P+H+AC+    ++ +LLI+    + +  +   +P+  A   G I I   L+                       N+ DI          +   R  + P+H AS LG   +  +L+    +I  ++  K   + IA+      IV++L+ N      +  +   P+H+AC+ G   VVQ+L+ N  +I+      + P+H+A+                       NG+           +EI   LL+HGAD N I     +PL+LA + G+ D+ ++L++ G  I   +     P+H A Q G   ++Q+L++   +I     N   P+H+A   G+L++VK  +++ +++E        P+H A + G++ +I  L+ +    +      +T L +    GY
Sbjct:  301 LTPLHCASRSGHVEVIKHLL--QQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDY-KANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGY 805          

HSP 4 Score: 160.614 bits (405), Expect = 2.528e-39
Identity = 128/514 (24.90%), Postives = 227/514 (44.16%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIV-RLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEI-----------------------------AKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITN---------------HCNIKCINDE-------NEQPI-----------HVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
              ALH A + G  DI   LL  G    KI++ATK  N A+H A ++   +++  LI     +N ++     PL+ A    +    + L+     N +    +   P+ +A Q GH +I                             AKLL++ +   + ++K  F+P+  A + G ++IA LL+ NK D+N   +    P+H A   G   +  +L+ R   I+  T     P+  AS + +VE+++ L+                 H   +  +DE       N+ P+           HVA   G V+V +LL+D   N N        P+HIA +  R+++V++L++HGA+         TPL++A+  G  ++   L+ +  + +  +I+   P+H A +    +I ++L+ S   +D      Q P+H+A   GN+NI+ LL+ HG+ +          +H A + G  ++++ L+ N    +       TPL L   +G  + V  L
Sbjct:   74 LNALHLAAKDGYVDICCELLRRG---IKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLL-ANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQIL 582          

HSP 5 Score: 121.324 bits (303), Expect = 3.130e-27
Identity = 94/392 (23.98%), Postives = 180/392 (45.92%), Query Frame = 3
Query:  747 DVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFAS---------TL-------------GFTEVAHMLI---DRQCDIECETILK---RRP-IFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            D+  CN N  NA     +HLA + G+ +I   L+ +  ++++  K+  + +  A  +GQ ++   LI    ++N  +     P++ A+         TL             GFT +A  +    D+   +  E  ++   R P + IA+  N+V   +LL+ +  N   ++     P+H+A   G V++  LL++N  ++N      + P+H+A + G++ +  +LL  GA  +       TPL+ A+  GH +V K L+     I  ++      +H A Q    E A LL+D+   +D    +    +H+A   G++ + KLL+D+ +N      +   P+H AC+   + +++ L+ +   I     +  TPL +    G  + V +L
Sbjct:   65 DINSCNANGLNA-----LHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYL 451          

HSP 6 Score: 90.1225 bits (222), Expect = 1.056e-17
Identity = 75/312 (24.04%), Postives = 141/312 (45.19%), Query Frame = 3
Query: 1149 NHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANREIF------HRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILD--QPINYQEIRFL 2048
            N CN   +N      +H+A + G+V++   L+     I+ A  K    +HIAS  G+ +++  L+ + A+ N       TPLY+A ++ H +  + L+ NG N    +   + P+  A Q G  +I  +L+++    D     +   +H+A    ++N  KLL+ H  N +   +S   P+H A   GN+D+   L++N   ++     + TPL +   +G     + L    +K+  A R+         R  H +++K   L   +   + +   GLS L +A         + +LD   P++   + +L
Sbjct:   67 NSCNANGLN-----ALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIK--HLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYL 367          
BLAST of SMED30013027 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 194.126 bits (492), Expect = 1.155e-49
Identity = 137/490 (27.96%), Postives = 235/490 (47.96%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID----VPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVR-------------HDDIVKF 1901
             T LH AC+ G   +  LL+      KI+ AT+     +H A  S   E+++ L+ +   I  K    +  LH A    +   A LL+D    V +  V+   A     +H+A   GH ++AKLL++     N+     F+P+  A    +I++ +LLI +  +I  +T +   P+H AS +G   +   L+  +   +  TI    P+ +A+  N  +I+R+L+ +   +  I  E + P+HVA + G + ++ LL+ +   IN  ++     +HIA++ G+  IV++LLE+GA+ N +     TPL+LA + G  +V ++L+ NG +I+ Q      P+H A       I +LL+ +  S +    N Q  IH+AC    L I   L+ HG+++    +S   P+H A + GN+D+++ L+     I        TPL +    G+   V     +L+    I  R R             H D+VKF
Sbjct:  268 ITPLHVACKWGKLSLCTLLLCRG--AKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTA-----LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGH---VLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKF 745          

HSP 2 Score: 176.022 bits (445), Expect = 4.528e-44
Identity = 108/418 (25.84%), Postives = 204/418 (48.80%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKAL 1736
            FT LH AC++    +V LL+  K    I   T+S    +H A       IV  L+  +   +        PLH A       I ++L+      V+    E   P+H+A + G+  I  LL++   E+N+ +  ++S +  A   GQ  I ++L+ N  + N  T+    P+H A   G   V  +L+     I+ +      P+ +A+  NN  IV LL+ N  +        +  IH+AC+K ++E+   L+ +  ++N  +     P+H+A++ G V++V++LLE+G   +       TPL++A ++GH  VS++L+++G NI  ++   + P+H A   G  ++ +  +++   I+  ++    P+H A   G++ I+ LL+ H +N     +     +H A   G + ++++L
Sbjct:  400 FTPLHIACKKNRIKMVELLI--KHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLR--SAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 3 Score: 164.081 bits (414), Expect = 2.527e-40
Identity = 120/509 (23.58%), Postives = 224/509 (44.01%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLI----------------------TNKCDI----------NCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIAS----------------------ENGR-----------VEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGY 1814
             T LH A + G+ ++++ L+  +    I   TK+   A+H A   E +E   +L+  K  ++    + +  LH A   G+  +A+LL+D    N N +      P+H+AC+    ++ +LLI+    + +  +   +P+  A   G I I   L+                       N+ DI          +   R  + P+H AS LG   +  +L+    +I  ++  K   + IA+      IV++L+ N      +  +   P+H+AC+ G   VVQ+L+ N  +I+      + P+H+A+                       NG+           +EI   LL+HGAD N I     +PL+LA + G+ D+ ++L++ G  I   +     P+H A Q G   ++Q+L++   +I     N   P+H+A   G+L++VK  +++ +++E        P+H A + G++ +I  L+ +    +      +T L +    GY
Sbjct:  301 LTPLHCASRSGHVEVIKHLL--QQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDY-KANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGY 805          

HSP 4 Score: 160.614 bits (405), Expect = 2.528e-39
Identity = 128/514 (24.90%), Postives = 227/514 (44.16%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIV-RLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEI-----------------------------AKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITN---------------HCNIKCINDE-------NEQPI-----------HVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
              ALH A + G  DI   LL  G    KI++ATK  N A+H A ++   +++  LI     +N ++     PL+ A    +    + L+     N +    +   P+ +A Q GH +I                             AKLL++ +   + ++K  F+P+  A + G ++IA LL+ NK D+N   +    P+H A   G   +  +L+ R   I+  T     P+  AS + +VE+++ L+                 H   +  +DE       N+ P+           HVA   G V+V +LL+D   N N        P+HIA +  R+++V++L++HGA+         TPL++A+  G  ++   L+ +  + +  +I+   P+H A +    +I ++L+ S   +D      Q P+H+A   GN+NI+ LL+ HG+ +          +H A + G  ++++ L+ N    +       TPL L   +G  + V  L
Sbjct:   74 LNALHLAAKDGYVDICCELLRRG---IKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLL-ANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQIL 582          

HSP 5 Score: 121.324 bits (303), Expect = 3.130e-27
Identity = 94/392 (23.98%), Postives = 180/392 (45.92%), Query Frame = 3
Query:  747 DVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFAS---------TL-------------GFTEVAHMLI---DRQCDIECETILK---RRP-IFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            D+  CN N  NA     +HLA + G+ +I   L+ +  ++++  K+  + +  A  +GQ ++   LI    ++N  +     P++ A+         TL             GFT +A  +    D+   +  E  ++   R P + IA+  N+V   +LL+ +  N   ++     P+H+A   G V++  LL++N  ++N      + P+H+A + G++ +  +LL  GA  +       TPL+ A+  GH +V K L+     I  ++      +H A Q    E A LL+D+   +D    +    +H+A   G++ + KLL+D+ +N      +   P+H AC+   + +++ L+ +   I     +  TPL +    G  + V +L
Sbjct:   65 DINSCNANGLNA-----LHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLENDVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYL 451          

HSP 6 Score: 90.1225 bits (222), Expect = 1.056e-17
Identity = 75/312 (24.04%), Postives = 141/312 (45.19%), Query Frame = 3
Query: 1149 NHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANREIF------HRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILD--QPINYQEIRFL 2048
            N CN   +N      +H+A + G+V++   L+     I+ A  K    +HIAS  G+ +++  L+ + A+ N       TPLY+A ++ H +  + L+ NG N    +   + P+  A Q G  +I  +L+++    D     +   +H+A    ++N  KLL+ H  N +   +S   P+H A   GN+D+   L++N   ++     + TPL +   +G     + L    +K+  A R+         R  H +++K   L   +   + +   GLS L +A         + +LD   P++   + +L
Sbjct:   67 NSCNANGLN-----ALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN----DVRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIK--HLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYL 367          
BLAST of SMED30013027 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 212.616 bits (540), Expect = 1.401e-55
Identity = 118/455 (25.93%), Postives = 222/455 (48.79%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEES--QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VR L+  +   +I+D T      +H A       +V++L+ K  + N +      PLH AC   +     LL+     + + +   ES   P+H+A   GH  I K L+++    N+ N +  +P+  A  +G  E+A+ L+ N   ++   +  + P+H A+ +G  E+  +L++ + + +  T     P+ IA+   + +  R+L+  +     +  +   P+HVAC+ G V+VV+LL++   N N A    + P+H+A  +  +++VK+L+  G   +       T L++A ++   +V+  L+  G N   +S++   P+H A Q G  ++  LL+    +++  N N   P+HL    G++ I  +LV  G+++    R    P+H AC  GN+ ++K L+     ++ K     TPL      G+ D V+ L K
Sbjct:  247 LSPIHMAAQGDHMDCVRQLL--QYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLK---HSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLK 696          

HSP 2 Score: 196.052 bits (497), Expect = 2.321e-50
Identity = 116/451 (25.72%), Postives = 213/451 (47.23%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A    N  + +LL++      +N   K+    +H A    +  +V +L+ +  +I+ K  +E+ PLH A  NG+  + ++L+D     +  K      PIH+A Q  H +  + L++ N E++ +     +P+  A + G   + K+L+      N        P+H A          +L+     +E  T     P+ +A+   ++ IV+ L+    +    N + E P+H+A + G  EV Q L+ N+  ++        P+H A+  G  E+VK+L+EH A+ +   T   TPL++A  +GH   +++L+D        + K + P+H AC+ G  ++ +LL++   + +    N   P+H+A    NL++VKLLV  G +     R+    +H A +   L++  +L+      + ++    TPL L    G  D V+ L
Sbjct:  148 FTPLHIAAHYENLSVAQLLLNRG--ANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQ-GAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALL 595          

HSP 3 Score: 190.66 bits (483), Expect = 1.145e-48
Identity = 112/454 (24.67%), Postives = 219/454 (48.24%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVS----GKVQCKI------NDATKSAN-----------------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHC 1763
            FT L  A QQG+ ++V LL++    GKV+         ND T++A                    +H A   E+  + ++L+ +   +N      + PLH A   GN  + +LL+D     ++ K  +E  P+H A ++GH  + ++L+++   + +  K   SPI  A     ++  + L+    +I+  T     P+H A+  G   +  +L+D+        +    P+ IA   N++  + LL+ +  +++ + +    P+HVA   G + +V+ L+    + N +N K+  P+H+A+  G  E+ + LL++ A  +      +TPL+ A   GH ++ K+L+++  N +  +     P+H A + G  +  ++L+D +            P+H+AC  G +++V+LL++ G+N     ++   P+H A  + NLD++K LV    + H 
Sbjct:   86 FTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDR-GAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHS 538          

HSP 4 Score: 178.333 bits (451), Expect = 8.284e-45
Identity = 113/451 (25.06%), Postives = 211/451 (46.78%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            F+ L+ A Q+ + ++V+ L+       +   T+     +  A     E +V +LI        K    +  LH A  N +   A +L+   D N +  +     P+H+A  + +  +A+LL+ +   +N   K   +P+  A   G + + +LL+     I+  T+ +  P+H A+  G   V  +L+D+   ++ +T     PI +A+  ++++ VR L+  +  I  I  ++  P+HVA   G   +V++L+D     N        P+HIA +   +  + +LL+H A    +     TPL++A   GH ++ K L+  G +    ++K   P+H A + G CE+AQ L+ ++  +D +  + Q P+H A   G+  +VKLL++H +N +    +   P+H A   G+    + L+  N           TPL +   +G  D V  L
Sbjct:   53 FSPLYMAAQENHLEVVKYLLEHGANQSL--PTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQN-DPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 496          

HSP 5 Score: 176.022 bits (445), Expect = 4.114e-44
Identity = 109/424 (25.71%), Postives = 200/424 (47.17%), Query Frame = 3
Query:  564 INDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +   TK  N A+H A ++  E++V  LI     +N ++ +   PL+ A    +  + + L++    N +    +   P+ +A Q GH  +  LLI    +     K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R  ++         P+ IAS   NV +VRLL+     I     +   P+H A + G V VV++L+D    +       + PIH+A++   ++ V+ LL++ A+ + I     TPL++A   GH+ + KVL+D G     +++  + P+H AC+        LL+    S++   ++   P+H+A   G+LNIVK L+  G++    +   + P+H A   G+ ++ + L+ NN  +  K     TPL      G+ + V  L
Sbjct:   12 LETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEH-GANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLL 430          

HSP 6 Score: 144.436 bits (363), Expect = 2.508e-34
Identity = 85/358 (23.74%), Postives = 170/358 (47.49%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQ-------PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1538
            T LH A + G+ ++ + L+    Q  ++   K     +H A     +E+V++L+  K   +        PLH A   G+    ++L+D        +NA++++       P+H+AC++G  ++ +LL+E+    N+  K   +P+  A++   +++ KLL++     + + R     +H A+     EVA  L+    +   E++    P+ +AS     ++V LLI+   N+   N     P+H+  Q+G V +  +L+    ++  A+     P+H+A   G +++VK LL+  A  N       TPL+ A ++GH D+  +L+ +G      +     P+  A + G+  +  +L
Sbjct:  380 TPLHMAARAGHCEVAQFLLQNNAQ--VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLD--------ENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 727          

HSP 7 Score: 124.79 bits (312), Expect = 2.815e-28
Identity = 74/298 (24.83%), Postives = 146/298 (48.99%), Query Frame = 3
Query:  942 LITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            L+ N  D+  +T+     +H A+  G  +V   LI+   ++  ++     P+++A+  N++E+V+ L+ +  N     ++   P+ VA Q+G   VV LLI    N        +  +HIA+ N       +LL++  + + +     TPL++A    +  V+++L++ G N+         P+H A + G   + +LL+D    ID +  ++  P+H A  +G++ +V++L+D G+ L+   ++   PIH A +  ++D ++ L+  N  I        TPL +    G+   V  L
Sbjct:    5 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVL 298          

HSP 8 Score: 108.612 bits (270), Expect = 2.470e-23
Identity = 97/409 (23.72%), Postives = 172/409 (42.05%), Query Frame = 3
Query: 1140 LITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDV-----------------------------SKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPN 2279
            L+ N  +++    +    +H+A   G  +VV  LI+   N+N  + K   P+++A++   +E+VK LLEHGA+ +       TPL +A ++GH +V                             + VL+ N  N +  S   + P+H A       +AQLL++   +++    N   P+H+A   GN+ +V+LL+D G+ ++   +    P+H A  NG++ +++ L+     +  K     +P+ +     + DCV    ++L  N EI      DDI              L++   L+ L VA      R++  +LD     +  +    ALN F             LH +   N   S       S     V  +G T L +A   G+ +  + + +R   PN
Sbjct:    5 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCV---RQLLQYNAEI------DDI-------------TLDH---LTPLHVAAHCGHHRMVKVLLD-----KGAKANARALNGF-----------TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPN 372          
BLAST of SMED30013027 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 213.001 bits (541), Expect = 2.447e-55
Identity = 118/455 (25.93%), Postives = 222/455 (48.79%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEES--QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VR L+  +   +I+D T      +H A       +V++L+ K  + N +      PLH AC   +     LL+     + + +   ES   P+H+A   GH  I K L+++    N+ N +  +P+  A  +G  E+A+ L+ N   ++   +  + P+H A+ +G  E+  +L++ + + +  T     P+ IA+   + +  R+L+  +     +  +   P+HVAC+ G V+VV+LL++   N N A    + P+H+A  +  +++VK+L+  G   +       T L++A ++   +V+  L+  G N   +S++   P+H A Q G  ++  LL+    +++  N N   P+HL    G++ I  +LV  G+++    R    P+H AC  GN+ ++K L+     ++ K     TPL      G+ D V+ L K
Sbjct:  309 LSPIHMAAQGDHMDCVRQLL--QYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLK---HSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLK 758          

HSP 2 Score: 196.823 bits (499), Expect = 2.758e-50
Identity = 116/451 (25.72%), Postives = 213/451 (47.23%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A    N  + +LL++      +N   K+    +H A    +  +V +L+ +  +I+ K  +E+ PLH A  NG+  + ++L+D     +  K      PIH+A Q  H +  + L++ N E++ +     +P+  A + G   + K+L+      N        P+H A          +L+     +E  T     P+ +A+   ++ IV+ L+    +    N + E P+H+A + G  EV Q L+ N+  ++        P+H A+  G  E+VK+L+EH A+ +   T   TPL++A  +GH   +++L+D        + K + P+H AC+ G  ++ +LL++   + +    N   P+H+A    NL++VKLLV  G +     R+    +H A +   L++  +L+      + ++    TPL L    G  D V+ L
Sbjct:  210 FTPLHIAAHYENLSVAQLLLNRG--ANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQ-GAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALL 657          

HSP 3 Score: 191.045 bits (484), Expect = 1.413e-48
Identity = 112/463 (24.19%), Postives = 220/463 (47.52%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI----------NDATKSAN-----------------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            FT L  A QQG+ ++V LL++   + K+          ND T++A                    +H A   E+  + ++L+ +   +N      + PLH A   GN  + +LL+D     ++ K  +E  P+H A ++GH  + ++L+++   + +  K   SPI  A     ++  + L+    +I+  T     P+H A+  G   +  +L+D+        +    P+ IA   N++  + LL+ +  +++ + +    P+HVA   G + +V+ L+    + N +N K+  P+H+A+  G  E+ + LL++ A  +      +TPL+ A   GH ++ K+L+++  N +  +     P+H A + G  +  ++L+D +            P+H+AC  G +++V+LL++ G+N     ++   P+H A  + NLD++K LV    + H       T L
Sbjct:  148 FTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDR-GAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTAL 609          

HSP 4 Score: 181.03 bits (458), Expect = 2.167e-45
Identity = 115/451 (25.50%), Postives = 212/451 (47.01%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  L+   +   +   TK  N A+H A ++  E++V  LI     +N ++ +   PL+ A    +  + + L++    N +    +   P+ +A Q GH  +  LLI    +     K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R  ++         P+ IAS   NV +VRLL+     I     +   P+H A + G V VV++L+D    +       + PIH+A++   ++ V+ LL++ A+ + I     TPL++A   GH+ + KVL+D G     +++  + P+H AC+        LL+    S++   ++   P+H+A   G+LNIVK L+  G++    +   + P+H A   G+ ++ + L+ NN  +  K     TPL      G+ + V  L
Sbjct:   49 LNGLHLASKEGHVKMVLELLHNGID--LETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEH-GANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLL 492          

HSP 5 Score: 179.489 bits (454), Expect = 6.309e-45
Identity = 113/451 (25.06%), Postives = 211/451 (46.78%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            F+ L+ A Q+ + ++V+ L+       +   T+     +  A     E +V +LI        K    +  LH A  N +   A +L+   D N +  +     P+H+A  + +  +A+LL+ +   +N   K   +P+  A   G + + +LL+     I+  T+ +  P+H A+  G   V  +L+D+   ++ +T     PI +A+  ++++ VR L+  +  I  I  ++  P+HVA   G   +V++L+D     N        P+HIA +   +  + +LL+H A    +     TPL++A   GH ++ K L+  G +    ++K   P+H A + G CE+AQ L+ ++  +D +  + Q P+H A   G+  +VKLL++H +N +    +   P+H A   G+    + L+  N           TPL +   +G  D V  L
Sbjct:  115 FSPLYMAAQENHLEVVKYLLEHGANQSL--PTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQN-DPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVVELL 558          

HSP 6 Score: 144.821 bits (364), Expect = 2.702e-34
Identity = 85/358 (23.74%), Postives = 170/358 (47.49%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQ-------PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1538
            T LH A + G+ ++ + L+    Q  ++   K     +H A     +E+V++L+  K   +        PLH A   G+    ++L+D        +NA++++       P+H+AC++G  ++ +LL+E+    N+  K   +P+  A++   +++ KLL++     + + R     +H A+     EVA  L+    +   E++    P+ +AS     ++V LLI+   N+   N     P+H+  Q+G V +  +L+    ++  A+     P+H+A   G +++VK LL+  A  N       TPL+ A ++GH D+  +L+ +G      +     P+  A + G+  +  +L
Sbjct:  442 TPLHMAARAGHCEVAQFLLQNNAQ--VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLD--------ENAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 789          

HSP 7 Score: 135.191 bits (339), Expect = 2.127e-31
Identity = 137/615 (22.28%), Postives = 243/615 (39.51%), Query Frame = 3
Query:  762 NVNCKNAEESQPIHLACQHGHFE------------------------IAKL---------LIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLID----------------RQCDIECETILKR-------------RPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL--------SKVLDANREIFH---RVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEI--KERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPN---ENPYFNLMMAIKDNDPFSVQYLLAKFTFGAN 2372
            ++N  N      +HLA + GH +                        IA L         LI     +N+ +++ FSP+  A     +E+ K L+ +  + +  T     P+  A   G   V  +LI+                R  D     +L +              P+ IA+   N+ + +LL+    N+         P+H+A ++G V +V+LL+D    I+      + P+H A+ NG V +V+ILL+ GA          +P+++A +  H D  + L+     I+  ++    P+H A   G   + ++L+D     +    N   P+H+AC   ++  + LL+ H ++LE    S   P+H A   G+L+++K+L+    + +  N    TPL +    G+ +   FL        +K  D ++   H   R+ H ++VK    + A+         G + L +A     ++    +LD+  N Q+ +  K       +  K   + + E  L R    N               +N    G T L +A  H N D  + +  +   P+    N Y  L +A K N       LL    +GAN
Sbjct:   40 DINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKD-DQTPLHCAARMGHKELVKLLMEHKANPDSA--TTAGHTPLHIAAREGHAQTTRILLDE--NAQQTKMTKKGFTPLHVACKYGKVDVVELLLERGANPN------------AAGKN----GLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLL---QYGAN 630          

HSP 8 Score: 134.035 bits (336), Expect = 5.551e-31
Identity = 84/359 (23.40%), Postives = 172/359 (47.91%), Query Frame = 3
Query:  759 CNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             +++   A+ +     A + G+ E A   I+   ++N  N+   + +  A   G +++   L+ N  D+  +T+     +H A+  G  +V   LI+   ++  ++     P+++A+  N++E+V+ L+ +  N     ++   P+ VA Q+G   VV LLI    N        +  +HIA+ N       +LL++  + + +     TPL++A    +  V+++L++ G N+         P+H A + G   + +LL+D    ID +  ++  P+H A  +G++ +V++L+D G+ L+   ++   PIH A +  ++D ++ L+  N  I        TPL +    G+   V  L
Sbjct:    6 SSLSSPQADATTSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVL 360          

HSP 9 Score: 117.857 bits (294), Expect = 4.329e-26
Identity = 111/475 (23.37%), Postives = 199/475 (41.89%), Query Frame = 3
Query:  858 CEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPN 2279
              ++S      +  L A  SG +E A   I N  DIN + +     +H AS  G  ++   L+    D+E  T      + IA+     ++V  LI    N+   + +   P+++A Q+  +EVV+ L+++  N +   +    P+ +A + G   +V +L+ +G          R P L++A        + VL+ N  N +  S   + P+H A       +AQLL++   +++    N   P+H+A   GN+ +V+LL+D G+ ++   +    P+H A  NG++ +++ L+     +  K     +P+ +     + DCV    ++L  N EI      DDI              L++   L+ L VA      R++  +LD+            ALN F             LH +   N   S       S     V  +G T L +A   G+ +  + + +R   PN
Sbjct:    6 SSLSSPQADATTSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCV---RQLLQYNAEI------DDI-------------TLDH---LTPLHVAAHCGHHRMVKVLLDKGAKAN-----ARALNGF-----------TPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPN 434          
BLAST of SMED30013027 vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 213.001 bits (541), Expect = 2.558e-55
Identity = 120/465 (25.81%), Postives = 227/465 (48.82%), Query Frame = 3
Query:  453 VSNS*LLT*KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEES--QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
            VS++ +L    + +H A Q  + D VR L+  +   +I+D T      +H A       +V++L+ K  + N +      PLH AC   +     LL+     + + +   ES   P+H+A   GH  I K L+++    N+ N +  +P+  A  +G  E+A+ L+ N   ++   +  + P+H A+ +G  E+  +L++ + + +  T     P+ IA+   + +  R+L+  +     +  +   P+HVAC+ G V+V +LL++   N N A    + P+H+A  +  +++VK+L+  G   +       T L++A ++   +V+  L+  G N   +S++   P+H A Q G  ++  LL+    +++  N N   P+HL    G++ I  +LV  G+++    R    P+H AC  GN+ ++K L+     ++ K     TPL      G+ D V+ L K
Sbjct:  264 VSSTLILLNGLSPIHMAAQGDHMDCVRQLL--QYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLK---HSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLK 723          

HSP 2 Score: 153.295 bits (386), Expect = 6.111e-37
Identity = 113/486 (23.25%), Postives = 209/486 (43.00%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCD--------------------------INCST---RTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKR--------RPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             LH A ++G+  +V  L+   +   +   TK  N A+H A ++  E++V  LI     +N ++ +   PL+ A    +  + + L++    N +    +   P+ +A Q GH  +  LLI    +     K     +  A  +     A +L+ N  +                          + C T   +T   P+H A+      VA +L++R  ++     +           PI +A+  ++++ VR L+  +  I  I  ++  P+HVA   G   +V++L+D     N        P+HIA +   +  + +LL+H A    +     TPL++A   GH ++ K L+  G +    ++K   P+H A + G CE+AQ L+ ++  +D +  + Q P+H A   G+  +VKLL++H +N +    +   P+H A   G+    + L+  N           TPL +   +G  D    L
Sbjct:   45 GLHLASKEGHVKMVLELLHNGID--LETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEH-GANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELL 523          

HSP 3 Score: 146.747 bits (369), Expect = 7.721e-35
Identity = 86/358 (24.02%), Postives = 171/358 (47.77%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQ-------PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1538
            T LH A + G+ ++ + L+    Q  ++   K     +H A     +E+V++L+  K   +        PLH A   G+    ++L+D        +NA++++       P+H+AC++G  ++A+LL+E+    N+  K   +P+  A++   +++ KLL++     + + R     +H A+     EVA  L+    +   E++    P+ +AS     ++V LLI+   N+   N     P+H+  Q+G V +  +L+    ++  A+     P+H+A   G +++VK LL+  A  N       TPL+ A ++GH D+  +L+ +G      +     P+  A + G+  +  +L
Sbjct:  407 TPLHMAARAGHCEVAQFLLQNNAQ--VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLD--------ENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 754          

HSP 4 Score: 113.235 bits (282), Expect = 1.106e-24
Identity = 129/618 (20.87%), Postives = 238/618 (38.51%), Query Frame = 3
Query:  771 CKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCI----------------CTYAR-------------TPLYLATEKGHYDVSKVLIDNGCNIECQS--------IKKWRPIHNACQN---------------------------------GFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL---SKVLDA----NREIFH---RVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLA-GTTFLELATIHGNDDFAQKIRERICFPN---ENPYFNLMMAIKDNDPFSVQYLLAKFTFGAN 2372
            C +A+ +     A + G+ E A   I+   ++N  N+   + +  A   G +++   L+ N  D+  +T+     +H A+  G  +V   LI+   ++  ++     P+++A+  N++E+V+ L+ +  N     ++   P+ VA Q+G   VV LLI    N        +  +HIA+ N       +LL++  + + +                CTY               TPL++A    +  V+++L++ G N+            +    PIH A Q                                  G   + ++L+D     +    N   P+H+AC   ++  + LL+ H ++LE    S   P+H A   G+L+++K+L+    + +  N    TPL +    G+ +   FL   +  +DA    ++   H   R+ H ++VK    + A+         G + L +A     ++    +LD+  N Q+ +  K       +                C       A   L    N N     G T L +A  H N D  + +  +   P+    N Y  L +A K N       LL    +GAN
Sbjct:    4 CGHADATTSFLRAARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSA--TTAGHTPLHIAAREGHAQTTRILLDE--NAQQTKMTKKGFTPLHVA---------------CKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLL---QYGAN 595          
BLAST of SMED30013027 vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 212.616 bits (540), Expect = 3.562e-55
Identity = 118/463 (25.49%), Postives = 224/463 (48.38%), Query Frame = 3
Query:  453 VSNS*LLT*KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
            VS++ +L    + +H A Q  + D VR L+  +   +I+D T      +H A       +V++L+ K  + N +      PLH AC   +     LL+     ++         P+H+A   GH  I K L+++    N+ N +  +P+  A  +G  E+A+ L+ N   ++   +  + P+H A+ +G  E+  +L++ + + +  T     P+ IA+   + +  R+L+  +     +  +   P+HVAC+ G V+V +LL++   N N A    + P+H+A  +  +++VK+L+  G   +       T L++A ++   +V+  L+  G N   +S++   P+H A Q G  ++  LL+    +++  N N   P+HL    G++ I  +LV  G+++    R    P+H AC  GN+ ++K L+     ++ K     TPL      G+ D V+ L K
Sbjct:  269 VSSTLILLNGLSPIHMAAQGDHMDCVRQLL--QYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKH-SASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLK 728          

HSP 2 Score: 152.91 bits (385), Expect = 8.039e-37
Identity = 113/486 (23.25%), Postives = 209/486 (43.00%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCD--------------------------INCST---RTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKR--------RPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             LH A ++G+  +V  L+   +   +   TK  N A+H A ++  E++V  LI     +N ++ +   PL+ A    +  + + L++    N +    +   P+ +A Q GH  +  LLI    +     K     +  A  +     A +L+ N  +                          + C T   +T   P+H A+      VA +L++R  ++     +           PI +A+  ++++ VR L+  +  I  I  ++  P+HVA   G   +V++L+D     N        P+HIA +   +  + +LL+H A    +     TPL++A   GH ++ K L+  G +    ++K   P+H A + G CE+AQ L+ ++  +D +  + Q P+H A   G+  +VKLL++H +N +    +   P+H A   G+    + L+  N           TPL +   +G  D    L
Sbjct:   50 GLHLASKEGHVKMVLELLHNGID--LETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEH-GANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELL 528          

HSP 3 Score: 146.362 bits (368), Expect = 9.981e-35
Identity = 86/358 (24.02%), Postives = 171/358 (47.77%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQ-------PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLL 1538
            T LH A + G+ ++ + L+    Q  ++   K     +H A     +E+V++L+  K   +        PLH A   G+    ++L+D        +NA++++       P+H+AC++G  ++A+LL+E+    N+  K   +P+  A++   +++ KLL++     + + R     +H A+     EVA  L+    +   E++    P+ +AS     ++V LLI+   N+   N     P+H+  Q+G V +  +L+    ++  A+     P+H+A   G +++VK LL+  A  N       TPL+ A ++GH D+  +L+ +G      +     P+  A + G+  +  +L
Sbjct:  412 TPLHMAARAGHCEVAQFLLQNNAQ--VDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLD--------ENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 759          

HSP 4 Score: 110.923 bits (276), Expect = 6.728e-24
Identity = 127/606 (20.96%), Postives = 233/606 (38.45%), Query Frame = 3
Query:  807 ACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCI----------------CTYAR-------------TPLYLATEKGHYDVSKVLIDNGCNIECQS--------IKKWRPIHNACQN---------------------------------GFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL---SKVLDA----NREIFH---RVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLA-GTTFLELATIHGNDDFAQKIRERICFPN---ENPYFNLMMAIKDNDPFSVQYLLAKFTFGAN 2372
            A + G+ E A   I+   ++N  N+   + +  A   G +++   L+ N  D+  +T+     +H A+  G  +V   LI+   ++  ++     P+++A+  N++E+V+ L+ +  N     ++   P+ VA Q+G   VV LLI    N        +  +HIA+ N       +LL++  + + +                CTY               TPL++A    +  V+++L++ G N+            +    PIH A Q                                  G   + ++L+D     +    N   P+H+AC   ++  + LL+ H ++LE    S   P+H A   G+L+++K+L+    + +  N    TPL +    G+ +   FL   +  +DA    ++   H   R+ H ++VK    + A+         G + L +A     ++    +LD+  N Q+ +  K       +                C       A   L    N N     G T L +A  H N D  + +  +   P+    N Y  L +A K N       LL    +GAN
Sbjct:   21 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKVCVLLQDYLSVFLFCTYTESMKCYTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSA--TTAGHTPLHIAAREGHAQTTRILLDE--NAQQTKMTKKGFTPLHVA---------------CKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLL---QYGAN 600          
BLAST of SMED30013027 vs. Ensembl Zebrafish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 209.534 bits (532), Expect = 3.583e-54
Identity = 116/455 (25.49%), Postives = 224/455 (49.23%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEES--QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D +R L+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  +  LL+     + + +   ES   P+H++   GH  I K+L++K    N+ N +  +P+  A  +G  E+A+ L+ N   ++   +  + P+H AS +G  E+  +L++ + +    T     P+ IA+   + +   +L+  +  +  +  +   P+HVA + G V+V  LL++   N N A    + P+H+A  +  +++V +LL  G   +       TPL++A+++   +V+  L+ +G +   +S++   P+H A Q G  ++  LL+    +++  N +   P+HL    G++ I  +LV HG+++    R    P+H AC  GN+ ++K L+     ++CK   S TPL      G+ D V+ L K
Sbjct:  306 LSPIHMAAQGDHLDCIRQLL--QYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLK---HSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHTDIVTLLLK 755          

HSP 2 Score: 199.904 bits (507), Expect = 2.990e-51
Identity = 118/451 (26.16%), Postives = 212/451 (47.01%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             T LH A   G+H + ++L+      K N    +    +H AC      ++++L+     +    +  + PLH +   G+  I ++L+     + N  N +   P+H+A + GH E+A+ L++    +++  K + +P+  A   G  E+ KLL+ +K + N +T     P+H A+  G T+ A +L+D    +   T     P+ +A+    V++  LL+    N          P+HVA     ++VV LL+    + + A      P+HIAS+  + E+   LL+HGA  N       TPL+LA+++G  D+  +LI    N+   +     P+H   Q G   IA +LV    S+         P+H+AC  GN+ +VK L+   +N+ C  R +  P+H A + G+ D++  L+ +    +      ++ L + K  GY   +  L
Sbjct:  339 LTPLHVAAHCGHHRVAKVLLDKG--AKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQ-KGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKHGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNCKTRMSYTPLHQAAQQGHTDIVTLLLKHGAQPNEVTSNGTSALAIAKRLGYISVIDVL 786          

HSP 3 Score: 195.282 bits (495), Expect = 9.877e-50
Identity = 118/451 (26.16%), Postives = 215/451 (47.67%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A    N ++ +LL++      +N   K+    +H A    +  +V +L+ +  +I+ K  +E+ PLH A  NG+  I ++L+D     +  K      PIH+A Q  H +  + L++ N E++ +     +P+  A + G   +AK+L+      N        P+H A       V  +L+     +E  T     P+ ++S   ++ IV++L+    +    N + E P+H+A + G  EV + L+ N   ++        P+H AS  G  E+VK+LLEH A++N   T   TPL++A  +GH   + +L+D    +   + K + P+H A + G  ++A LL++   + +        P+H+A    NL++V LL+  G +     R+   P+H A +    ++  +L+ +  + + ++    TPL L    G  D V  L
Sbjct:  207 FTPLHIAAHYENLNVAQLLLN--RGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQ-GAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPLHIASKQNQAEVASSLLQHGASANAESLQGVTPLHLASQEGQPDMVLLL 654          

HSP 4 Score: 191.045 bits (484), Expect = 2.029e-48
Identity = 113/463 (24.41%), Postives = 221/463 (47.73%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI----------NDATKSAN-----------------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            FT L  A QQG+ ++V LL++   + K+          ND T++A                    +H A   E+  + ++L+ +  ++N      + PLH A   GN  + +LL+D     ++ K  +E  P+H A ++GH  I ++L+++   + +  K   SPI  A     ++  + L+    +I+  T     P+H A+  G   VA +L+D+        +    P+ IA   N++ ++ LL+ +  +++ + +    P+HV+   G + +V++L+    + N +N K+  P+H+AS  G  E+ + LL++ A  +      +TPL+ A+  GH ++ K+L+++  N    +     P+H A + G  + A +L+D +  +         P+H+A   G +++  LL++ G+N     +    P+H A  + NLD++  L+    + H       TPL
Sbjct:  145 FTPLAVALQQGHENVVALLINHGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDR-GAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLLLERGANPNAAGKVGLTPLHVAVHHNNLDVVNLLLSKGGSPHSAARNGYTPL 606          

HSP 5 Score: 184.496 bits (467), Expect = 2.071e-46
Identity = 116/452 (25.66%), Postives = 215/452 (47.57%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIV-RLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  LL  G V   +   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L+D    N      +   P+ +A Q GH  +  LLI    +     K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R  D+         P+ IAS   NV +VRLL+     I     +   P+H A + G V ++++L+D    I       + PIH+A++   ++ ++ LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     +  LL+    S++   ++   P+H++   G+LNIVK+L+  G++    +   + P+H A   G+ ++ + L+ N   +  K     TPL      G+++ V  L
Sbjct:   46 LNGLHLASKEGHVKMVLELLHHGIV---LETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDN-GANQTIPTEDGFTPLAVALQQGHENVVALLINHGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLL 489          

HSP 6 Score: 177.563 bits (449), Expect = 2.576e-44
Identity = 113/452 (25.00%), Postives = 213/452 (47.12%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGN-KAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT L+ A Q+ + ++V+ L+       I   T+     +  A     E +V +LI        K    +  LH A  N + +  A LL + P+ +V  K      P+H+A  + +  +A+LL+ +  ++N   K   +P+  A   G + + +LL+     I+  T+ +  P+H A+  G   +  +L+D+   I+ +T     PI +A+  ++++ +R L+  +  I  I  ++  P+HVA   G   V ++L+D     N        P+HIA +   + ++ +LL+H A    +     TPL++++  GH ++ K+L+  G +    ++K   P+H A + G CE+A+ L+ +   +D +  + Q P+H A   G+  +VKLL++H +N      +   P+H A   G+      L+  N  +        TPL +   +G  D    L
Sbjct:  112 FTPLYMAAQENHLEVVKFLLDNGANQTI--PTEDGFTPLAVALQQGHENVVALLINH----GTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTG--FTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKLLLEHKANSNSTTTAGHTPLHIAAREGHTQTASILLDMNAQLTKMTKKGFTPLHVAAKYGKVDVAVLL 555          

HSP 7 Score: 134.806 bits (338), Expect = 3.637e-31
Identity = 105/458 (22.93%), Postives = 193/458 (42.14%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFE------------------------IAKL---------LIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLID----------------RQCDIECETILKR-------------RPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL---SKVLDA----NREIFH---RVRHDDIVKF 1901
            ID+   N N  N      +HLA + GH +                        IA L         L+     +N+ +++ F+P+  A     +E+ K L+ N  +    T     P+  A   G   V  +LI+                R  D     +L +              P+ IA+   N+ + +LL+    ++         P+H+A ++G V +V+LL+D    I+      + P+H A+ NG V I++ILL+ GA          +P+++A +  H D  + L+     I+  ++    P+H A   G   +A++L+D     +T   N   P+H+AC   ++ ++ LL+ H ++LE    S   P+H +   G+L+++K L+    + +  N    TPL +    G+ +   FL   +  +DA    ++   H   R+ H+++VK 
Sbjct:   36 IDINTANQNGLNG-----LHLASKEGHVKMVLELLHHGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLINHGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNTRALNGFTPLHIACKKNHMRVMDLLLKHSASLEAVTESGLTPLHVSSFMGHLNIVKILMQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTPLHCASRMGHNEMVKL 488          

HSP 8 Score: 129.028 bits (323), Expect = 2.040e-29
Identity = 78/318 (24.53%), Postives = 162/318 (50.94%), Query Frame = 3
Query:  807 ACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKP-IHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            A + G+ E A   I+   ++N+ N+   + +  A   G +++   L+ +   +  +T+     +H A+  G  +V   L++   ++  ++     P+++A+  N++E+V+ L+ N  N     ++   P+ VA Q+G   VV LLI NH        K+  P +HIA+ N       +LL++  + + +     TPL++A    + +V+++L++ G ++         P+H A + G   + +LL+D    ID +  ++  P+H A  +G++ I+++L+D G+ ++   ++   PIH A +  +LD I+ L+  N  I
Sbjct:   19 AARSGNLEKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHHGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLI-NHGT----KGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCIRQLLQYNAEI 331          

HSP 9 Score: 120.168 bits (300), Expect = 1.007e-26
Identity = 83/323 (25.70%), Postives = 148/323 (45.82%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREI 1865
            L A  SG +E A   I N  DIN + +     +H AS  G  ++   L+     +E  T      + IA+     ++V  L+    N+   + +   P+++A Q+  +EVV+ L+DN  N     +    P+ +A + G   +V +L+ HG          R P L++A        + VL+ N  N +  S   + P+H A       +AQLL++    ++    N   P+H+A   GN+ +V+LL+D G+ ++   +    P+H A  NG++ +I+ L+     I  K     +P+ +     + DC+    ++L  N EI
Sbjct:   17 LRAARSGNLEKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHHGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLDNGANQTIPTEDGFTPLAVALQQGHENVVALLINHGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGADVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAKIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHLDCI---RQLLQYNAEI 331          
BLAST of SMED30013027 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 211.075 bits (536), Expect = 1.528e-54
Identity = 131/481 (27.23%), Postives = 220/481 (45.74%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS---TPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYD 1916
             T LH A   G+H + +LL+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  + +   P+H+A +  H ++A  LI+   ++N+  K + +P+  A  SG  E+ +LL+ N    +  T     P+H  +  G T+ A +L+D Q      T     P+ +A+    ++I  LL+    +          P+HVA     + +V+LL++   + +C       P+H+A +   V+  + LL+ GA  N       TPL+LA ++GH D+  +L+    N+   +     P+H A Q G   IA++LV    S+  E      P+H+AC  GN+ +VK L+ H +N+    +    P+H A + G+ D++  L+ N     C N AS    TPL + K  GY      LS V D         RH   + F E  D
Sbjct:  335 LTPLHVAAHCGHHRVAKLLLDKG--AKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK-GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA---CPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANERHR--MSFPETMD 807          

HSP 2 Score: 209.92 bits (533), Expect = 3.494e-54
Identity = 117/453 (25.83%), Postives = 216/453 (47.68%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  + Q  I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L++K    N  + +  +P+  A  +   ++A  LI NK  +N   +  + P+H A+  G  E+  +L++     +  T     P+ + +   + +   LL+ N      +  +   P+HVA + G +++ +LL++   + N A    + P+H+A  +  + IV++LL  GA  +C      TPL++A ++   D ++ L+  G     QS++   P+H A Q G  ++  LL+    ++   N +   P+HLA   G+LNI ++LV H +++    R    P+H AC  GN+ ++K L+ +   ++       TPL      G+ D V+ L K
Sbjct:  302 LSPIHMASQGDHLDCVRLLL--QYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS-GASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLK 751          

HSP 3 Score: 202.986 bits (515), Expect = 5.452e-52
Identity = 156/636 (24.53%), Postives = 281/636 (44.18%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANRE---IFHRVRHDDIVKFNELYDAHTLFV-LEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFP-------------NENPYFNLM-MAIKDND 2324
            FT LH A    N ++ +LL++      +N   ++   A+H A    +  +V +L+ +  +I+    +E+ PLH A  NG+  I+++L+D     +  K      PIH+A Q  H +  +LL++    ++ +     +P+  A + G   +AKLL+      N        P+H A       V  +L+     I+  T     P+ +AS   ++ IV+ L+    +    + + E P+H+A +    +V   LI N   +N        P+H A+ +G  E+V++LLE+GA  +   T   TPL+L T  GH   +++L+DN       + K + P+H A + G  +IA+LL++     ++       P+H+A    +LNIV+LL++ G++  C  R+   P+H A +  ++D  +AL+      + ++    TPL L    G+ D V+ L    + V   N+      H    +  +   E+  +H   V  E   G + L VA    + +++ ++L    N   +  L         ++    I    L    C N + S       ++  R   ++ T  L L T   +   A + R R+ FP             +E PYF      ++D D
Sbjct:  203 FTPLHIAAHYENLNVAQLLLNRG--ANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDH-GAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQA-SMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANE-RHRMSFPETMDEPMDVSEDEDEPPYFRAAPPGLRDPD 833          

HSP 4 Score: 175.252 bits (443), Expect = 1.546e-43
Identity = 113/449 (25.17%), Postives = 211/449 (46.99%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ALH + ++G+  +V  L+   +   +   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI    +     K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R  ++          + IAS   NV +VRLL+     I     +   P+H A + G V + ++L+D+   I       + PIH+AS+   ++ V++LL++ A  + I     TPL++A   GH+ V+K+L+D G     +++  + P+H AC+     + +LL+ S  SID   ++   P+H+A   G+L IVK L+  G++        + P+H A    + D+   L+ N   ++ +     TPL      G+ + V  L
Sbjct:   44 ALHLSSKEGHVKMVTELLHKDI--VLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLEN-GANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLL 485          

HSP 5 Score: 174.481 bits (441), Expect = 2.982e-43
Identity = 111/470 (23.62%), Postives = 211/470 (44.89%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID--------VPDCNVNCKNAEESQ--------------------PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFG 1811
            TALH A   G  D+VR LV+      +N  ++     ++ A       +V+ L+      N   ++   PL  A   G++ +   LI         +P  ++  +N +                       P+H+A  + +  +A+LL+ +   +N   +   S +  A   G + + +LL+     I+  T+ +  P+H A   G   ++ +L+D    I+ +T     PI +AS  ++++ VRLL+    +I  I  ++  P+HVA   G   V +LL+D     N        P+HIA +   + ++++LL+ GA  + +     TPL++A+  GH  + K L+  G +    S+K   P+H A +    ++A  L+ +   ++    + Q P+H A  SG+  +V+LL+++G++ + P  +   P+H     G+    + L+ N  A         TPL +   +G
Sbjct:   76 TALHIAALAGQEDVVRELVNHG--ANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYG 543          

HSP 6 Score: 135.961 bits (341), Expect = 2.044e-31
Identity = 102/430 (23.72%), Postives = 182/430 (42.33%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKN---------------------------------CEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRP-IFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----------SKVLDANREIFHRVRHDDIVKF 1901
            +D+  CN N  NA     +HL+ + GH ++   L+ K+                                   +NS +++ F+P+  A     + + K L+ N  + N +T     P+  A   G   V   LI      +      R P + IA+ N++     +L+ N  N   ++     P+H+A     + V QLL++   N+N      +  +HIAS  G V +V++LL+ GA  +       TPL+ A   GH  +S++L+D+G  I+ ++     PIH A Q    +  +LL+     ID    +   P+H+A   G+  + KLL+D G+       +   P+H AC+  ++ +++ L+ +  +I     +  TPL +    G+   V  L          S  ++    +  R  H D+  F
Sbjct:   32 VDINTCNQNGLNA-----LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADF 451          

HSP 7 Score: 82.0333 bits (201), Expect = 6.699e-15
Identity = 58/245 (23.67%), Postives = 105/245 (42.86%), Query Frame = 3
Query: 1143 ITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD---------SHCSIDTENDNKQ--------------------KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            + N  +I   N      +H++ ++G V++V  L+     +     K    +HIA+  G+ ++V+ L+ HGA+ N       TPLY+A ++ H  V K L++NG N    +   + P+  A Q G   +   L+              I   ND+ +                     P+H+A    NLN+ +LL++ G+N+    ++    +H A   GN+ +++ L+     I        TPL
Sbjct:   28 LRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPL 272          

HSP 8 Score: 51.9878 bits (123), Expect = 8.343e-6
Identity = 33/152 (21.71%), Postives = 70/152 (46.05%), Query Frame = 3
Query: 1380 ARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A T    A   G+ D +   + NG +I   +      +H + + G  ++   L+     ++T        +H+A  +G  ++V+ LV+HG+N+    +    P++ A +  +L ++K L+ N    +       TPL +    G+++ V++L
Sbjct:    8 AATSFLRAARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYL 159          
BLAST of SMED30013027 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 210.69 bits (535), Expect = 1.721e-54
Identity = 131/481 (27.23%), Postives = 220/481 (45.74%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS---TPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYD 1916
             T LH A   G+H + +LL+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  + +   P+H+A +  H ++A  LI+   ++N+  K + +P+  A  SG  E+ +LL+ N    +  T     P+H  +  G T+ A +L+D Q      T     P+ +A+    ++I  LL+    +          P+HVA     + +V+LL++   + +C       P+H+A +   V+  + LL+ GA  N       TPL+LA ++GH D+  +L+    N+   +     P+H A Q G   IA++LV    S+  E      P+H+AC  GN+ +VK L+ H +N+    +    P+H A + G+ D++  L+ N     C N AS    TPL + K  GY      LS V D         RH   + F E  D
Sbjct:  372 LTPLHVAAHCGHHRVAKLLLDKG--AKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK-GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA---CPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANERHR--MSFPETMD 844          

HSP 2 Score: 209.534 bits (532), Expect = 4.002e-54
Identity = 117/453 (25.83%), Postives = 216/453 (47.68%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  + Q  I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L++K    N  + +  +P+  A  +   ++A  LI NK  +N   +  + P+H A+  G  E+  +L++     +  T     P+ + +   + +   LL+ N      +  +   P+HVA + G +++ +LL++   + N A    + P+H+A  +  + IV++LL  GA  +C      TPL++A ++   D ++ L+  G     QS++   P+H A Q G  ++  LL+    ++   N +   P+HLA   G+LNI ++LV H +++    R    P+H AC  GN+ ++K L+ +   ++       TPL      G+ D V+ L K
Sbjct:  339 LSPIHMASQGDHLDCVRLLL--QYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS-GASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLK 788          

HSP 3 Score: 202.986 bits (515), Expect = 5.484e-52
Identity = 156/636 (24.53%), Postives = 281/636 (44.18%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANRE---IFHRVRHDDIVKFNELYDAHTLFV-LEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFP-------------NENPYFNLM-MAIKDND 2324
            FT LH A    N ++ +LL++      +N   ++   A+H A    +  +V +L+ +  +I+    +E+ PLH A  NG+  I+++L+D     +  K      PIH+A Q  H +  +LL++    ++ +     +P+  A + G   +AKLL+      N        P+H A       V  +L+     I+  T     P+ +AS   ++ IV+ L+    +    + + E P+H+A +    +V   LI N   +N        P+H A+ +G  E+V++LLE+GA  +   T   TPL+L T  GH   +++L+DN       + K + P+H A + G  +IA+LL++     ++       P+H+A    +LNIV+LL++ G++  C  R+   P+H A +  ++D  +AL+      + ++    TPL L    G+ D V+ L    + V   N+      H    +  +   E+  +H   V  E   G + L VA    + +++ ++L    N   +  L         ++    I    L    C N + S       ++  R   ++ T  L L T   +   A + R R+ FP             +E PYF      ++D D
Sbjct:  240 FTPLHIAAHYENLNVAQLLLNRG--ANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDH-GAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQA-SMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANE-RHRMSFPETMDEPMDVSEDEDEPPYFRAAPPGLRDPD 870          

HSP 4 Score: 175.252 bits (443), Expect = 1.590e-43
Identity = 113/449 (25.17%), Postives = 211/449 (46.99%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ALH + ++G+  +V  L+   +   +   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI    +     K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R  ++          + IAS   NV +VRLL+     I     +   P+H A + G V + ++L+D+   I       + PIH+AS+   ++ V++LL++ A  + I     TPL++A   GH+ V+K+L+D G     +++  + P+H AC+     + +LL+ S  SID   ++   P+H+A   G+L IVK L+  G++        + P+H A    + D+   L+ N   ++ +     TPL      G+ + V  L
Sbjct:   81 ALHLSSKEGHVKMVTELLHKDI--VLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLEN-GANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLL 522          

HSP 5 Score: 174.481 bits (441), Expect = 2.940e-43
Identity = 111/470 (23.62%), Postives = 211/470 (44.89%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID--------VPDCNVNCKNAEESQ--------------------PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFG 1811
            TALH A   G  D+VR LV+      +N  ++     ++ A       +V+ L+      N   ++   PL  A   G++ +   LI         +P  ++  +N +                       P+H+A  + +  +A+LL+ +   +N   +   S +  A   G + + +LL+     I+  T+ +  P+H A   G   ++ +L+D    I+ +T     PI +AS  ++++ VRLL+    +I  I  ++  P+HVA   G   V +LL+D     N        P+HIA +   + ++++LL+ GA  + +     TPL++A+  GH  + K L+  G +    S+K   P+H A +    ++A  L+ +   ++    + Q P+H A  SG+  +V+LL+++G++ + P  +   P+H     G+    + L+ N  A         TPL +   +G
Sbjct:  113 TALHIAALAGQEDVVRELVNHG--ANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYG 580          

HSP 6 Score: 135.961 bits (341), Expect = 1.908e-31
Identity = 102/430 (23.72%), Postives = 182/430 (42.33%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKN---------------------------------CEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRP-IFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----------SKVLDANREIFHRVRHDDIVKF 1901
            +D+  CN N  NA     +HL+ + GH ++   L+ K+                                   +NS +++ F+P+  A     + + K L+ N  + N +T     P+  A   G   V   LI      +      R P + IA+ N++     +L+ N  N   ++     P+H+A     + V QLL++   N+N      +  +HIAS  G V +V++LL+ GA  +       TPL+ A   GH  +S++L+D+G  I+ ++     PIH A Q    +  +LL+     ID    +   P+H+A   G+  + KLL+D G+       +   P+H AC+  ++ +++ L+ +  +I     +  TPL +    G+   V  L          S  ++    +  R  H D+  F
Sbjct:   69 VDINTCNQNGLNA-----LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADF 488          

HSP 7 Score: 82.0333 bits (201), Expect = 6.075e-15
Identity = 58/245 (23.67%), Postives = 105/245 (42.86%), Query Frame = 3
Query: 1143 ITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD---------SHCSIDTENDNKQ--------------------KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            + N  +I   N      +H++ ++G V++V  L+     +     K    +HIA+  G+ ++V+ L+ HGA+ N       TPLY+A ++ H  V K L++NG N    +   + P+  A Q G   +   L+              I   ND+ +                     P+H+A    NLN+ +LL++ G+N+    ++    +H A   GN+ +++ L+     I        TPL
Sbjct:   65 LRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPL 309          

HSP 8 Score: 51.9878 bits (123), Expect = 8.013e-6
Identity = 33/152 (21.71%), Postives = 70/152 (46.05%), Query Frame = 3
Query: 1380 ARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A T    A   G+ D +   + NG +I   +      +H + + G  ++   L+     ++T        +H+A  +G  ++V+ LV+HG+N+    +    P++ A +  +L ++K L+ N    +       TPL +    G+++ V++L
Sbjct:   45 AATSFLRAARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYL 196          
BLAST of SMED30013027 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 210.69 bits (535), Expect = 1.816e-54
Identity = 117/453 (25.83%), Postives = 216/453 (47.68%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  + Q  I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L++K    N  + +  +P+  A  +   ++A  LI NK  +N   +  + P+H A+  G  E+  +L++     +  T     P+ + +   + +   LL+ N      +  +   P+HVA + G +++ +LL++   + N A    + P+H+A  +  + IV++LL  GA  +C      TPL++A ++   D ++ L+  G     QS++   P+H A Q G  ++  LL+    ++   N +   P+HLA   G+LNI ++LV H +++    R    P+H AC  GN+ ++K L+ +   ++       TPL      G+ D V+ L K
Sbjct:  297 LSPIHMASQGDHLDCVRLLL--QYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS-GASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLK 746          

HSP 2 Score: 202.601 bits (514), Expect = 4.723e-52
Identity = 121/451 (26.83%), Postives = 219/451 (48.56%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A    N ++ +LL++      +N   ++   A+H A    +  +V +L+ +  +I+    +E+ PLH A  NG+  I+++L+D     +  K      PIH+A Q  H +  +LL++    ++ +     +P+  A + G   +AKLL+      N        P+H A       V  +L+     I+  T     P+ +AS   ++ IV+ L+    +    + + E P+H+A +    +V   LI N   +N        P+H A+ +G  E+V++LLE+GA  +   T   TPL+L T  GH   +++L+DN       + K + P+H A + G  +IA+LL++     ++       P+H+A    +LNIV+LL++ G++  C  R+   P+H A +  ++D  +AL+      + ++    TPL L    G+ D V+ L
Sbjct:  198 FTPLHIAAHYENLNVAQLLLNRG--ANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDH-GAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLL 645          

HSP 3 Score: 199.904 bits (507), Expect = 3.664e-51
Identity = 116/432 (26.85%), Postives = 203/432 (46.99%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHAS 1778
             T LH A   G+H + +LL+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  + +   P+H+A +  H ++A  LI+   ++N+  K + +P+  A  SG  E+ +LL+ N    +  T     P+H  +  G T+ A +L+D Q      T     P+ +A+    ++I  LL+    +          P+HVA     + +V+LL++   + +C       P+H+A +   V+  + LL+ GA  N       TPL+LA ++GH D+  +L+    N+   +     P+H A Q G   IA++LV    S+  E      P+H+AC  GN+ +VK L+ H +N+    +    P+H A + G+ D++  L+ N     C N AS
Sbjct:  330 LTPLHVAAHCGHHRVAKLLLDKG--AKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK-GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA---CPNQAS 755          

HSP 4 Score: 176.022 bits (445), Expect = 8.618e-44
Identity = 113/449 (25.17%), Postives = 211/449 (46.99%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ALH + ++G+  +V  L+   +   +   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI    +     K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R  ++          + IAS   NV +VRLL+     I     +   P+H A + G V + ++L+D+   I       + PIH+AS+   ++ V++LL++ A  + I     TPL++A   GH+ V+K+L+D G     +++  + P+H AC+     + +LL+ S  SID   ++   P+H+A   G+L IVK L+  G++        + P+H A    + D+   L+ N   ++ +     TPL      G+ + V  L
Sbjct:   39 ALHLSSKEGHVKMVTELLHKDI--VLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLEN-GANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLL 480          

HSP 5 Score: 175.252 bits (443), Expect = 1.651e-43
Identity = 114/444 (25.68%), Postives = 209/444 (47.07%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFG 1811
            FT L+ A Q+ +  +V+ LL +G  Q   N AT+     +  A     E +V  LI        K    +  LH A  N +   A +L+   D N +  +     P+H+A  + +  +A+LL+ +   +N   +   S +  A   G + + +LL+     I+  T+ +  P+H A   G   ++ +L+D    I+ +T     PI +AS  ++++ VRLL+    +I  I  ++  P+HVA   G   V +LL+D     N        P+HIA +   + ++++LL+ GA  + +     TPL++A+  GH  + K L+  G +    S+K   P+H A +    ++A  L+ +   ++    + Q P+H A  SG+  +V+LL+++G++ + P  +   P+H     G+    + L+ N  A         TPL +   +G
Sbjct:  103 FTPLYMAAQENHLPVVKFLLENGANQ---NLATEDGFTPLAVALQQGHENVVAYLI----SYGMKGKVRLPALHIAARNDDTRTAAVLLQN-DPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYG 538          

HSP 6 Score: 136.346 bits (342), Expect = 1.337e-31
Identity = 102/430 (23.72%), Postives = 182/430 (42.33%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKN---------------------------------CEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRP-IFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----------SKVLDANREIFHRVRHDDIVKF 1901
            +D+  CN N  NA     +HL+ + GH ++   L+ K+                                   +NS +++ F+P+  A     + + K L+ N  + N +T     P+  A   G   V   LI      +      R P + IA+ N++     +L+ N  N   ++     P+H+A     + V QLL++   N+N      +  +HIAS  G V +V++LL+ GA  +       TPL+ A   GH  +S++L+D+G  I+ ++     PIH A Q    +  +LL+     ID    +   P+H+A   G+  + KLL+D G+       +   P+H AC+  ++ +++ L+ +  +I     +  TPL +    G+   V  L          S  ++    +  R  H D+  F
Sbjct:   27 VDINTCNQNGLNA-----LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADF 446          

HSP 7 Score: 82.0333 bits (201), Expect = 6.386e-15
Identity = 58/245 (23.67%), Postives = 105/245 (42.86%), Query Frame = 3
Query: 1143 ITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD---------SHCSIDTENDNKQ--------------------KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            + N  +I   N      +H++ ++G V++V  L+     +     K    +HIA+  G+ ++V+ L+ HGA+ N       TPLY+A ++ H  V K L++NG N    +   + P+  A Q G   +   L+              I   ND+ +                     P+H+A    NLN+ +LL++ G+N+    ++    +H A   GN+ +++ L+     I        TPL
Sbjct:   23 LRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPL 267          

HSP 8 Score: 51.9878 bits (123), Expect = 7.446e-6
Identity = 33/152 (21.71%), Postives = 70/152 (46.05%), Query Frame = 3
Query: 1380 ARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A T    A   G+ D +   + NG +I   +      +H + + G  ++   L+     ++T        +H+A  +G  ++V+ LV+HG+N+    +    P++ A +  +L ++K L+ N    +       TPL +    G+++ V++L
Sbjct:    3 AATSFLRAARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYL 154          
BLAST of SMED30013027 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 210.69 bits (535), Expect = 1.952e-54
Identity = 131/481 (27.23%), Postives = 220/481 (45.74%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS---TPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYD 1916
             T LH A   G+H + +LL+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  + +   P+H+A +  H ++A  LI+   ++N+  K + +P+  A  SG  E+ +LL+ N    +  T     P+H  +  G T+ A +L+D Q      T     P+ +A+    ++I  LL+    +          P+HVA     + +V+LL++   + +C       P+H+A +   V+  + LL+ GA  N       TPL+LA ++GH D+  +L+    N+   +     P+H A Q G   IA++LV    S+  E      P+H+AC  GN+ +VK L+ H +N+    +    P+H A + G+ D++  L+ N     C N AS    TPL + K  GY      LS V D         RH   + F E  D
Sbjct:  372 LTPLHVAAHCGHHRVAKLLLDKG--AKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK-GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA---CPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANERHR--MSFPETMD 844          

HSP 2 Score: 209.534 bits (532), Expect = 4.539e-54
Identity = 117/453 (25.83%), Postives = 216/453 (47.68%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  + Q  I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L++K    N  + +  +P+  A  +   ++A  LI NK  +N   +  + P+H A+  G  E+  +L++     +  T     P+ + +   + +   LL+ N      +  +   P+HVA + G +++ +LL++   + N A    + P+H+A  +  + IV++LL  GA  +C      TPL++A ++   D ++ L+  G     QS++   P+H A Q G  ++  LL+    ++   N +   P+HLA   G+LNI ++LV H +++    R    P+H AC  GN+ ++K L+ +   ++       TPL      G+ D V+ L K
Sbjct:  339 LSPIHMASQGDHLDCVRLLL--QYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS-GASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLK 788          

HSP 3 Score: 202.601 bits (514), Expect = 6.952e-52
Identity = 156/636 (24.53%), Postives = 281/636 (44.18%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANRE---IFHRVRHDDIVKFNELYDAHTLFV-LEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFP-------------NENPYFNLM-MAIKDND 2324
            FT LH A    N ++ +LL++      +N   ++   A+H A    +  +V +L+ +  +I+    +E+ PLH A  NG+  I+++L+D     +  K      PIH+A Q  H +  +LL++    ++ +     +P+  A + G   +AKLL+      N        P+H A       V  +L+     I+  T     P+ +AS   ++ IV+ L+    +    + + E P+H+A +    +V   LI N   +N        P+H A+ +G  E+V++LLE+GA  +   T   TPL+L T  GH   +++L+DN       + K + P+H A + G  +IA+LL++     ++       P+H+A    +LNIV+LL++ G++  C  R+   P+H A +  ++D  +AL+      + ++    TPL L    G+ D V+ L    + V   N+      H    +  +   E+  +H   V  E   G + L VA    + +++ ++L    N   +  L         ++    I    L    C N + S       ++  R   ++ T  L L T   +   A + R R+ FP             +E PYF      ++D D
Sbjct:  240 FTPLHIAAHYENLNVAQLLLNRG--ANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDH-GAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQA-SMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANE-RHRMSFPETMDEPMDVSEDEDEPPYFRAAPPGLRDPD 870          

HSP 4 Score: 174.866 bits (442), Expect = 2.063e-43
Identity = 113/449 (25.17%), Postives = 211/449 (46.99%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ALH + ++G+  +V  L+   +   +   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI    +     K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R  ++          + IAS   NV +VRLL+     I     +   P+H A + G V + ++L+D+   I       + PIH+AS+   ++ V++LL++ A  + I     TPL++A   GH+ V+K+L+D G     +++  + P+H AC+     + +LL+ S  SID   ++   P+H+A   G+L IVK L+  G++        + P+H A    + D+   L+ N   ++ +     TPL      G+ + V  L
Sbjct:   81 ALHLSSKEGHVKMVTELLHKDI--VLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLEN-GANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLL 522          

HSP 5 Score: 174.096 bits (440), Expect = 3.781e-43
Identity = 114/444 (25.68%), Postives = 209/444 (47.07%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFG 1811
            FT L+ A Q+ +  +V+ LL +G  Q   N AT+     +  A     E +V  LI        K    +  LH A  N +   A +L+   D N +  +     P+H+A  + +  +A+LL+ +   +N   +   S +  A   G + + +LL+     I+  T+ +  P+H A   G   ++ +L+D    I+ +T     PI +AS  ++++ VRLL+    +I  I  ++  P+HVA   G   V +LL+D     N        P+HIA +   + ++++LL+ GA  + +     TPL++A+  GH  + K L+  G +    S+K   P+H A +    ++A  L+ +   ++    + Q P+H A  SG+  +V+LL+++G++ + P  +   P+H     G+    + L+ N  A         TPL +   +G
Sbjct:  145 FTPLYMAAQENHLPVVKFLLENGANQ---NLATEDGFTPLAVALQQGHENVVAYLI----SYGMKGKVRLPALHIAARNDDTRTAAVLLQN-DPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYG 580          

HSP 6 Score: 135.961 bits (341), Expect = 2.306e-31
Identity = 102/430 (23.72%), Postives = 182/430 (42.33%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKN---------------------------------CEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRP-IFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----------SKVLDANREIFHRVRHDDIVKF 1901
            +D+  CN N  NA     +HL+ + GH ++   L+ K+                                   +NS +++ F+P+  A     + + K L+ N  + N +T     P+  A   G   V   LI      +      R P + IA+ N++     +L+ N  N   ++     P+H+A     + V QLL++   N+N      +  +HIAS  G V +V++LL+ GA  +       TPL+ A   GH  +S++L+D+G  I+ ++     PIH A Q    +  +LL+     ID    +   P+H+A   G+  + KLL+D G+       +   P+H AC+  ++ +++ L+ +  +I     +  TPL +    G+   V  L          S  ++    +  R  H D+  F
Sbjct:   69 VDINTCNQNGLNA-----LHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADF 488          

HSP 7 Score: 82.0333 bits (201), Expect = 6.619e-15
Identity = 58/245 (23.67%), Postives = 105/245 (42.86%), Query Frame = 3
Query: 1143 ITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD---------SHCSIDTENDNKQ--------------------KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            + N  +I   N      +H++ ++G V++V  L+     +     K    +HIA+  G+ ++V+ L+ HGA+ N       TPLY+A ++ H  V K L++NG N    +   + P+  A Q G   +   L+              I   ND+ +                     P+H+A    NLN+ +LL++ G+N+    ++    +H A   GN+ +++ L+     I        TPL
Sbjct:   65 LRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPL 309          

HSP 8 Score: 51.9878 bits (123), Expect = 8.873e-6
Identity = 33/152 (21.71%), Postives = 70/152 (46.05%), Query Frame = 3
Query: 1380 ARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A T    A   G+ D +   + NG +I   +      +H + + G  ++   L+     ++T        +H+A  +G  ++V+ LV+HG+N+    +    P++ A +  +L ++K L+ N    +       TPL +    G+++ V++L
Sbjct:   45 AATSFLRAARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYL 196          
BLAST of SMED30013027 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 210.69 bits (535), Expect = 2.066e-54
Identity = 131/481 (27.23%), Postives = 220/481 (45.74%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS---TPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYD 1916
             T LH A   G+H + +LL+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  + +   P+H+A +  H ++A  LI+   ++N+  K + +P+  A  SG  E+ +LL+ N    +  T     P+H  +  G T+ A +L+D Q      T     P+ +A+    ++I  LL+    +          P+HVA     + +V+LL++   + +C       P+H+A +   V+  + LL+ GA  N       TPL+LA ++GH D+  +L+    N+   +     P+H A Q G   IA++LV    S+  E      P+H+AC  GN+ +VK L+ H +N+    +    P+H A + G+ D++  L+ N     C N AS    TPL + K  GY      LS V D         RH   + F E  D
Sbjct:  297 LTPLHVAAHCGHHRVAKLLLDKG--AKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQK-GASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGA---CPNQASMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANERHR--MSFPETMD 769          

HSP 2 Score: 209.534 bits (532), Expect = 4.604e-54
Identity = 117/453 (25.83%), Postives = 216/453 (47.68%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  + Q  I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L++K    N  + +  +P+  A  +   ++A  LI NK  +N   +  + P+H A+  G  E+  +L++     +  T     P+ + +   + +   LL+ N      +  +   P+HVA + G +++ +LL++   + N A    + P+H+A  +  + IV++LL  GA  +C      TPL++A ++   D ++ L+  G     QS++   P+H A Q G  ++  LL+    ++   N +   P+HLA   G+LNI ++LV H +++    R    P+H AC  GN+ ++K L+ +   ++       TPL      G+ D V+ L K
Sbjct:  264 LSPIHMASQGDHLDCVRLLL--QYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS-GASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLK 713          

HSP 3 Score: 202.216 bits (513), Expect = 7.499e-52
Identity = 156/636 (24.53%), Postives = 281/636 (44.18%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANRE---IFHRVRHDDIVKFNELYDAHTLFV-LEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFP-------------NENPYFNLM-MAIKDND 2324
            FT LH A    N ++ +LL++      +N   ++   A+H A    +  +V +L+ +  +I+    +E+ PLH A  NG+  I+++L+D     +  K      PIH+A Q  H +  +LL++    ++ +     +P+  A + G   +AKLL+      N        P+H A       V  +L+     I+  T     P+ +AS   ++ IV+ L+    +    + + E P+H+A +    +V   LI N   +N        P+H A+ +G  E+V++LLE+GA  +   T   TPL+L T  GH   +++L+DN       + K + P+H A + G  +IA+LL++     ++       P+H+A    +LNIV+LL++ G++  C  R+   P+H A +  ++D  +AL+      + ++    TPL L    G+ D V+ L    + V   N+      H    +  +   E+  +H   V  E   G + L VA    + +++ ++L    N   +  L         ++    I    L    C N + S       ++  R   ++ T  L L T   +   A + R R+ FP             +E PYF      ++D D
Sbjct:  165 FTPLHIAAHYENLNVAQLLLNRG--ANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDH-GAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQA-SMNGITPLAIAKRLGYISVTDVLSLVTDGPHIQLANE-RHRMSFPETMDEPMDVSEDEDEPPYFRAAPPGLRDPD 795          

HSP 4 Score: 174.866 bits (442), Expect = 2.218e-43
Identity = 113/449 (25.17%), Postives = 211/449 (46.99%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ALH + ++G+  +V  L+   +   +   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI    +     K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R  ++          + IAS   NV +VRLL+     I     +   P+H A + G V + ++L+D+   I       + PIH+AS+   ++ V++LL++ A  + I     TPL++A   GH+ V+K+L+D G     +++  + P+H AC+     + +LL+ S  SID   ++   P+H+A   G+L IVK L+  G++        + P+H A    + D+   L+ N   ++ +     TPL      G+ + V  L
Sbjct:    6 ALHLSSKEGHVKMVTELLHKDI--VLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLEN-GANQNLATEDGFTPLAVALQQGHENVVAYLISYGMK----GKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLL 447          

HSP 5 Score: 174.096 bits (440), Expect = 4.135e-43
Identity = 114/444 (25.68%), Postives = 209/444 (47.07%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFG 1811
            FT L+ A Q+ +  +V+ LL +G  Q   N AT+     +  A     E +V  LI        K    +  LH A  N +   A +L+   D N +  +     P+H+A  + +  +A+LL+ +   +N   +   S +  A   G + + +LL+     I+  T+ +  P+H A   G   ++ +L+D    I+ +T     PI +AS  ++++ VRLL+    +I  I  ++  P+HVA   G   V +LL+D     N        P+HIA +   + ++++LL+ GA  + +     TPL++A+  GH  + K L+  G +    S+K   P+H A +    ++A  L+ +   ++    + Q P+H A  SG+  +V+LL+++G++ + P  +   P+H     G+    + L+ N  A         TPL +   +G
Sbjct:   70 FTPLYMAAQENHLPVVKFLLENGANQ---NLATEDGFTPLAVALQQGHENVVAYLI----SYGMKGKVRLPALHIAARNDDTRTAAVLLQN-DPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYG 505          
BLAST of SMED30013027 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 197.593 bits (501), Expect = 6.873e-51
Identity = 128/519 (24.66%), Postives = 234/519 (45.09%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI----------NDATKSAN-----------------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEI---------------------------------VKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSKVLDAN 1856
            FT L  A QQG+ ++V  L++   + K+          ND T++A                    +H A   E+  + ++L+ +   +N      + PLH A   GN  + +LL+D     +  +  +E  P+H A ++GH  I+++L++    + +  K   SPI  A     ++  +LL+    +I+  T     P+H A+  G   VA +L+D+        +    P+ IA   N++ ++ LL+    +I  + +    P+HVA   G + +V+ L+    + N +N K+  P+H+A+  G  E+                                 VK+LLE+GA  N   T   TPL+ A  +GH D +  L++   +  C + K + P+H A + G   +A+LL++     +    N   P+H+A    NL+IVKLL+  G +   P  +   P+H A +   +++ ++L+    + + ++    TPL L    G+ + V+  LSK  + N
Sbjct:  149 FTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDR-GAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGN 666          

HSP 2 Score: 196.438 bits (498), Expect = 1.536e-50
Identity = 115/453 (25.39%), Postives = 216/453 (47.68%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L+++    N  N +  +P+  A  +G  E+AK L+ NK   N   +  + P+H A+ +G T +  +L++        T     P+  A+   +V+    L+    +  C+  +   P+HVA + G V + +LL+++  + N A    + P+H+A  +  ++IVK+LL  G   +       TPL++A ++   +V++ L+  G +   +S++   P+H A Q G  E+  LL+    + +  N +   P+HL    G++ +  +L+ HG  ++   R    P+H A   GN+ L+K L+ +   ++ K     +PL      G+ D V+ L K
Sbjct:  310 LSPIHMAAQGDHLDCVRLLL--QYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKT-GASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 759          

HSP 3 Score: 196.052 bits (497), Expect = 1.895e-50
Identity = 119/482 (24.69%), Postives = 223/482 (46.27%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIF----HRVRHDDIVKFNELYD 1916
             T LH A   G+H + ++L+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  N +   P+H+A + GH E+AK L++   + N+  K + +P+  A   G   + KLL+ N    N +T     P+H A+  G  + A  L++++    C T     P+ +A+    V +  LL+ +  +          P+HVA     +++V+LL+    + +        P+HIA++  ++E+ + LL++G   N       TPL+LA ++GH ++  +L+    N    +     P+H   Q G   +A +L+    ++D        P+H+A   GN+ +VK L+ H +++    +    P+H A + G+ D++  L+ N  + +  +   +TPL + K  GY      L  V D    +     HR+ + + V  +E+ D
Sbjct:  343 LTPLHVAAHCGHHRVAKVLLDKG--AKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKVVTDETSVVLVSDKHRMSYPETV--DEILD 819          

HSP 4 Score: 174.481 bits (441), Expect = 1.108e-43
Identity = 115/451 (25.50%), Postives = 214/451 (47.45%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  L+  ++  +    TK  N A+H A ++  +E+V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI    +     K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R   +         P+ IAS   NV +VRLL+     I+    +   P+H A + G V + ++L+D+   I       + PIH+A++   ++ V++LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     + +LL+ +  SID   ++   P+H+A   G+L IVK L+  G++    +   + P+H A   G+ ++ K L+ N    + K     TPL      G+   V  L
Sbjct:   50 LNGLHLASKEGHVKMVVELLHKEIILETT--TKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVAHLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLL 493          

HSP 5 Score: 164.851 bits (416), Expect = 1.114e-40
Identity = 112/453 (24.72%), Postives = 210/453 (46.36%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGY-DDCVSFLSK 1841
            TALH A   G  ++VR LV+      +N  ++     ++ A      E+V+ L+      N   ++   PL  A   G++ +   LI     N   K       +H+A ++     A +L++ +   + ++K  F+P+  A +   + +A+LL+     +N + +    P+H AS  G   +  +L+DR   IE  T  +  P+  A+ N +V I  +L+ +   I+        PIH+A Q   ++ V+LL+  +  I+      + P+H+A+  G   + K+LL+ GA  N       TPL++A +K H  V ++L+  G +I+  +     P+H A   G   I + L+    S +  N   + P+H+A  +G+  + K L+ + +      + ++ P+H A   G+  ++K L+ N  + +    A  TPL      G+ D  ++ L K
Sbjct:   84 TALHIAALAGQDEVVRELVN--YGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI-----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEK 529          

HSP 6 Score: 137.887 bits (346), Expect = 2.877e-32
Identity = 101/443 (22.80%), Postives = 187/443 (42.21%), Query Frame = 3
Query:  705 ACTNGN--KAIAQLL--IDVPDCNVNCKNAEESQPIHLACQHGHF---------------------------------EIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLID----------------RQCDIECETILKR-------------RPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A  +GN  KA+  L   +D+  CN N  N      +HLA + GH                                  E+ + L+     +N+ +++ F+P+  A     +E+ K L+ N  + N +T     P+  A   G   V   LI+                R  D     +L +              P+ IA+   N+ + +LL+    ++         P+H+A ++G V +V+LL+D    I       + P+H A+ NG V I +ILL+HGA          +P+++A +  H D  ++L+     I+  ++    P+H A   G   +A++L+D     ++   N   P+H+AC   ++ +++LL+  G++++    S   P+H A   G+L ++K L+    + +  N    TPL +    G+ +   +L
Sbjct:   23 AARSGNLDKALDHLRNGVDINTCNQNGLNG-----LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL 460          

HSP 7 Score: 121.324 bits (303), Expect = 3.455e-27
Identity = 86/323 (26.63%), Postives = 151/323 (46.75%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREI 1865
            L A  SG ++ A   + N  DIN   +     +H AS  G  ++   L+ ++  +E  T      + IA+     E+VR L+    N+   + +   P+++A Q+  +EVV+ L++N  N N A +    P+ +A + G   +V  L+ +G          R P L++A        + VL+ N  N +  S   + P+H A       +AQLL++   S++    N   P+H+A   GN+ +V+LL+D G+ +E   +    P+H A  NG++ + + L+ +   I  K     +P+ +     + DCV  L   L  N EI
Sbjct:   21 LRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL---LQYNAEI 335          
BLAST of SMED30013027 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 196.823 bits (499), Expect = 3.207e-50
Identity = 128/519 (24.66%), Postives = 234/519 (45.09%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI----------NDATKSAN-----------------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEI---------------------------------VKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSKVLDAN 1856
            FT L  A QQG+ ++V  L++   + K+          ND T++A                    +H A   E+  + ++L+ +   +N      + PLH A   GN  + +LL+D     +  +  +E  P+H A ++GH  I+++L++    + +  K   SPI  A     ++  +LL+    +I+  T     P+H A+  G   VA +L+D+        +    P+ IA   N++ ++ LL+    +I  + +    P+HVA   G + +V+ L+    + N +N K+  P+H+A+  G  E+                                 VK+LLE+GA  N   T   TPL+ A  +GH D +  L++   +  C + K + P+H A + G   +A+LL++     +    N   P+H+A    NL+IVKLL+  G +   P  +   P+H A +   +++ ++L+    + + ++    TPL L    G+ + V+  LSK  + N
Sbjct:  178 FTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDR-GAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGN 695          

HSP 2 Score: 195.282 bits (495), Expect = 9.535e-50
Identity = 119/482 (24.69%), Postives = 223/482 (46.27%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIF----HRVRHDDIVKFNELYD 1916
             T LH A   G+H + ++L+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  N +   P+H+A + GH E+AK L++   + N+  K + +P+  A   G   + KLL+ N    N +T     P+H A+  G  + A  L++++    C T     P+ +A+    V +  LL+ +  +          P+HVA     +++V+LL+    + +        P+HIA++  ++E+ + LL++G   N       TPL+LA ++GH ++  +L+    N    +     P+H   Q G   +A +L+    ++D        P+H+A   GN+ +VK L+ H +++    +    P+H A + G+ D++  L+ N  + +  +   +TPL + K  GY      L  V D    +     HR+ + + V  +E+ D
Sbjct:  372 LTPLHVAAHCGHHRVAKVLLDKG--AKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKVVTDETSVVLVSDKHRMSYPETV--DEILD 848          

HSP 3 Score: 194.897 bits (494), Expect = 1.021e-49
Identity = 115/453 (25.39%), Postives = 216/453 (47.68%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L+++    N  N +  +P+  A  +G  E+AK L+ NK   N   +  + P+H A+ +G T +  +L++        T     P+  A+   +V+    L+    +  C+  +   P+HVA + G V + +LL+++  + N A    + P+H+A  +  ++IVK+LL  G   +       TPL++A ++   +V++ L+  G +   +S++   P+H A Q G  E+  LL+    + +  N +   P+HL    G++ +  +L+ HG  ++   R    P+H A   GN+ L+K L+ +   ++ K     +PL      G+ D V+ L K
Sbjct:  339 LSPIHMAAQGDHLDCVRLLL--QYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKT-GASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 788          

HSP 4 Score: 174.481 bits (441), Expect = 2.384e-43
Identity = 115/451 (25.50%), Postives = 214/451 (47.45%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  L+  ++   +   TK  N A+H A ++  +E+V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI       +  K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R   +         P+ IAS   NV +VRLL+     I+    +   P+H A + G V + ++L+D+   I       + PIH+A++   ++ V++LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     + +LL+ +  SID   ++   P+H+A   G+L IVK L+  G++    +   + P+H A   G+ ++ K L+ N    + K     TPL      G+   V  L
Sbjct:   79 LNGLHLASKEGHVKMVVELLHKEI--ILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLL 522          

HSP 5 Score: 164.851 bits (416), Expect = 2.285e-40
Identity = 112/453 (24.72%), Postives = 210/453 (46.36%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGY-DDCVSFLSK 1841
            TALH A   G  ++VR LV+      +N  ++     ++ A      E+V+ L+      N   ++   PL  A   G++ +   LI     N   K       +H+A ++     A +L++ +   + ++K  F+P+  A +   + +A+LL+     +N + +    P+H AS  G   +  +L+DR   IE  T  +  P+  A+ N +V I  +L+ +   I+        PIH+A Q   ++ V+LL+  +  I+      + P+H+A+  G   + K+LL+ GA  N       TPL++A +K H  V ++L+  G +I+  +     P+H A   G   I + L+    S +  N   + P+H+A  +G+  + K L+ + +      + ++ P+H A   G+  ++K L+ N  + +    A  TPL      G+ D  ++ L K
Sbjct:  113 TALHIAALAGQDEVVRELVN--YGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI-----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEK 558          

HSP 6 Score: 137.887 bits (346), Expect = 3.652e-32
Identity = 101/443 (22.80%), Postives = 187/443 (42.21%), Query Frame = 3
Query:  705 ACTNGN--KAIAQLL--IDVPDCNVNCKNAEESQPIHLACQHGHF---------------------------------EIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLID----------------RQCDIECETILKR-------------RPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A  +GN  KA+  L   +D+  CN N  N      +HLA + GH                                  E+ + L+     +N+ +++ F+P+  A     +E+ K L+ N  + N +T     P+  A   G   V   LI+                R  D     +L +              P+ IA+   N+ + +LL+    ++         P+H+A ++G V +V+LL+D    I       + P+H A+ NG V I +ILL+HGA          +P+++A +  H D  ++L+     I+  ++    P+H A   G   +A++L+D     ++   N   P+H+AC   ++ +++LL+  G++++    S   P+H A   G+L ++K L+    + +  N    TPL +    G+ +   +L
Sbjct:   52 AARSGNLDKALDHLRNGVDINTCNQNGLNG-----LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL 489          

HSP 7 Score: 121.709 bits (304), Expect = 3.619e-27
Identity = 86/323 (26.63%), Postives = 151/323 (46.75%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREI 1865
            L A  SG ++ A   + N  DIN   +     +H AS  G  ++   L+ ++  +E  T      + IA+     E+VR L+    N+   + +   P+++A Q+  +EVV+ L++N  N N A +    P+ +A + G   +V  L+ +G          R P L++A        + VL+ N  N +  S   + P+H A       +AQLL++   S++    N   P+H+A   GN+ +V+LL+D G+ +E   +    P+H A  NG++ + + L+ +   I  K     +P+ +     + DCV  L   L  N EI
Sbjct:   50 LRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL---LQYNAEI 364          
BLAST of SMED30013027 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 196.823 bits (499), Expect = 3.245e-50
Identity = 128/519 (24.66%), Postives = 234/519 (45.09%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI----------NDATKSAN-----------------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEI---------------------------------VKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSKVLDAN 1856
            FT L  A QQG+ ++V  L++   + K+          ND T++A                    +H A   E+  + ++L+ +   +N      + PLH A   GN  + +LL+D     +  +  +E  P+H A ++GH  I+++L++    + +  K   SPI  A     ++  +LL+    +I+  T     P+H A+  G   VA +L+D+        +    P+ IA   N++ ++ LL+    +I  + +    P+HVA   G + +V+ L+    + N +N K+  P+H+A+  G  E+                                 VK+LLE+GA  N   T   TPL+ A  +GH D +  L++   +  C + K + P+H A + G   +A+LL++     +    N   P+H+A    NL+IVKLL+  G +   P  +   P+H A +   +++ ++L+    + + ++    TPL L    G+ + V+  LSK  + N
Sbjct:  149 FTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDR-GAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGN 666          

HSP 2 Score: 195.282 bits (495), Expect = 9.001e-50
Identity = 115/453 (25.39%), Postives = 216/453 (47.68%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L+++    N  N +  +P+  A  +G  E+AK L+ NK   N   +  + P+H A+ +G T +  +L++        T     P+  A+   +V+    L+    +  C+  +   P+HVA + G V + +LL+++  + N A    + P+H+A  +  ++IVK+LL  G   +       TPL++A ++   +V++ L+  G +   +S++   P+H A Q G  E+  LL+    + +  N +   P+HL    G++ +  +L+ HG  ++   R    P+H A   GN+ L+K L+ +   ++ K     +PL      G+ D V+ L K
Sbjct:  310 LSPIHMAAQGDHLDCVRLLL--QYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKT-GASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 759          

HSP 3 Score: 194.897 bits (494), Expect = 1.050e-49
Identity = 119/482 (24.69%), Postives = 223/482 (46.27%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIF----HRVRHDDIVKFNELYD 1916
             T LH A   G+H + ++L+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  N +   P+H+A + GH E+AK L++   + N+  K + +P+  A   G   + KLL+ N    N +T     P+H A+  G  + A  L++++    C T     P+ +A+    V +  LL+ +  +          P+HVA     +++V+LL+    + +        P+HIA++  ++E+ + LL++G   N       TPL+LA ++GH ++  +L+    N    +     P+H   Q G   +A +L+    ++D        P+H+A   GN+ +VK L+ H +++    +    P+H A + G+ D++  L+ N  + +  +   +TPL + K  GY      L  V D    +     HR+ + + V  +E+ D
Sbjct:  343 LTPLHVAAHCGHHRVAKVLLDKG--AKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKVVTDETSVVLVSDKHRMSYPETV--DEILD 819          

HSP 4 Score: 174.481 bits (441), Expect = 2.646e-43
Identity = 115/451 (25.50%), Postives = 214/451 (47.45%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  L+  ++   +   TK  N A+H A ++  +E+V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI       +  K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R   +         P+ IAS   NV +VRLL+     I+    +   P+H A + G V + ++L+D+   I       + PIH+A++   ++ V++LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     + +LL+ +  SID   ++   P+H+A   G+L IVK L+  G++    +   + P+H A   G+ ++ K L+ N    + K     TPL      G+   V  L
Sbjct:   50 LNGLHLASKEGHVKMVVELLHKEI--ILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLL 493          

HSP 5 Score: 164.851 bits (416), Expect = 2.077e-40
Identity = 112/453 (24.72%), Postives = 210/453 (46.36%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGY-DDCVSFLSK 1841
            TALH A   G  ++VR LV+      +N  ++     ++ A      E+V+ L+      N   ++   PL  A   G++ +   LI     N   K       +H+A ++     A +L++ +   + ++K  F+P+  A +   + +A+LL+     +N + +    P+H AS  G   +  +L+DR   IE  T  +  P+  A+ N +V I  +L+ +   I+        PIH+A Q   ++ V+LL+  +  I+      + P+H+A+  G   + K+LL+ GA  N       TPL++A +K H  V ++L+  G +I+  +     P+H A   G   I + L+    S +  N   + P+H+A  +G+  + K L+ + +      + ++ P+H A   G+  ++K L+ N  + +    A  TPL      G+ D  ++ L K
Sbjct:   84 TALHIAALAGQDEVVRELVN--YGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI-----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEK 529          

HSP 6 Score: 137.887 bits (346), Expect = 4.030e-32
Identity = 101/443 (22.80%), Postives = 187/443 (42.21%), Query Frame = 3
Query:  705 ACTNGN--KAIAQLL--IDVPDCNVNCKNAEESQPIHLACQHGHF---------------------------------EIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLID----------------RQCDIECETILKR-------------RPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A  +GN  KA+  L   +D+  CN N  N      +HLA + GH                                  E+ + L+     +N+ +++ F+P+  A     +E+ K L+ N  + N +T     P+  A   G   V   LI+                R  D     +L +              P+ IA+   N+ + +LL+    ++         P+H+A ++G V +V+LL+D    I       + P+H A+ NG V I +ILL+HGA          +P+++A +  H D  ++L+     I+  ++    P+H A   G   +A++L+D     ++   N   P+H+AC   ++ +++LL+  G++++    S   P+H A   G+L ++K L+    + +  N    TPL +    G+ +   +L
Sbjct:   23 AARSGNLDKALDHLRNGVDINTCNQNGLNG-----LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL 460          

HSP 7 Score: 121.324 bits (303), Expect = 4.179e-27
Identity = 86/323 (26.63%), Postives = 151/323 (46.75%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREI 1865
            L A  SG ++ A   + N  DIN   +     +H AS  G  ++   L+ ++  +E  T      + IA+     E+VR L+    N+   + +   P+++A Q+  +EVV+ L++N  N N A +    P+ +A + G   +V  L+ +G          R P L++A        + VL+ N  N +  S   + P+H A       +AQLL++   S++    N   P+H+A   GN+ +V+LL+D G+ +E   +    P+H A  NG++ + + L+ +   I  K     +P+ +     + DCV  L   L  N EI
Sbjct:   21 LRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL---LQYNAEI 335          
BLAST of SMED30013027 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 196.823 bits (499), Expect = 3.410e-50
Identity = 128/519 (24.66%), Postives = 234/519 (45.09%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI----------NDATKSAN-----------------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEI---------------------------------VKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSKVLDAN 1856
            FT L  A QQG+ ++V  L++   + K+          ND T++A                    +H A   E+  + ++L+ +   +N      + PLH A   GN  + +LL+D     +  +  +E  P+H A ++GH  I+++L++    + +  K   SPI  A     ++  +LL+    +I+  T     P+H A+  G   VA +L+D+        +    P+ IA   N++ ++ LL+    +I  + +    P+HVA   G + +V+ L+    + N +N K+  P+H+A+  G  E+                                 VK+LLE+GA  N   T   TPL+ A  +GH D +  L++   +  C + K + P+H A + G   +A+LL++     +    N   P+H+A    NL+IVKLL+  G +   P  +   P+H A +   +++ ++L+    + + ++    TPL L    G+ + V+  LSK  + N
Sbjct:  149 FTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDR-GAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGN 666          

HSP 2 Score: 195.282 bits (495), Expect = 9.219e-50
Identity = 115/453 (25.39%), Postives = 216/453 (47.68%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L+++    N  N +  +P+  A  +G  E+AK L+ NK   N   +  + P+H A+ +G T +  +L++        T     P+  A+   +V+    L+    +  C+  +   P+HVA + G V + +LL+++  + N A    + P+H+A  +  ++IVK+LL  G   +       TPL++A ++   +V++ L+  G +   +S++   P+H A Q G  E+  LL+    + +  N +   P+HL    G++ +  +L+ HG  ++   R    P+H A   GN+ L+K L+ +   ++ K     +PL      G+ D V+ L K
Sbjct:  310 LSPIHMAAQGDHLDCVRLLL--QYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKT-GASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 759          

HSP 3 Score: 194.897 bits (494), Expect = 1.152e-49
Identity = 119/482 (24.69%), Postives = 223/482 (46.27%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIF----HRVRHDDIVKFNELYD 1916
             T LH A   G+H + ++L+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  N +   P+H+A + GH E+AK L++   + N+  K + +P+  A   G   + KLL+ N    N +T     P+H A+  G  + A  L++++    C T     P+ +A+    V +  LL+ +  +          P+HVA     +++V+LL+    + +        P+HIA++  ++E+ + LL++G   N       TPL+LA ++GH ++  +L+    N    +     P+H   Q G   +A +L+    ++D        P+H+A   GN+ +VK L+ H +++    +    P+H A + G+ D++  L+ N  + +  +   +TPL + K  GY      L  V D    +     HR+ + + V  +E+ D
Sbjct:  343 LTPLHVAAHCGHHRVAKVLLDKG--AKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKVVTDETSVVLVSDKHRMSYPETV--DEILD 819          

HSP 4 Score: 174.096 bits (440), Expect = 2.757e-43
Identity = 115/451 (25.50%), Postives = 214/451 (47.45%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  L+  ++   +   TK  N A+H A ++  +E+V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI       +  K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R   +         P+ IAS   NV +VRLL+     I+    +   P+H A + G V + ++L+D+   I       + PIH+A++   ++ V++LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     + +LL+ +  SID   ++   P+H+A   G+L IVK L+  G++    +   + P+H A   G+ ++ K L+ N    + K     TPL      G+   V  L
Sbjct:   50 LNGLHLASKEGHVKMVVELLHKEI--ILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLL 493          

HSP 5 Score: 164.851 bits (416), Expect = 2.056e-40
Identity = 112/453 (24.72%), Postives = 210/453 (46.36%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGY-DDCVSFLSK 1841
            TALH A   G  ++VR LV+      +N  ++     ++ A      E+V+ L+      N   ++   PL  A   G++ +   LI     N   K       +H+A ++     A +L++ +   + ++K  F+P+  A +   + +A+LL+     +N + +    P+H AS  G   +  +L+DR   IE  T  +  P+  A+ N +V I  +L+ +   I+        PIH+A Q   ++ V+LL+  +  I+      + P+H+A+  G   + K+LL+ GA  N       TPL++A +K H  V ++L+  G +I+  +     P+H A   G   I + L+    S +  N   + P+H+A  +G+  + K L+ + +      + ++ P+H A   G+  ++K L+ N  + +    A  TPL      G+ D  ++ L K
Sbjct:   84 TALHIAALAGQDEVVRELVN--YGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI-----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEK 529          

HSP 6 Score: 137.887 bits (346), Expect = 4.309e-32
Identity = 101/443 (22.80%), Postives = 187/443 (42.21%), Query Frame = 3
Query:  705 ACTNGN--KAIAQLL--IDVPDCNVNCKNAEESQPIHLACQHGHF---------------------------------EIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLID----------------RQCDIECETILKR-------------RPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A  +GN  KA+  L   +D+  CN N  N      +HLA + GH                                  E+ + L+     +N+ +++ F+P+  A     +E+ K L+ N  + N +T     P+  A   G   V   LI+                R  D     +L +              P+ IA+   N+ + +LL+    ++         P+H+A ++G V +V+LL+D    I       + P+H A+ NG V I +ILL+HGA          +P+++A +  H D  ++L+     I+  ++    P+H A   G   +A++L+D     ++   N   P+H+AC   ++ +++LL+  G++++    S   P+H A   G+L ++K L+    + +  N    TPL +    G+ +   +L
Sbjct:   23 AARSGNLDKALDHLRNGVDINTCNQNGLNG-----LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL 460          

HSP 7 Score: 121.324 bits (303), Expect = 4.319e-27
Identity = 86/323 (26.63%), Postives = 151/323 (46.75%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREI 1865
            L A  SG ++ A   + N  DIN   +     +H AS  G  ++   L+ ++  +E  T      + IA+     E+VR L+    N+   + +   P+++A Q+  +EVV+ L++N  N N A +    P+ +A + G   +V  L+ +G          R P L++A        + VL+ N  N +  S   + P+H A       +AQLL++   S++    N   P+H+A   GN+ +V+LL+D G+ +E   +    P+H A  NG++ + + L+ +   I  K     +P+ +     + DCV  L   L  N EI
Sbjct:   21 LRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL---LQYNAEI 335          
BLAST of SMED30013027 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 196.438 bits (498), Expect = 4.156e-50
Identity = 130/519 (25.05%), Postives = 234/519 (45.09%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLV----SGKVQCKI------NDATKSAN-----------------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEI---------------------------------VKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSKVLDAN 1856
            FT L  A QQG+ ++V  L+     GKV+         ND T++A                    +H A   E+  + ++L+ +   +N      + PLH A   GN  + +LL+D     +  +  +E  P+H A ++GH  I+++L++    + +  K   SPI  A     ++  +LL+    +I+  T     P+H A+  G   VA +L+D+        +    P+ IA   N++ ++ LL+    +I  + +    P+HVA   G + +V+ L+    + N +N K+  P+H+A+  G  E+                                 VK+LLE+GA  N   T   TPL+ A  +GH D +  L++   +  C + K + P+H A + G   +A+LL++     +    N   P+H+A    NL+IVKLL+  G +   P  +   P+H A +   +++ ++L+    + + ++    TPL L    G+ + V+  LSK  + N
Sbjct:  178 FTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDR-GAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGN 695          

HSP 2 Score: 194.897 bits (494), Expect = 1.368e-49
Identity = 115/453 (25.39%), Postives = 216/453 (47.68%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L+++    N  N +  +P+  A  +G  E+AK L+ NK   N   +  + P+H A+ +G T +  +L++        T     P+  A+   +V+    L+    +  C+  +   P+HVA + G V + +LL+++  + N A    + P+H+A  +  ++IVK+LL  G   +       TPL++A ++   +V++ L+  G +   +S++   P+H A Q G  E+  LL+    + +  N +   P+HL    G++ +  +L+ HG  ++   R    P+H A   GN+ L+K L+ +   ++ K     +PL      G+ D V+ L K
Sbjct:  339 LSPIHMAAQGDHLDCVRLLL--QYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKT-GASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 788          

HSP 3 Score: 194.897 bits (494), Expect = 1.368e-49
Identity = 119/482 (24.69%), Postives = 223/482 (46.27%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIF----HRVRHDDIVKFNELYD 1916
             T LH A   G+H + ++L+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  N +   P+H+A + GH E+AK L++   + N+  K + +P+  A   G   + KLL+ N    N +T     P+H A+  G  + A  L++++    C T     P+ +A+    V +  LL+ +  +          P+HVA     +++V+LL+    + +        P+HIA++  ++E+ + LL++G   N       TPL+LA ++GH ++  +L+    N    +     P+H   Q G   +A +L+    ++D        P+H+A   GN+ +VK L+ H +++    +    P+H A + G+ D++  L+ N  + +  +   +TPL + K  GY      L  V D    +     HR+ + + V  +E+ D
Sbjct:  372 LTPLHVAAHCGHHRVAKVLLDKG--AKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKVVTDETSVVLVSDKHRMSYPETV--DEILD 848          

HSP 4 Score: 174.096 bits (440), Expect = 3.257e-43
Identity = 115/451 (25.50%), Postives = 214/451 (47.45%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  L+  ++   +   TK  N A+H A ++  +E+V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI       +  K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R   +         P+ IAS   NV +VRLL+     I+    +   P+H A + G V + ++L+D+   I       + PIH+A++   ++ V++LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     + +LL+ +  SID   ++   P+H+A   G+L IVK L+  G++    +   + P+H A   G+ ++ K L+ N    + K     TPL      G+   V  L
Sbjct:   79 LNGLHLASKEGHVKMVVELLHKEI--ILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLL 522          

HSP 5 Score: 164.466 bits (415), Expect = 2.874e-40
Identity = 112/453 (24.72%), Postives = 210/453 (46.36%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGY-DDCVSFLSK 1841
            TALH A   G  ++VR LV+      +N  ++     ++ A      E+V+ L+      N   ++   PL  A   G++ +   LI     N   K       +H+A ++     A +L++ +   + ++K  F+P+  A +   + +A+LL+     +N + +    P+H AS  G   +  +L+DR   IE  T  +  P+  A+ N +V I  +L+ +   I+        PIH+A Q   ++ V+LL+  +  I+      + P+H+A+  G   + K+LL+ GA  N       TPL++A +K H  V ++L+  G +I+  +     P+H A   G   I + L+    S +  N   + P+H+A  +G+  + K L+ + +      + ++ P+H A   G+  ++K L+ N  + +    A  TPL      G+ D  ++ L K
Sbjct:  113 TALHIAALAGQDEVVRELVN--YGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI-----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEK 558          

HSP 6 Score: 137.887 bits (346), Expect = 4.681e-32
Identity = 101/443 (22.80%), Postives = 187/443 (42.21%), Query Frame = 3
Query:  705 ACTNGN--KAIAQLL--IDVPDCNVNCKNAEESQPIHLACQHGHF---------------------------------EIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLID----------------RQCDIECETILKR-------------RPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A  +GN  KA+  L   +D+  CN N  N      +HLA + GH                                  E+ + L+     +N+ +++ F+P+  A     +E+ K L+ N  + N +T     P+  A   G   V   LI+                R  D     +L +              P+ IA+   N+ + +LL+    ++         P+H+A ++G V +V+LL+D    I       + P+H A+ NG V I +ILL+HGA          +P+++A +  H D  ++L+     I+  ++    P+H A   G   +A++L+D     ++   N   P+H+AC   ++ +++LL+  G++++    S   P+H A   G+L ++K L+    + +  N    TPL +    G+ +   +L
Sbjct:   52 AARSGNLDKALDHLRNGVDINTCNQNGLNG-----LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL 489          

HSP 7 Score: 121.324 bits (303), Expect = 4.448e-27
Identity = 86/323 (26.63%), Postives = 151/323 (46.75%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREI 1865
            L A  SG ++ A   + N  DIN   +     +H AS  G  ++   L+ ++  +E  T      + IA+     E+VR L+    N+   + +   P+++A Q+  +EVV+ L++N  N N A +    P+ +A + G   +V  L+ +G          R P L++A        + VL+ N  N +  S   + P+H A       +AQLL++   S++    N   P+H+A   GN+ +V+LL+D G+ +E   +    P+H A  NG++ + + L+ +   I  K     +P+ +     + DCV  L   L  N EI
Sbjct:   50 LRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL---LQYNAEI 364          
BLAST of SMED30013027 vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 213.001 bits (541), Expect = 1.863e-54
Identity = 119/453 (26.27%), Postives = 219/453 (48.34%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L+++    N  N +  +P+  A  +G  E+AK L+ NK  +N   +  + P+H A+ +G T +  +L++   +    T     P+ IA+   +VE V  L+    +  C+  +   P+HVA + G V V +LL++   + N A    + P+H+A  +  ++IVK+LL  G   +       TPL++A ++   +V++ L+  G +   +S++   P+H A Q G  E+  LL+    + +  N +   P+HL    G++ +  +L+ HG  ++   R    P+H A   GN+ L+K L+ +   ++ K     +PL      G+ D V+ L K
Sbjct:  306 LSPIHMAAQGDHLDCVRLLL--QYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKT-GASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 755          

HSP 2 Score: 202.601 bits (514), Expect = 3.462e-51
Identity = 124/507 (24.46%), Postives = 229/507 (45.17%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIIN 2003
             T LH A   G+H + ++L+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  N +   P+H+A + GH E+AK L++   ++N+  K + +P+  A   G   + KLL+ N  + N +T     P+H A+  G  E    L++++    C T     P+ +A+    V +  LL+    +          P+HVA     +++V+LL+    + +        P+HIA++  +VE+ + LL++G   N       TPL+LA ++GH ++  +L+    N    +     P+H   Q G   +A +L+     +D        P+H+A   GN+ +VK L+ H +++    +    P+H A + G+ D++  L+ N  + +  +   +TPL + K  GY      L  V D    +    +H   + F E  D   +  +  D G  ++      R SR ++
Sbjct:  339 LTPLHVAAHCGHHRVAKVLLDKG--AKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHR--MSFPETVD--EILDVSEDEGEELISFKAERRDSRDVD 838          

HSP 3 Score: 197.208 bits (500), Expect = 1.435e-49
Identity = 121/459 (26.36%), Postives = 221/459 (48.15%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSKVLDAN 1856
            FT LH A    N ++ +LL++      +N   ++    +H A    +  +V +L+ +  +I  K  +E+ PLH A  NG+  I+++L+D     +  K      PIH+A Q  H +  +LL++ + E++ +     +P+  A + G   +AK+L+      N        P+H A       V  +L+     I+  T     P+ +AS   ++ IV+ L+    +    N + E P+H+A + G  EV + L+ N   +N        P+H A+  G   +VK+LLE+ A+ N   T   TPL++A  +GH +    L++   +  C + K + P+H A + G   +A+LL++     +    N   P+H+A    NL+IVKLL+  G +   P  +   P+H A +   +++ ++L+    + + ++    TPL L    G+ + V+  LSK  + N
Sbjct:  207 FTPLHIAAHYENLNVAQLLLNRG--ASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDH-GAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGN 662          

HSP 4 Score: 182.57 bits (462), Expect = 4.960e-45
Identity = 115/451 (25.50%), Postives = 216/451 (47.89%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  L+  ++   +   TK  N A+H A ++  +E+V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI       +  K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R   +         P+ IAS   NV +VRLL+     I+    +   P+H A + G V + ++L+D+   I       + PIH+A++   ++ V++LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     + +LL+ +  SID   ++   P+H+A   G+L IVK L+  G++    +   + P+H A   G+ ++ K L+ N   ++ K     TPL      G+ + V  L
Sbjct:   46 LNGLHLASKEGHVKMVVELLHKEI--ILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLL 489          

HSP 5 Score: 176.792 bits (447), Expect = 3.173e-43
Identity = 112/470 (23.83%), Postives = 217/470 (46.17%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID--------VPDCNVNCKNAEESQ--------------------PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFG 1811
            TALH A   G  ++VR LV+      +N  ++     ++ A      E+V+ L+      N   ++   PL  A   G++ +   LI+        +P  ++  +N +                       P+H+A  + +  +A+LL+ +   +N   +   +P+  A   G + + +LL+     I   T+ +  P+H A+  G   ++ +L+D    I+ +T     PI +A+  ++++ VRLL+     I  I  ++  P+HVA   G   V ++L+D     N        P+HIA +   V ++++LL+ GA  + +     TPL++A+  GH  + K L+  G +    ++K   P+H A + G  E+A+ L+ +   ++ +  + Q P+H A   G+ N+VKLL+++ +N      +   P+H A   G+++ + AL+    +  C      TPL +   +G
Sbjct:   80 TALHIAALAGQDEVVRELVN--YGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYG 547          

HSP 6 Score: 125.176 bits (313), Expect = 2.315e-27
Identity = 74/332 (22.29%), Postives = 164/332 (49.40%), Query Frame = 3
Query:  762 NVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            +V  + A+ +     A + G+ + A   +    ++N+ N+   + +  A   G +++   L+  +  +  +T+     +H A+  G  EV   L++   ++  ++     P+++A+  N++E+V+ L+ N  N     ++   P+ VA Q+G   VV  LI    N        +  +HIA+ N       +LL++  + + +     TPL++A    + +V+++L++ G ++         P+H A + G   + +LL+D    I+T+  ++  P+H A  +G++ I ++L+DHG+ ++   ++   PIH A +  +LD ++ L+  +  I
Sbjct:    4 SVGFREADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEI 331          

HSP 7 Score: 121.709 bits (304), Expect = 2.568e-26
Identity = 82/314 (26.11%), Postives = 147/314 (46.82%), Query Frame = 3
Query:  897 ILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             L A  SG ++ A   + N  DIN   +     +H AS  G  ++   L+ ++  +E  T      + IA+     E+VR L+    N+   + +   P+++A Q+  +EVV+ L++N  N N A +    P+ +A + G   +V  L+ +G          R P L++A        + VL+ N  N +  S   + P+H A       +AQLL++   S++    N   P+H+A   GN+ +V+LL+D G+ +E   +    P+H A  NG++ + + L+ +   I  K     +P+ +     + DCV  L
Sbjct:   16 FLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL 324          
BLAST of SMED30013027 vs. UniProt/SwissProt
Match: sp|Q4UMH6|Y381_RICFE (Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0381 PE=4 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 1.443e-50
Identity = 128/473 (27.06%), Postives = 223/473 (47.15%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI----DV-------------------PD---------CNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTF 1808
            T LHYA + GN  +V+ L+    Q  I+  T +    +H+A    + ++V +LI    ++N K D  +  LHYA  +GN  +  LLI    DV                   PD          +VN K       +H A + G+ ++  LLI     +N+      + + +A  SG + +   LI NK DI+  T + E  +HFA+  G   + + LI  + DI  +T      +  A+ + N+ +V  LI N  +I    +  E  +H A + G + +V  LI N  +I+   +     +H A+E+G + +V +L+ +G D N       T L+ A E G+ ++  +LI  G ++  ++      +H A   G  ++  LL+     ++ + D+    +H A  S NL +V LL+ +G+++   + S + P+HYA    +LDL+  L+HN   I+ KN++  T L+ +  F
Sbjct:  673 TVLHYAVKSGNLHLVKWLIEN--QANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVNNAK----TILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETVLNSIMEF 1139          

HSP 2 Score: 144.821 bits (364), Expect = 1.397e-33
Identity = 94/339 (27.73%), Postives = 165/339 (48.67%), Query Frame = 3
Query:  828 EIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNI-ECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
            E   LLI      N+ N      +  A  +G +++AKLL  N  D+N  T   E  +H+A   G   +   LI+ Q +I  +T      +  A S NN ++V LLI    ++    D     +H A   G +++V LLI +  ++N   +     ++ A + G  ++V +L+ +GAD N       T L+ A E G+ D+  +LI NG N+   ++I     +H A ++G   +   L+ +   I  + ++ +  +H A  SGNLN+V  L+ + +++     S +  +H+A ++GNL+L+  L+ N   IH K ++  T L      G  + V++L K
Sbjct:  619 ESVPLLITHGANPNATNCHGVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVNNAKTI-----LHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIK 952          

HSP 3 Score: 117.857 bits (294), Expect = 3.290e-25
Identity = 81/330 (24.55%), Postives = 151/330 (45.76%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSI 1475
            T LH+A + GN ++V  L+  K    I+  T S    +HFA  S +  +V  LI  K +I+ K +     LH+A  +GN  +   LI     +++ K       +H A + G+  +   LI+   ++++      + + +A  SG + +  LLI N  DIN  T      +H+A   G   +  +LI +  D+  +T      +  A    ++++V LL+    ++    D+    +H A +   + +V LL+    ++N  N+    P+H A     +++V +L+ +GAD N       T L    E  + ++ K  I  G +I  +++
Sbjct:  834 TILHFAAKSGNLNLVNWLIKNK--ADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIK-NKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETVLNSIMEFNNCNILKSFILGGADINLETM 1160          

HSP 4 Score: 80.8777 bits (198), Expect = 6.852e-14
Identity = 55/199 (27.64%), Postives = 93/199 (46.73%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETIL 1082
            T LH+A + GN ++V LL+       IN  T     A+H+A  S +  +V +LI K  ++N K +     LH+A   G+  +  LL+ V   +VN K  +    +H A +  +  +  LL+    ++N+ N    +P+ YA+    +++  LLI N  DIN    + E  ++         +    I    DI  ET+L
Sbjct:  966 TILHFAAESGNLNLVSLLIHNG--TDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLM-VRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETVLNSIMEFNNCNILKSFILGGADINLETML 1161          
BLAST of SMED30013027 vs. UniProt/SwissProt
Match: sp|Q02357|ANK1_MOUSE (Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 3.026e-49
Identity = 128/519 (24.66%), Postives = 234/519 (45.09%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI----------NDATKSAN-----------------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEI---------------------------------VKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSKVLDAN 1856
            FT L  A QQG+ ++V  L++   + K+          ND T++A                    +H A   E+  + ++L+ +   +N      + PLH A   GN  + +LL+D     +  +  +E  P+H A ++GH  I+++L++    + +  K   SPI  A     ++  +LL+    +I+  T     P+H A+  G   VA +L+D+        +    P+ IA   N++ ++ LL+    +I  + +    P+HVA   G + +V+ L+    + N +N K+  P+H+A+  G  E+                                 VK+LLE+GA  N   T   TPL+ A  +GH D +  L++   +  C + K + P+H A + G   +A+LL++     +    N   P+H+A    NL+IVKLL+  G +   P  +   P+H A +   +++ ++L+    + + ++    TPL L    G+ + V+  LSK  + N
Sbjct:  141 FTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDR-GAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGN 658          

HSP 2 Score: 194.897 bits (494), Expect = 8.835e-49
Identity = 115/453 (25.39%), Postives = 216/453 (47.68%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VRLL+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  + +LL+     +++        P+H+A   GH  I K L+++    N  N +  +P+  A  +G  E+AK L+ NK   N   +  + P+H A+ +G T +  +L++        T     P+  A+   +V+    L+    +  C+  +   P+HVA + G V + +LL+++  + N A    + P+H+A  +  ++IVK+LL  G   +       TPL++A ++   +V++ L+  G +   +S++   P+H A Q G  E+  LL+    + +  N +   P+HL    G++ +  +L+ HG  ++   R    P+H A   GN+ L+K L+ +   ++ K     +PL      G+ D V+ L K
Sbjct:  302 LSPIHMAAQGDHLDCVRLLL--QYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKT-GASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 751          

HSP 3 Score: 194.897 bits (494), Expect = 8.911e-49
Identity = 119/482 (24.69%), Postives = 223/482 (46.27%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIF----HRVRHDDIVKFNELYD 1916
             T LH A   G+H + ++L+      K N    +    +H AC      ++E+L+     I+   +  + PLH A   G+  I + L+     + N  N +   P+H+A + GH E+AK L++   + N+  K + +P+  A   G   + KLL+ N    N +T     P+H A+  G  + A  L++++    C T     P+ +A+    V +  LL+ +  +          P+HVA     +++V+LL+    + +        P+HIA++  ++E+ + LL++G   N       TPL+LA ++GH ++  +L+    N    +     P+H   Q G   +A +L+    ++D        P+H+A   GN+ +VK L+ H +++    +    P+H A + G+ D++  L+ N  + +  +   +TPL + K  GY      L  V D    +     HR+ + + V  +E+ D
Sbjct:  335 LTPLHVAAHCGHHRVAKVLLDKG--AKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKVVTDETSVVLVSDKHRMSYPETV--DEILD 811          

HSP 4 Score: 174.096 bits (440), Expect = 2.280e-42
Identity = 115/451 (25.50%), Postives = 214/451 (47.45%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  L+  ++   +   TK  N A+H A ++  +E+V  L+     +N ++ +   PL+ A    +  + + L++    N N    +   P+ +A Q GH  +   LI       +  K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R   +         P+ IAS   NV +VRLL+     I+    +   P+H A + G V + ++L+D+   I       + PIH+A++   ++ V++LL++ A+ + I     TPL++A   GH+ V+KVL+D G     +++  + P+H AC+     + +LL+ +  SID   ++   P+H+A   G+L IVK L+  G++    +   + P+H A   G+ ++ K L+ N    + K     TPL      G+   V  L
Sbjct:   42 LNGLHLASKEGHVKMVVELLHKEI--ILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN-GANQNVATEDGFTPLAVALQQGHENVVAHLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLL 485          

HSP 5 Score: 164.466 bits (415), Expect = 1.898e-39
Identity = 112/453 (24.72%), Postives = 210/453 (46.36%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGY-DDCVSFLSK 1841
            TALH A   G  ++VR LV+      +N  ++     ++ A      E+V+ L+      N   ++   PL  A   G++ +   LI     N   K       +H+A ++     A +L++ +   + ++K  F+P+  A +   + +A+LL+     +N + +    P+H AS  G   +  +L+DR   IE  T  +  P+  A+ N +V I  +L+ +   I+        PIH+A Q   ++ V+LL+  +  I+      + P+H+A+  G   + K+LL+ GA  N       TPL++A +K H  V ++L+  G +I+  +     P+H A   G   I + L+    S +  N   + P+H+A  +G+  + K L+ + +      + ++ P+H A   G+  ++K L+ N  + +    A  TPL      G+ D  ++ L K
Sbjct:   76 TALHIAALAGQDEVVRELVN--YGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLI-----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEK 521          

HSP 6 Score: 138.272 bits (347), Expect = 2.365e-31
Identity = 104/454 (22.91%), Postives = 190/454 (41.85%), Query Frame = 3
Query:  669 CKNDEEMFPLHYA-CTNGNKAIAQLL--IDVPDCNVNCKNAEESQPIHLACQHGHF---------------------------------EIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLID----------------RQCDIECETILKR-------------RPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            CK D     L  A   N +KA+  L   +D+  CN N  N      +HLA + GH                                  E+ + L+     +N+ +++ F+P+  A     +E+ K L+ N  + N +T     P+  A   G   V   LI+                R  D     +L +              P+ IA+   N+ + +LL+    ++         P+H+A ++G V +V+LL+D    I       + P+H A+ NG V I +ILL+HGA          +P+++A +  H D  ++L+     I+  ++    P+H A   G   +A++L+D     ++   N   P+H+AC   ++ +++LL+  G++++    S   P+H A   G+L ++K L+    + +  N    TPL +    G+ +   +L
Sbjct:    4 CKADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNG-----LHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYL 452          

HSP 7 Score: 121.324 bits (303), Expect = 3.109e-26
Identity = 86/323 (26.63%), Postives = 151/323 (46.75%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREI 1865
            L A  SG ++ A   + N  DIN   +     +H AS  G  ++   L+ ++  +E  T      + IA+     E+VR L+    N+   + +   P+++A Q+  +EVV+ L++N  N N A +    P+ +A + G   +V  L+ +G          R P L++A        + VL+ N  N +  S   + P+H A       +AQLL++   S++    N   P+H+A   GN+ +V+LL+D G+ +E   +    P+H A  NG++ + + L+ +   I  K     +P+ +     + DCV  L   L  N EI
Sbjct:   13 LRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKV-----RLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLL---LQYNAEI 327          
BLAST of SMED30013027 vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 1.084e-47
Identity = 117/454 (25.77%), Postives = 210/454 (46.26%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI---NDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A   GN ++  LL++          ND T      +H A    +  +V++L+ +  +I+ K  + + PLH    +G++ + ++L+D     +  K      P+H+A Q  H    +LL++ N  ++ +     + +  A + G  ++AK+L+  K   N        P+H A       V  +L+     I+  T     PI +A+   +V IV  L+ +  +    N   E  +H+A + G  EVV+ L+ +   +         P+HI++  G+ +IV+ LL+ GA  N   T   TPL+LA  +GH DV+  L+D+G ++   + K + P+H A + G  E+A LL+    S D    +   P+H+A    N  +  LL+D G++     ++   P+H A +   +D+  +L+      +         + L    G+ D VS L
Sbjct:  219 FTPLHIAAHYGNINVATLLLNRAAAVDFTARNDIT-----PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDR-SAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 666          

HSP 2 Score: 191.045 bits (484), Expect = 1.276e-47
Identity = 122/505 (24.16%), Postives = 234/505 (46.34%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL-------SKVLDANREIFH---RVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVA 1973
            ALH A ++G+ ++V  L+  + +  ++ ATK  N A+H A ++   E+V++L+     +N ++     PL+ A    +  + + L+D    + +    +   P+ +A Q GH ++  LL+E + +     K     +  A      + A LL+ N  + +  +++   P+H A+  G   VA +L++R   ++        P+ +AS   N  +V+LL+     I     +   P+H   + G  +VV++L+D    I       + P+H+A++   +  V++LL+H    + +     T L++A   GHY V+KVL+D   +   +++  + P+H AC+     + +LL+    SI    ++   PIH+A   G++NIV  L+ HG++    +   +  +H A  +G  ++++ LV +   +  K     TPL +    G  D V  L       +    +     H   R  H+D+  F  L D      +    G + L VA
Sbjct:   60 ALHLASKEGHVEVVSELL--QREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDN-GASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTK----GKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAF--LLDHGASLSITTKKGFTPLHVA 555          

HSP 3 Score: 182.956 bits (463), Expect = 3.726e-45
Identity = 108/454 (23.79%), Postives = 205/454 (45.15%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKV 1844
             TALH A   G++ + ++L+  K     N    +    +H AC      ++E+L+     I    +  + P+H A   G+  I   L+     + N  N      +H+A + G  E+ + L++   ++ +  K + +P+  +   G+ +I + L+      N +T +   P+H A+  G  +VA  L+D    +   T     P+ +A+    +E+  LL+    +          P+HVA      +V  LL+D   + + A      P+HIA++  +++I   LLE+GAD N +       ++LA ++GH D+  +L+    N+   +     P+H A Q     +A++LV+    +D +      P+H+ C  GN+ IV  L+ H + +    ++    +H A + G+  +I  L+ NN + +      +T L + +  GY   V  L  V
Sbjct:  351 LTALHVAAHCGHYKVAKVLLDKKASP--NAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHH-GASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 801          

HSP 4 Score: 179.489 bits (454), Expect = 4.432e-44
Identity = 106/451 (23.50%), Postives = 215/451 (47.67%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT L+ A Q+ + ++VR L+       +  AT+     +  A     +++V +L+    E + K    +  LH A    +   A LL+   D N + ++     P+H+A  +G+  +A LL+ +   ++   + + +P+  A   G   + KLL+     I+  TR    P+H  +  G  +V  ML+DR   I  +T     P+ +A+  +++  V+LL+ ++  +  + ++    +HVA   G  +V ++L+D   + N        P+HIA +  R+ ++++LL+HGA    +     TP+++A   GH ++   L+ +G +    +++    +H A ++G  E+ + LV     ++ +  + Q P+H++   G  +IV+ L+  G++      S   P+H A   G+ D+   L+ +  ++        TPL +   +G  +  S L
Sbjct:  124 FTPLYMAAQENHLEVVRFLLDNGASQSL--ATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQN-DTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLL 567          

HSP 5 Score: 145.206 bits (365), Expect = 1.621e-33
Identity = 87/313 (27.80%), Postives = 153/313 (48.88%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            L A  +G +E A   I N  D+N   +     +H AS  G  EV   L+ R+ +++  T      + IAS     E+V++L+TN  N+   +     P+++A Q+  +EVV+ L+DN  + + A +    P+ +A + G  ++V +LLE     N      R P L++A  K     + +L+ N  N + +S   + P+H A   G   +A LL++   ++D    N   P+H+A   GN N+VKLL+D G+ ++   R    P+H    +G+  +++ L+  +  I  K     +PL +     + +CV  L
Sbjct:   29 LRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLL 336          

HSP 6 Score: 144.821 bits (364), Expect = 2.277e-33
Identity = 100/426 (23.47%), Postives = 183/426 (42.96%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKC---------------------INDENEQ--------PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQN---------------------------------GFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +DV  CN N  NA     +HLA + GH E+   L+++   +++  K+  + +  A  +GQ E+ K+L+TN  ++N  ++    P++ A+     EV   L+D        T     P+ +A    + ++V LL+ N    K                       ND N          P+H+A   G + V  LL++    ++      + P+H+AS+ G   +VK+LL+ GA  +       TPL+     GH  V ++L+D    I  ++     P+H A Q                                  G  ++A++L+D   S + +  N   P+H+AC    + +++LL+ HG++++    S   PIH A   G+++++  L+H+  + +  N    T L +    G  + V +L
Sbjct:   48 VDVNICNQNGLNA-----LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYL 468          

HSP 7 Score: 133.265 bits (334), Expect = 6.676e-30
Identity = 85/359 (23.68%), Postives = 168/359 (46.80%), Query Frame = 3
Query:  807 ACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLID-----------------------------NHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNK--RPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            A + GH E A   I+   ++N  N+   + +  A   G +E+   L+  + +++ +T+     +H AS  G  EV  +L+    ++  ++     P+++A+  N++E+VR L+ N  +     ++   P+ VA Q+G  +VV LL++                             N  N +  +     P+HIA+  G + +  +LL   A  +       TPL++A+++G+ ++ K+L+D G  I+ ++     P+H   ++G  ++ ++L+D    I ++  N   P+H+A    +LN V+LL+ H  N+   D +N     +H A   G+  + K L+    + + K     TPL
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPL 387          

HSP 8 Score: 118.627 bits (296), Expect = 2.547e-25
Identity = 73/275 (26.55%), Postives = 128/275 (46.55%), Query Frame = 3
Query: 1143 ITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEI-----------------------------AQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVR 1880
            I N  ++   N      +H+A ++G VEVV  L+    N++ A  K    +HIAS  G+ E+VK+L+ +GA+ N       TPLY+A ++ H +V + L+DNG +    +   + P+  A Q G  ++                             A LL+ +  + D E+ +   P+H+A   GN+N+  LL++  + ++   R++  P+H A + GN +++K L+     I  K     TPL      G++  V  L   LD +  I  + +
Sbjct:   44 IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEML---LDRSAPILSKTK 315          
BLAST of SMED30013027 vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 190.66 bits (483), Expect = 2.593e-47
Identity = 125/522 (23.95%), Postives = 240/522 (45.98%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL-------SKVLDANREIFH---RVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQ 2018
              ALH A ++G+ ++V  L+  + +  ++ ATK  N A+H A ++   E+V++L+     +N ++     PL+ A    +  + + L+D    + +    +   P+ +A Q GH ++  LL+E     ++  K     +  A      + A LL+ N  + +  +++   P+H A+  G   VA +L++R   ++        P+ +AS   N  +V+LL+     I     +   P+H   + G  +VV++L+D    I       + P+H+A++   +  V++LL+H    + +     T L++A   GHY V+KVL+D   N   +++  + P+H AC+    ++ +LL+    SI    ++   PIH+A   G++NIV  L+ HG++    +   +  +H A  +G  ++++ LV +   +  K     TPL +    G  D V  L       +    +     H   R  H+D+  F  L D      +    G + L VA       + N +L +
Sbjct:   75 LNALHLASKEGHVEVVSELL--QREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLD-NGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAF--LLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQK 587          

HSP 2 Score: 184.496 bits (467), Expect = 1.854e-45
Identity = 116/454 (25.55%), Postives = 211/454 (46.48%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI---NDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A   GN ++  LL++          ND T      +H A    +  +V++L+ +  +I+ K  + + PLH    +G++ + ++L+D     +  K      P+H+A Q  H    +LL++ N  ++ +     + +  A + G  ++AK+L+  K + N        P+H A      +V  +L+     I+  T     PI +A+   +V IV  L+ +  +    N   E  +H+A + G  EVV+ L+ +   +         P+HI++  G+ +IV+ LL+ GA  N   T   TPL+L+  +GH DV+  L+D+G ++   + K + P+H A + G  E+A LL+    S D    +   P+H+A    N  +  LL+D G++     ++   P+H A +   +D+   L+      +         + L    G+ D VS L
Sbjct:  236 FTPLHIAAHYGNINVATLLLNRAAAVDFTARNDIT-----PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRA-APILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLL 683          

HSP 3 Score: 184.111 bits (466), Expect = 2.629e-45
Identity = 113/464 (24.35%), Postives = 213/464 (45.91%), Query Frame = 3
Query:  450 DVSNS*LLT*KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN--RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            DV+N  L     TALH A   G++ + ++L+  K     N   K+ N    +H AC     +++E+L+     I    +  + P+H A   G+  I   L+     + N  N      +H+A + G  E+ + L++   ++ +  K + +P+  +   G+ +I + L+      N +T +   P+H ++  G  +VA  L+D    +   T     P+ +A+    +E+  LL+    +          P+HVA      +V  LL+D   + + A      P+HIA++  +++I   LLE+GAD N +       ++LA ++GH D+  +L+    N+   +     P+H A Q     +A++LV+    +D +      P+H+ C  GN+ IV  L+ H + +    ++   P+H A + G+  +I  L+ NN + +      +T L + +  GY   V  L
Sbjct:  362 DVTNDYL-----TALHVAAHCGHYKVAKVLLDKKA----NPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMH-HGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTL 815          

HSP 4 Score: 144.05 bits (362), Expect = 4.184e-33
Identity = 93/332 (28.01%), Postives = 160/332 (48.19%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDI 1892
            L A  +G +E A   I N  DIN   +     +H AS  G  EV   L+ R+ +++  T      + IAS     E+V++L+TN  N+   +     P+++A Q+  +EVV+ L+DN  + + A +    P+ +A + G  ++V +LLE+  DT       R P L++A  K     + +L+ N  N + +S   + P+H A   G   +A LL++   ++D    N   P+H+A   GN N+VKLL+D G+ ++   R    P+H    +G+  +++ L+     I  K     +PL +     + +CV  L +         H V  DD+
Sbjct:   46 LRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN--DTK---GKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ---------HNVPVDDV 363          

HSP 5 Score: 143.665 bits (361), Expect = 6.721e-33
Identity = 94/393 (23.92%), Postives = 175/393 (44.53%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKC---------------------INDENEQ--------PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +D+  CN N  NA     +HLA + GH E+   L+++   +++  K+  + +  A  +GQ E+ K+L+TN  ++N  ++    P++ A+     EV   L+D        T     P+ +A    + ++V LL+ N    K                       ND N          P+H+A   G + V  LL++    ++      + P+H+AS+ G   +VK+LL+ GA  +       TPL+     GH  V ++L+D    I  ++     P+H A Q       QLL+  +  +D   ++    +H+A   G+  + K+L+D  +N      +   P+H AC+   + +++ L+ +  +I     +  TP+ +    G+ + VS L
Sbjct:   65 VDINICNQNGLNA-----LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQL 452          

HSP 6 Score: 132.88 bits (333), Expect = 1.313e-29
Identity = 84/361 (23.27%), Postives = 168/361 (46.54%), Query Frame = 3
Query:  807 ACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHC-----------------------------NINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNK--RPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDL 1796
            A + GH E A   I+   ++N  N+   + +  A   G +E+   L+  + +++ +T+     +H AS  G  EV  +L+    ++  ++     P+++A+  N++E+V+ L+ N  +     ++   P+ VA Q+G  +VV LL++N                               N +  +     P+HIA+  G + +  +LL   A  +       TPL++A+++G+ ++ K+L+D G  I+ ++     P+H   ++G  ++ ++L+D    I ++  N   P+H+A    +LN V+LL+ H  N+   D +N     +H A   G+  + K L+      + K     TPL +
Sbjct:   48 AARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH--NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHI 406          
BLAST of SMED30013027 vs. TrEMBL
Match: Q16FI9 (AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014742 PE=4 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 4.115e-83
Identity = 149/463 (32.18%), Postives = 268/463 (57.88%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATK-SANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNV------NCKNAEESQ-----PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +T LH A Q G+ ++V+ L+  +      D T+      +H A  +   E+V++LI  K  ++   ++ + PLH+A  NG+  + +LLID    NV      N  N + +Q     P+H A Q+GH E+ KLLIE    + +   + ++P+ +A  +G +E+ KLLI N+ +++ +      P++ AS  G  EV  +LI+ + +++        P+++AS N ++E+V+LLI N  N+    +E   P+HVA Q G +EVV+LLIDN  N++   +K + P+++AS+NG +E+VK+L+++ A+ +       TPL++A++ GH +V K+LI+N  N++    K   P+H A QNG  E+ +LL+D+  ++DT  +    P+H+A  +G+L +VKLL+++ +N++        P+H+A +NG+L+++K L+ N   +    +   TPL +    G+ + V  L
Sbjct:  284 WTPLHVASQNGHLEVVKFLIDNRANV---DTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLID-NRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLL 742          

HSP 2 Score: 295.819 bits (756), Expect = 1.095e-81
Identity = 147/463 (31.75%), Postives = 264/463 (57.02%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN-RAIHFACMSESEEIVEILIGKKCEI-----------NCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +T LH A Q G+ ++V+LL+  K      D T++     +HFA  +   E+V++LI  +  +           +   ++ + PLH+A  NG+  + +LLI+    NV     E   P+H A ++GH E+ KLLIE    +++   + ++P+  A  +G +E+ KLLI N+ +++ +      P++ AS  G  EV  +LID + +++        P+ +AS N ++E+V+LLI N  N+    ++   P++VA + G +EVV+LLIDN  N++  +++   P+H+AS+NG +E+VK+L+E+ A+ +       TPL+ A++ GH +V K+LIDN  N++    + W P+H A QNG  E+ +LL+++  ++DT  +    P+H A  +G+L +VKLL+D+ +N++        P+H A +NG+L+++K L+ N   +    +   TPL +    G+ + V  L
Sbjct:  317 WTPLHVASQNGHLEVVKLLIDNKANV---DTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIE-NRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLL 775          

HSP 3 Score: 293.123 bits (749), Expect = 9.970e-81
Identity = 146/437 (33.41%), Postives = 243/437 (55.61%), Query Frame = 3
Query:  558 CKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSN---LECPDRSNK--------RPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
              I+ A       +H A  +   ++V++LI     ++ + DE   PLH A  NG   + +LLID    NV+    E   P+HLA ++GH E+ KLLI+    +++     ++P+  A  +G +E+ KLLI N+ +++        P+HFAS  G  EV   LID + +++        P+ +AS N ++E+V+LLI N  N+    +E   P+H A Q G +EVV+ LIDN  N++   D+   P+H+A+ENG +E+VK+L+E+ A+ +       TPL++A++ GH +V K LIDN  N++    + W P+H A QNG  E+ +LL+D+  ++DT  +    P+H A  +G+L +VKLL+D+ +N   L   +R+N          P+H+A +NG+L+++K L+ N   +    +   TPL      G+ + V  L
Sbjct:   10 ANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLID-NGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLL 445          

HSP 4 Score: 290.041 bits (741), Expect = 1.006e-79
Identity = 143/434 (32.95%), Postives = 257/434 (59.22%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGK-------VQCKIN-DATKSAN-RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
             T LH+A Q G+ ++V+LL+  +       ++ + N D T++     +HFA  +   E+V++LI  +  +    +E   PLH+A  NG+  + +LLI+    NV+    E   P+++A  +GH E+ KLLI     +++   + ++P+  A  +G +E+ KLLI NK +++ +      P+H AS  G  EV  +LID + +++        P+++AS N ++E+V+LLI N  N+   ++E   P+HVA Q G +EVV+LLI+N  N++   +K + P+H AS+NG +E+VK+L+++ A+ +       TPL++A++ GH +V K+LI+N  N++    K   P+H A QNG  E+ +LL+D+  ++DT  +    P+H+A  +G+L +VKLL+D+ +N++        P++ A  NG+L+++K L+ N   +
Sbjct:  350 ITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIE-NRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANV 782          

HSP 5 Score: 290.041 bits (741), Expect = 1.187e-79
Identity = 143/463 (30.89%), Postives = 261/463 (56.37%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRA-IHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVE-----------IVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +T LH A + G+ ++V+LL+  +      D  K+     +H A  +   E+V++LI  +  ++ K +E   PLH+A  NG+  + + LID    NV+    E   P+H+A Q+GH E+ KLLIE    +++   + ++P+ +A  +G +E+ K LI N+ +++ +      P+H A+  G  EV  +LI+ + +++ +      P+ +AS N ++E+V+ LI N  N+     E   P+HVA Q G +EVV+LLIDN  N++   +K + P+H AS+NG +E           +VK+L+E+ A+ +       TPL+ A++ GH +V K+LI+N  N+     + W P+H A +NG  E+ +LL+++  ++DT  +    P+++A  +G+L +VKLL+++ +N++        P++ A +NG+L+++K L+ N   +    +   TPL +    G+ + V  L
Sbjct:   86 WTPLHLAAENGHLEVVKLLIDNRANV---DTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLID-NRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLL 544          

HSP 6 Score: 289.656 bits (740), Expect = 1.374e-79
Identity = 147/463 (31.75%), Postives = 258/463 (55.72%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRA-IHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENE-----------QPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +T LH+A Q G+ ++V+ L+  +      D T+      +H A  +   E+V++LI  +  ++ K +E   PLH+A  NG+  + + LID    NV+    E   P+HLA ++GH E+ KLLIE    +++     ++P+  A  +G +E+ K LI N+ +++ +      P+H AS  G  EV  +LID + +++        P+  AS N ++E+V+LLI N  N+  +  EN             P+H A Q G +EVV+LLI+N  N+    ++   P+H AS NG +E+VK+L+E+ A+ +       TPLY+A+  GH +V K+LI+N  N++    + W P++ A +NG  E+ +LL+D+  ++DT  +    P+H+A  +G+L +VKLL+D+ +N++        P++ A +NG+L+++K L+ N   +   ++   TPL +    G+ + V  L
Sbjct:  152 WTPLHFASQNGHLEVVKFLIDNRANV---DTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLID-NRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLL 610          

HSP 7 Score: 275.404 bits (703), Expect = 1.433e-74
Identity = 129/376 (34.31%), Postives = 222/376 (59.04%), Query Frame = 3
Query:  630 IVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            +V+ LI     I+  N+    PLH A  NG+  + +LLID    NV+ +  E   P+HLA ++G+ E+ KLLI+    +++   + ++P+  A  +G +E+ KLLI N+ +++        P+H AS  G  EV  +LI+ + +++ +      P+  AS N ++E+V+ LI N  N+    DE   P+HVA Q G +EVV+LLI+N  N++   ++   P+H AS+NG +E+VK L+++ A+ +       TPL+LA E GH +V K+LI+N  N++ +    W P+H A QNG  E+ + L+D+  ++DT       P+H+A  +G+L +VKLL+D+ +N++        P+H+A +NG+L+++K L+ N   +
Sbjct:    1 MVKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLID-NGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANV 375          

HSP 8 Score: 268.855 bits (686), Expect = 2.352e-72
Identity = 128/394 (32.49%), Postives = 233/394 (59.14%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLEC 1664
             T LH+A Q G+ ++V+LL+  +    +          +HFA  +   E+V++LI  +  ++   +E   PL+ A  NG+  + +LLI+    NV+    E   P+++A ++GH E+ KLLI+    +++   + ++P+  A  +G +E+ KLLI N+ +++ +      P++ AS  G  EV  +LID + +++        P+ +AS N ++E+V+LLI N  N+    ++   P+H A Q G +EVV+LLIDN  N++   ++   P+H+AS+NG +E+VK+L+E+ A+ +       TPL+ A++ GH +V K+LIDN  N++    + W P+H A QNG  E+ +LL+D+  ++DT  +    P+++A  +G+L +VKLL+D+ +N++ 
Sbjct:  394 ITPLHFASQNGHLEVVKLLIENR--ANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLIN-NRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANVDT 784          

HSP 9 Score: 261.536 bits (667), Expect = 9.026e-70
Identity = 120/369 (32.52%), Postives = 216/369 (58.54%), Query Frame = 3
Query:  729 IAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            + + LID  + N++  N     P+H+A Q+GH ++ KLLI+    +++   + ++P+  A  +G +E+ KLLI N  +++ +      P+H A+  G  EV  +LID + +++ +      P+ +AS N ++E+V+LLI N  N+    +E   P+H A Q G +EVV+ LIDN  N++   D+   P+H+AS+NG +E+VK+L+E+ A+ +       TPL+ A++ GH +V K LIDN  N++    + W P+H A +NG  E+ +LL+++  ++DT+ +    P+H+A  +G+L +VK L+D+ +N++        P+H A +NG+L+++K L+ N   +    +   TPL      G+ + V  L
Sbjct:    1 MVKFLID-HNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLL 368          

HSP 10 Score: 165.622 bits (418), Expect = 4.638e-38
Identity = 85/267 (31.84%), Postives = 151/267 (56.55%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN-RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDK 1280
            +T LH A Q G+ ++V+LL+  +      D TK+     ++ A  +   E+V++LI  K  ++  ++E   PLH A  NG+  + +LLI+    NV+    +   P+H A Q+GH E+ KLLI+    +++   + ++P+  A  +G +E+ KLLI N+ +++ +      P+HFAS  G  EV  +LID + +++        P+ +AS N ++E+V+LLI N  N+    ++   P++VA   G +EVV+LLIDN  N++   ++
Sbjct:  526 WTPLHVASQNGHLEVVKLLIDNRANV---DTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIE-NRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANVDTTQNE 788          
BLAST of SMED30013027 vs. TrEMBL
Match: Q16FR1 (AAEL014668-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014668 PE=4 SV=1)

HSP 1 Score: 293.123 bits (749), Expect = 4.171e-80
Identity = 149/469 (31.77%), Postives = 254/469 (54.16%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID-------------VP------DCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            T LHYA + GN ++V+LL+  +    ++ A       +H+A  +   ++V++LI  +  ++   +E   PLHYA  NGN  + +LLID              P      + NV+    E   P+H A ++G+ E+ KLLIE    +++   + ++P+ Y+  +G +++ KLLI NK +++ +      P+H+A   G  EV   LID   +++           I S N  + +V+LLI N  N+   ++E   P+H A Q G +EVV+ LIDN  N +  N +     HIAS+NGR+E+VK+L+++GA+ +       TPL+ A+  GH +V K+LIDNG N++ ++ +     H   QNG  E+ +LL+D+  ++DT ++    P+H A  +G+L +VKLL+D+G+N++  +       H A +NG L+++K L+ N   +   N+   TPL      G+ + V  L
Sbjct:  331 TPLHYASRNGNLELVKLLIDNR--ANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLL 797          

HSP 2 Score: 286.574 bits (732), Expect = 7.856e-78
Identity = 146/435 (33.56%), Postives = 246/435 (56.55%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            T LH A  +GN ++V+LL+         D        +H+A  + + E+V++LI  +  ++   +E   PLHYA  NG+  + +LLID    NV+    E   P+H A ++GH ++ KLLI+    +++   + ++P+ YA  +G +E+ KLLI N+ +++ +      P+H+AS  G  +V  +LID + +++        P+  AS N N+E+V+LLI N  N+     E   P+H A Q G ++VV+LLIDN  N++   ++   P+H AS NG +E+VK+L+++ A+ +       TPL+ A+  G  DV K+LIDN  N++    +   P+H A +NG  E+ +LL+D+  ++DT       P+H A  +G L++VKLL+D+ +N++        P+HYA  NGNL+L+K L+ N   +    +   TPL
Sbjct:    1 TPLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCT--PLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLID-NRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPL 432          

HSP 3 Score: 281.182 bits (718), Expect = 4.641e-76
Identity = 148/471 (31.42%), Postives = 261/471 (55.41%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRA-IHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLE-------CPDRSNKR-------------PIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            T LHYA + GN ++V+LL+  +      D T++     +H+A  +   ++V++LI  +  ++   +E   PLH A  NG+  + +LLID    NV+   +E   P+H A ++G+ E+ KLLI+    +++   + ++P+ YA  +GQ+++ KLLI N+ +++ +      P+H+AS  G  E+  +LID + +++        P+  AS N  +++V+LLI N  N+    +E   P+H A + G +E+V+LLIDN  N++ A  +   P+H AS NG++++VK+L+++ A+ +       TPL+ A+  G+ ++ K+LIDN  N++    + W P+H A QNG  ++ +LL+D+  ++DT  +    P+H A  +GNL +VKLL+D+ +N++        P     R             P+HYA  NGNL+L+K L+ N   +    +   TPL      G+   V  L
Sbjct:   34 TPLHYASRNGNLEMVKLLIDNRANV---DTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLID-NKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLL 500          

HSP 4 Score: 281.182 bits (718), Expect = 5.308e-76
Identity = 142/442 (32.13%), Postives = 247/442 (55.88%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCK---------INDATKSAN---------RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            T LHYA + GN ++V+LL+  +             ++ A+++AN           +H+A  + + E+V++LI  +  ++   +E   PLHY+  NG+  + +LLI+    NV+    E   P+H A Q+GH E+ K LI+    +++MN +  +       +G++ + KLLI N+ +++ +      P+H+AS  G  EV   LID   + + +         IAS N  +E+V+LLI N  N+   N+E   P+H A + G +EVV+LLIDN  N++  N +     HI S+NGR+E+VK+L+++ A+ +       TPL+ A+  GH +V K+LIDNG N++ ++ +     H A +NG  E+ +LL+D+  ++DT N+    P+H A  +G+L +VKLL+D+G+N++  +       H   +NG L+++K L+ N   +
Sbjct:  397 TPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIE-NKANVDTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANV 837          

HSP 5 Score: 279.641 bits (714), Expect = 1.847e-75
Identity = 139/413 (33.66%), Postives = 237/413 (57.38%), Query Frame = 3
Query:  597 IHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +H A    + E+V++LI     I+ K+DE   PLHYA  NGN  + +LLID    NV+    E   P+H A Q+GH ++ KLLI+    +++   +  +P+  A  +G +++ KLLI NK +++ +      P+H+AS  G  E+  +LID + +++        P+  AS N  +++V+LLI N  N+    +E   P+H A Q G +E+V+LLIDN  N++ A  +   P+H AS+NG++++VK+L+++ A+ +       TPL+ A+  G+ ++ K+LIDN  N++    + W P+H A +NG  ++ +LL+D+  ++DT  +    P+H A  +GNL +VKLL+D+ +N++        P+HYA +NG LD++K L+ N   +    +   TPL      G  + V  L
Sbjct:    3 LHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLID-NRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLL 414          

HSP 6 Score: 277.715 bits (709), Expect = 7.337e-75
Identity = 151/472 (31.99%), Postives = 256/472 (54.24%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN-RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN----------------DNKQK----PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +T LHYA Q G+ D+V+LL+  +      D T++     +H A  +   ++V++LI  K  ++    E   PLHYA  NGN  + +LLID    NV+    E   P+H A ++G  ++ KLLI+    +++   +  +P+ YA  +G +E+ KLLI N+ +++ +      P+H+AS  G  +V  +LID + +++        P+  AS N N+E+V+LLI N  N+     E   P+H A + G ++VV+LLIDN  N++   ++   P+H AS NG +E+VK+L+++ A+ +       TPL+ A++ G  DV K+LIDN  N++    +   P+H A +NG  E+ +LL+D+  ++DT                  D  Q     P+H A  +GNL +VKLL+++ +N++        P+HY+ +NG+L ++K L+ N   +    +   TPL      G+ + V FL
Sbjct:   66 WTPLHYASQNGHIDVVKLLIDNRANV---DTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLID-NRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNANVDTTQNEGCTPLHYASRNGNLELVKLLIENRANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFL 533          

HSP 7 Score: 270.781 bits (691), Expect = 1.807e-72
Identity = 133/415 (32.05%), Postives = 232/415 (55.90%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIK 1730
            T LHYA + GN ++V+LL+  +    ++ A       +H++  +   ++V++LI  K  ++   +E   PLHYA  NG+  + + LID    NV+  N   S   H+  Q+G   + KLLI+    +++ + + ++P+ YA  +G +E+ K LI N  + +          H AS  G  EV  +LID   +++        P+  AS N ++E+V+LLI N  N+   N       H+  Q G +EVV+LLIDN  N++  +++   P+H AS NG +E+VK+L+++GA+ +   T   T  ++A++ G  +V K+LIDNG N++  + + W P+H A +NG  E+ +LL+D+  ++DT+N       H+   +G L +VKLL+D+G+N++         +H A  NG+L+++K
Sbjct:  450 TPLHYASRNGNLELVKLLIENR--ANVDTAQNEGWTPLHYSSQNGHLKVVKLLIENKANVDTTQNEGWTPLHYAFQNGHLEVVKFLID-NGANVDTMNTRGSTSFHIVSQNGRLVLVKLLIDNRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWTLLHDASLNGHLEVVK 861          

HSP 8 Score: 249.21 bits (635), Expect = 4.517e-65
Identity = 128/388 (32.99%), Postives = 214/388 (55.15%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRA-IHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVD 1643
            +T LHY+ Q G+  +V+LL+  K      D T++     +H+A  +   E+V+ LI     ++  N       H    NG   + +LLID    NV+  + E   P+H A Q+GH E+ K LI+     ++ N +  +    A  +G++E+ KLLI N  +++ +      P+H+AS  G  EV  +LID   +++ +         I S N  +E+V+LLI N  N+   ++E   P+H A + G +EVV+LLIDN  N++  N +     HIAS+NGR+E+VK+L+++GA+ +       TPL+ A+  GH +V K+LIDNG N++ ++ +     H   QNG  E+ +LL+D+  ++DT  + +   +H A  +G+L +VKL +D
Sbjct:  482 WTPLHYSSQNGHLKVVKLLIENKANV---DTTQNEGWTPLHYAFQNGHLEVVKFLIDNGANVDTMNTRGSTSFHIVSQNGRLVLVKLLID-NRANVDTTDNEGWTPLHYASQNGHLEVVKFLIDNGANFDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNRANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNTRGSTSFHIASKNGRLEVVKLLIDNGANVDTTNNEGWTPLHYASRNGHLEVVKLLIDNGANVDTKNARGSTSFHIVSQNGRLEVVKLLIDNGANVDTTYNERWTLLHDASLNGHLEVVKLSID 865          

HSP 9 Score: 238.424 bits (607), Expect = 2.029e-61
Identity = 114/347 (32.85%), Postives = 202/347 (58.21%), Query Frame = 3
Query:  795 PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            P+H A   G+ E+ KLLI+ N  +++ + +  +P+ YA  +G +E+ KLLI N+ +++ +      P+H+AS  G  +V  +LID + +++        P+  A+ N ++++V+LLI N  N+     E   P+H A + G +E+V+LLIDN  N++ A  +   P+H AS NG++++VK+L+++ A+ +       TPL+ A++ G+ ++ K+LIDN  N++    + W P+H A QNG  ++ +LL+D+  ++DT  +    P+H A  +GNL +VKLL+D+ +N++        P+HYA  NG LD++K L+ N   +    +   TPL      G  + V  L
Sbjct:    2 PLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLL 348          

HSP 10 Score: 213.386 bits (542), Expect = 2.868e-53
Identity = 109/315 (34.60%), Postives = 176/315 (55.87%), Query Frame = 3
Query:  891 SPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +P+  A   G IE+ KLLI +  +I+        P+H+AS  G  E+  +LID + +++        P+  AS N ++++V+LLI N  N+    +E   P+H A + G ++VV+LLIDN  N++ A  +   P+H AS NG +E+VK+L+++ A+ +       TPL+ A+  G  DV K+LIDN  N++    +   P+H A QNG  E+ +LL+D+  ++DT       P+H A  +G L++VKLL+D+ +N++        P+HYA  NGNL+L+K L+ N   +    +   TPL      G  D V  L
Sbjct:    1 TPLHTAAGKGNIEMVKLLIDHNANIDTKDDEGCTPLHYASRNGNLEMVKLLIDNRANVDTTQNEGWTPLHYASQNGHIDVVKLLIDNRANVDTTQNEGCTPLHKAAENGHLDVVKLLIDNKANVDTAQSEGWTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASQNGNLELVKLLIDNRANVDTAQYEGWTPLHYASQNGQLDVVKLLIDNRANVDTTQNEGCTPLHYASRNGNLELVKLLIDNRANVDTAQYEGWTPLHYASRNGQLDVVKLL 315          
BLAST of SMED30013027 vs. TrEMBL
Match: A0A182GGY8 (ANK_REP_REGION domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG009719 PE=4 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 4.549e-74
Identity = 149/451 (33.04%), Postives = 251/451 (55.65%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +T LH ACQ G+ ++V +L+  K    I+  T+     +H AC    +E V+ILIG+K  I+  ++ +  PLH AC NG+  + ++L+     N++    ++  P+HLACQ+GH E+ ++LI +   ++++ +++ +P+  A  +G  E+ ++LI  K +I    +    P+HFA   G  EV  +LI  + +IE        P+ ++  + + E+V +LI    NI+ +N +N  P+H+ACQ G  EVV++LI    NI   N     P+HIAS NG  ++V+IL+   A+   +     TPL+LA   GH +V ++LI    NIE  +   W P+H ACQNG  E+ ++LV    +ID   + K  P+HLAC +G+  +V++L+   +N++        P+H AC+NG+ ++++ LV     I   N  + TPL L    G+ + V  L
Sbjct: 1268 WTPLHLACQNGHKEVVEILI--KENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVK-EKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKIL 1715          

HSP 2 Score: 279.256 bits (713), Expect = 8.452e-73
Identity = 147/448 (32.81%), Postives = 247/448 (55.13%), Query Frame = 3
Query:  480 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDC 1823
            KFT LH ACQ G+ ++V +LV  K +  I+   +     +H AC +  +E+VEILIG+K  I+   +++  PLH AC NG+K + ++LI     N+   N     P+H AC +GH E+ ++LI +   + ++N+  ++P+  +   G  E+ ++LI  K +I    +    P+H A   G  EV  +LI  + +IE        P+ IAS N + ++V +LI    NI+ +  EN  P+H+AC+ G  EVV++LI    NI         P+H A +NG  E+V+IL++  A+ + +     TPL+LA + GH +V ++LI    NI+  + KK  P+H ACQNG  E+ ++LV    +I+  N +   P+HLAC  G+  +VK+L+   +N++   +    P+H AC+ G+ ++++  +  N  I   +    TPL+L    G+ + 
Sbjct: 1333 KFTPLHKACQNGHAEVVEILV--KEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIR-GKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEV 1777          

HSP 3 Score: 273.863 bits (699), Expect = 3.923e-71
Identity = 147/455 (32.31%), Postives = 252/455 (55.38%), Query Frame = 3
Query:  480 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSK 1841
            K+T LH AC +G+ + V++L+  K      D  K     +H AC +   E+VEIL+ +K  I+   +++  PLH AC NG+K + ++LI     N++    ++S P+HLACQ+GH E+ ++LI     + ++N+  ++P+ +A ++G  E+ ++LI  K +I    +    P+H +   G  EV  +LI  + +IE        P+ +A  + + E+V +LI    NI+ +N  N  P+H+A   G  +VV++LI    NI     +   P+H+A  NG  E+V+IL+   A+   +     TPL+ A + GH +V ++L+    NI+  + KK+ P+H ACQNG  E+ ++L+    +ID   + K  P+HLAC +G+  +V++LV   +N+E  ++ N  P+H ACE G+ +++K L+     I       +TPL L    G+ + V  FL K
Sbjct: 1300 KYTPLHLACARGHKEAVQILIGEKANIDALDENKFT--PLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIG-EKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRK 1751          

HSP 4 Score: 267.314 bits (682), Expect = 5.488e-69
Identity = 148/470 (31.49%), Postives = 247/470 (52.55%), Query Frame = 3
Query:  432 PSLAGVDVSNS*LLT*KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
            PS+AG            +TALH +   G+  IV LL+       +N A  +    +H+AC+S  +E+VEILIG K  I+     +  PLH+AC NG K + ++LI     N+   N     P+HLACQ+GH E+ ++LI++N  ++++ + +++P+  A   G  E  ++LI  K +I+     +  P+H A   G  EV  +L+  + +I+     K  P+ +A  N + E+V +LI    NI  + ++   P+H+ACQ G  EVV++LI    NI   N     P+H A  NG  E+V+IL+    +   +     TPL+L+   GH +V ++LI    NIE  +   W P+H ACQ+G  E+ ++L+    +I+  N     P+H+A  +G+  +V++L+   +N+E   + N  P+H AC NG+ ++++ L+     I      + TPL      G+ + V  L K
Sbjct: 1164 PSVAG------------YTALHISASSGHRPIVELLLDNG--ANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIR-EKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVK 1618          

HSP 5 Score: 266.544 bits (680), Expect = 7.607e-69
Identity = 136/419 (32.46%), Postives = 232/419 (55.37%), Query Frame = 3
Query:  480 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKAL 1736
            KFT LH ACQ G+ ++V +L+  K    I+  T+  +  +H AC +  +E+VEILI  K  I   N     PLH+AC NG+K + ++LI     N+   N +   P+HL+C+HGH E+ ++LI +   + ++N+  ++P+  A   G  E+ ++LI  + +I    +    P+H AS  G  +V  +LI  + +IE        P+ +A  N + E+V +LI    NI+ +  +N  P+H ACQ G  EVV++L+    NI+   +K   P+H+A +NG  E+V+IL+   A+ + +     TPL+LA + GH +V ++L+    NIE  +   W P+H AC+ G  E+ ++L+    +ID     K  P+HLAC  G+  +V++ +   +N+   D     P++ A +NG+ ++ K +
Sbjct: 1366 KFTPLHLACQNGHKEVVEILIGEK--ANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIR-EKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIRGKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIM 1781          

HSP 6 Score: 243.047 bits (619), Expect = 2.092e-61
Identity = 132/449 (29.40%), Postives = 236/449 (52.56%), Query Frame = 3
Query:  492 LHYACQQGN-HDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +H A   G   ++ RL+ +G     +N  + +   A+H +  S    IVE+L+     +N  +  E  PLH+AC +G K + ++LI     N++     +S P+H ACQ+G  E+ ++LI +   + ++N+  ++P+  A  +G  E+ ++LI    +I+  T  +  P+H A   G  E   +LI  + +I+     K  P+  A  N + E+V +L+    NI  + ++   P+H+ACQ G  EVV++LI    NI+   +K   P+H+A +NG  E+V+IL+   A+   +     TPL+ A   GH +V ++LI    NIE  +   W P+H +C++G  E+ ++L+    +I+  N +   P+HLAC  G+  +V++L+   +N+E  ++ N  P+H A  NG+  +++ L+     I      + TPL L    G+ + V  L
Sbjct: 1139 MHIAAGDGIIEEVKRLINNG---ANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIG-GKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEILIREKVNIEALNQDNWTPLHLSCRHGHKEVVEILIREKVNIEALNQDNWTPLHLACQDGHKEVVEILIREEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEIL 1583          

HSP 7 Score: 221.476 bits (563), Expect = 1.363e-54
Identity = 141/483 (29.19%), Postives = 234/483 (48.45%), Query Frame = 3
Query:  492 LHYACQQGNHDIVRLLVSGKVQCKINDATK--SANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCE----------------------MNSMNKQEF----------SPILY-ALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            L  A + G+  I   L++    CK++   K      A+ +A +   + +V IL+ K  +IN +N E    LHYA  +   AI++ LID    NVN +  E   P++LA   GH E+  LLIEK  E                      +  M K++F           P+++ A   G IE  K LI N  ++N  +      +H +++ G   +  +L+D   ++      +  P+  A  +   E+V +LI    NI  +      P+H ACQ G  EVV++LI    NI   N     P+H+A +NG  E+V+IL++  A+ + +  +  TPL+LA  +GH +  ++LI    NI+     K+ P+H ACQNG  E+ ++LV    +ID   + K  P+HLAC +G+  +V++L+   +N++        P+H AC+NG+ ++++ L+     I   N  + TPL      G+ + V  L
Sbjct:  973 LKIAIENGSDKICAYLIN---DCKVHPDVKFDGGLAALIWAVIYGHKNLVRILLEKGADINIRNTEGWSALHYAVHHKRIAISKFLID-KGINVNYQTREGKTPLNLAAARGHTEVVILLIEKLIEQFPSRNIIDSAFQTAVQYGHSSVQDMLKRKFPEHAFTKDIDGPLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILIRGKANIEALNQVNWTPLHFACHNGHKEVVEIL 1451          

HSP 8 Score: 173.326 bits (438), Expect = 1.207e-39
Identity = 89/288 (30.90%), Postives = 161/288 (55.90%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLE 1346
            +T LH ACQ G+ ++V +L+  + +  I    +     +H A  +  E++VEILI +K  I     E   PLH AC NG+K + ++LI     N+     +   P+H ACQ+GH E+ ++L+++   ++++ +++F+P+  A  +G  E+ ++LI  K +I+  T  +  P+H A   G  EV  +L+  + +IE        P+ +A    + E+V++LI    NI  +  +   P+H+ACQ+G  EVV++ +  + NI   +D+   P+++AS+NG  E+ KI+ E
Sbjct: 1499 WTPLHLACQDGHKEVVEILI--REEANIEALNQYNYTPLHIASWNGHEKVVEILIREKANIEALGQENWTPLHLACRNGHKEVVEILIR-GKANIEALTQDNWTPLHKACQNGHAEVVEILVKEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVGEKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIMKE 1783          

HSP 9 Score: 160.999 bits (406), Expect = 7.504e-36
Identity = 107/384 (27.86%), Postives = 189/384 (49.22%), Query Frame = 3
Query:  696 LHYACTNGNKAIAQLLIDVPDCNV--NCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
            L  A  NG+  I   LI+  DC V  + K       +  A  +GH  + ++L+EK  ++N  N + +S + YA++  +I I+K LI    ++N  TR  + P++ A+  G TEV  +LI++  +      +       A    +  +  +L           D +   +H+A   G +E V+ LI+N  N+N  +      +HI++ +G   IV++LL++GA+ N   T   TPL+ A   G  +V ++LI    NI+  +  K  P+H ACQNG  E+ ++L+    +I+  N +   P+HLAC +G+  +V++L+   +N++        P+H AC  G+ + ++ L+     I   +    TPL      G+ + V  L K
Sbjct:  973 LKIAIENGSDKICAYLIN--DCKVHPDVKFDGGLAALIWAVIYGHKNLVRILLEKGADINIRNTEGWSALHYAVHHKRIAISKFLIDKGINVNYQTREGKTPLNLAAARGHTEVVILLIEKLIEQFPSRNIIDSAFQTAVQYGHSSVQDMLKRKFPEHAFTKDIDGPLMHIAAGDGIIEEVKRLINNGANVNAPSVAGYTALHISASSGHRPIVELLLDNGANVNAADTNEYTPLHWACISGVKEVVEILIGGKANIDALAKNKSTPLHFACQNGRKEVVEILIREKANIEALNQHNWTPLHLACQNGHKEVVEILIKENANIDALTEHKYTPLHLACARGHKEAVQILIGEKANIDALDENKFTPLHKACQNGHAEVVEILVK 1354          

HSP 10 Score: 111.694 bits (278), Expect = 9.437e-21
Identity = 58/190 (30.53%), Postives = 108/190 (56.84%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDR 1052
            +T LH ACQ G+ ++V +LV  K +  I+   +     +H AC +  +E+VEILIG+K  I+   +++  PLH AC NG+K + ++L+     N+   N +   P+HLAC+ GH E+ K+LI +   ++++ +++ +P+  A   G  E+ ++ +    +I      +  P++ AS  G TEV  ++ ++
Sbjct: 1598 WTPLHKACQNGHAEVVEILV--KEKANIDALAEKKFTPLHLACQNGHKEVVEILIGEKANIDALTEKKSTPLHLACQNGHKEVVEILVG-EKANIEALNQDNWTPLHLACEKGHKEVVKILIGEKANIDALTQKKNTPLHLACQRGHKEVVEIFLRKNANIAALDDEKCTPLNLASQNGHTEVEKIMKEK 1784          
BLAST of SMED30013027 vs. TrEMBL
Match: A0A3D8S806 (ANK_REP_REGION domain-containing protein OS=Coleophoma cylindrospora OX=1849047 GN=BP6252_03452 PE=4 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 4.791e-74
Identity = 131/436 (30.05%), Postives = 235/436 (53.90%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLV-SGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            T LH+A ++ N ++V+LLV  G    K +D+ +     +H+A    + E+V++L+ +  ++   +  +  PLH+A    +  IAQLL+D    +V   ++ +  P+H A + GH E+A+LLI+   ++   +    + +  A  +G +++A+LL+    D+  +    + P+H AS  G+ E+A +L+D+  D++      R P+  A  N+ +EI +LLI    ++   +     P+H A + G +E+ QLLID   ++  A+     P+H A E G+ E+ ++L++ GAD N   T   TPL+ A++ GH +++ +LI  G +I+  + ++W P+H AC+ G   IAQLLVD    +   +   Q P+H A  +GN  I +LL+D G++++        P+H A E GNL + + LV     +        T L
Sbjct:   41 TPLHWASKKDNLEMVQLLVDQGADDVKASDSLE--QTPLHWASEKGNLEMVQLLVDQGADVKVADSLDRTPLHWASEKNHLEIAQLLVD-QGADVKPADSCKRTPLHKASEKGHLEMAQLLIDHGADVKPADSYRRTALHEASENGHLKMAQLLVDQGADVKPADSRGQTPLHGASENGYLEIAQLLVDQGADVKAVDFSGRTPLHWAFENDYLEIAQLLINQGADVTAADSSRRTPLHWASKNGHLEMAQLLIDQGADVKAADSPKRTPLHWACEKGQFELAQLLVDKGADANAATTRGSTPLHEASDNGHLELALLLISQGADIKAATSRRWTPLHGACEKGHLAIAQLLVDQGADVKAADSRGQTPLHGASDNGNREIAQLLIDQGADIKAAMFRGWTPLHGASEKGNLAIAQLLVDQGADVKAATSHGRTSL 473          

HSP 2 Score: 264.233 bits (674), Expect = 2.740e-73
Identity = 134/436 (30.73%), Postives = 237/436 (54.36%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRA-IHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            T LH+A ++GN ++V+LLV      K+ D   S +R  +H+A      EI ++L+ +  ++   +  +  PLH A   G+  +AQLLID    +V   ++     +H A ++GH ++A+LL+++  ++   + +  +P+  A  +G +EIA+LL+    D+     +   P+H+A    + E+A +LI++  D+      +R P+  AS N ++E+ +LLI    ++K  +     P+H AC+KG  E+ QLL+D   + N A  +   P+H AS+NG +E+  +L+  GAD     +   TPL+ A EKGH  ++++L+D G +++    +   P+H A  NG  EIAQLL+D    I         P+H A   GNL I +LLVD G++++      +  +H A +NG+L++ + L+     ++  +    TPL
Sbjct:   75 TPLHWASEKGNLEMVQLLVDQGADVKVAD---SLDRTPLHWASEKNHLEIAQLLVDQGADVKPADSCKRTPLHKASEKGHLEMAQLLID-HGADVKPADSYRRTALHEASENGHLKMAQLLVDQGADVKPADSRGQTPLHGASENGYLEIAQLLVDQGADVKAVDFSGRTPLHWAFENDYLEIAQLLINQGADVTAADSSRRTPLHWASKNGHLEMAQLLIDQGADVKAADSPKRTPLHWACEKGQFELAQLLVDKGADANAATTRGSTPLHEASDNGHLELALLLISQGADIKAATSRRWTPLHGACEKGHLAIAQLLVDQGADVKAADSRGQTPLHGASDNGNREIAQLLIDQGADIKAAMFRGWTPLHGASEKGNLAIAQLLVDQGADVKAATSHGRTSLHEASKNGHLEIAQLLIDQGADVNATDSFKRTPL 506          

HSP 3 Score: 239.195 bits (609), Expect = 2.125e-64
Identity = 111/389 (28.53%), Postives = 207/389 (53.21%), Query Frame = 3
Query:  624 EEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            E  V++L+ +  ++   +     PLH+A    N  + QLL+D    +V   ++ E  P+H A + G+ E+ +LL+++  ++   +  + +P+ +A     +EIA+LL+    D+  +   +  P+H AS  G  E+A +LID   D++     +R  +  AS N ++++ +LL+    ++K  +   + P+H A + G++E+ QLL+D   ++   +     P+H A EN  +EI ++L+  GAD     +  RTPL+ A++ GH +++++LID G +++     K  P+H AC+ G  E+AQLLVD     +        P+H A  +G+L +  LL+  G++++        P+H ACE G+L + + LV     +   +    TPL
Sbjct:   19 EGPVQLLLDQGADVRAADSFGQTPLHWASKKDNLEMVQLLVDQGADDVKASDSLEQTPLHWASEKGNLEMVQLLVDQGADVKVADSLDRTPLHWASEKNHLEIAQLLVDQGADVKPADSCKRTPLHKASEKGHLEMAQLLIDHGADVKPADSYRRTALHEASENGHLKMAQLLVDQGADVKPADSRGQTPLHGASENGYLEIAQLLVDQGADVKAVDFSGRTPLHWAFENDYLEIAQLLINQGADVTAADSSRRTPLHWASKNGHLEMAQLLIDQGADVKAADSPKRTPLHWACEKGQFELAQLLVDKGADANAATTRGSTPLHEASDNGHLELALLLISQGADIKAATSRRWTPLHGACEKGHLAIAQLLVDQGADVKAADSRGQTPL 407          

HSP 4 Score: 198.364 bits (503), Expect = 1.878e-50
Identity = 90/295 (30.51%), Postives = 168/295 (56.95%), Query Frame = 3
Query:  909 LNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQC-DIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            +NSG     +LL+    D+  +    + P+H+AS     E+  +L+D+   D++    L++ P+  AS   N+E+V+LL+    ++K  +  +  P+H A +K  +E+ QLL+D   ++  A+     P+H ASE G +E+ ++L++HGAD     +Y RT L+ A+E GH  ++++L+D G +++    +   P+H A +NG+ EIAQLLVD    +   + + + P+H A  +  L I +LL++ G+++   D S + P+H+A +NG+L++ + L+     +   +    TPL
Sbjct:   14 VNSGVEGPVQLLLDQGADVRAADSFGQTPLHWASKKDNLEMVQLLVDQGADDVKASDSLEQTPLHWASEKGNLEMVQLLVDQGADVKVADSLDRTPLHWASEKNHLEIAQLLVDQGADVKPADSCKRTPLHKASEKGHLEMAQLLIDHGADVKPADSYRRTALHEASENGHLKMAQLLVDQGADVKPADSRGQTPLHGASENGYLEIAQLLVDQGADVKAVDFSGRTPLHWAFENDYLEIAQLLINQGADVTAADSSRRTPLHWASKNGHLEMAQLLIDQGADVKAADSPKRTPL 308          

HSP 5 Score: 177.178 bits (448), Expect = 2.832e-43
Identity = 87/274 (31.75%), Postives = 153/274 (55.84%), Query Frame = 3
Query: 1017 GFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQ-PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            G      +L+D+  D+       + P+  AS  +N+E+V+LL+    +    +D  EQ P+H A +KG +E+VQLL+D   ++  A+     P+H ASE   +EI ++L++ GAD     +  RTPL+ A+EKGH +++++LID+G +++     +   +H A +NG  ++AQLLVD    +   +   Q P+H A  +G L I +LLVD G++++  D S + P+H+A EN  L++ + L++    +   + +  TPL      G+ +    L
Sbjct:   17 GVEGPVQLLLDQGADVRAADSFGQTPLHWASKKDNLEMVQLLVDQGADDVKASDSLEQTPLHWASEKGNLEMVQLLVDQGADVKVADSLDRTPLHWASEKNHLEIAQLLVDQGADVKPADSCKRTPLHKASEKGHLEMAQLLIDHGADVKPADSYRRTALHEASENGHLKMAQLLVDQGADVKPADSRGQTPLHGASENGYLEIAQLLVDQGADVKAVDFSGRTPLHWAFENDYLEIAQLLINQGADVTAADSSRRTPLHWASKNGHLEMAQLL 290          

HSP 6 Score: 131.339 bits (329), Expect = 4.861e-28
Identity = 72/221 (32.58%), Postives = 118/221 (53.39%), Query Frame = 3
Query:  480 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLL 1142
            K T LH+AC++G  ++ +LLV        N AT   +  +H A  +   E+  +LI +  +I         PLH AC  G+ AIAQLL+D    +V   ++    P+H A  +G+ EIA+LLI++  ++ +   + ++P+  A   G + IA+LL+    D+  +T      +H AS  G  E+A +LID+  D+      KR P+  AS N+++EI +LL
Sbjct:  304 KRTPLHWACEKGQFELAQLLVDKGADA--NAATTRGSTPLHEASDNGHLELALLLISQGADIKAATSRRWTPLHGACEKGHLAIAQLLVD-QGADVKAADSRGQTPLHGASDNGNREIAQLLIDQGADIKAAMFRGWTPLHGASEKGNLAIAQLLVDQGADVKAATSHGRTSLHEASKNGHLEIAQLLIDQGADVNATDSFKRTPLQGASENDHLEIAQLL 521          
BLAST of SMED30013027 vs. TrEMBL
Match: A0A1X7T5X6 (Uncharacterized protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.545e-72
Identity = 169/498 (33.94%), Postives = 269/498 (54.02%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIV-EILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAK-LLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLIT-NKCDINCSTRTQERPIHFASTLGFTE-VAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNH--CNIKCINDENEQPIHVACQKGFVEVVQ-LLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGA-----------------------------------DTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGS-NLECPDRSNKRPIHYACENGNLDLIKALV-HNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLS 1838
            +T LHYAC++G  +IVR+L +   QC I     S +R +H AC S + +IV  ++I K C +N K      PLHYAC  G+  I ++L + P CN+  + +   +P+H AC+ G+ +I + L+I+K+C++N++    ++P+ YA   G  EI K+L   ++C++       +RP+H A   G  + V H++ID+ CD+  +      P+  A    + EIV++L TNH  CNI+  ++ N +P+H AC+ G V++V+ L+ID HC++N        P+H A E G  EIVKIL  H                                     D N       TPL+ A EKGH++  K+L ++  CNIE +     RP+H AC++G  +I + L++D HC ++ +  N   P+H AC  G+  IVK+L +H   N+E  D S  RP+H ACE+GN+D+++ LV   +C ++ K     TPL      G+ + V  L+
Sbjct:   45 YTPLHYACEEGCFEIVRIL-TDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKIL-TNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILT 540          

HSP 2 Score: 274.633 bits (701), Expect = 5.701e-72
Identity = 162/498 (32.53%), Postives = 275/498 (55.22%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAK-LLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITN-KCDINCSTRTQERPIHFASTLGFTE-VAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNH--CNIKCINDENEQPIHVACQKGFVEVVQ-LLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGA-----------------------------------DTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGS-NLECPDRSNKRPIHYACENGNLDLIKALV-HNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLS 1838
            +T LHYAC++G+ +IV++L +   QC +       +R +H AC S + +IV  ++I K C++N K+     PLHYAC  G+    ++L + P CN+  ++   ++P+H AC+ G+ +I + L+I+K+C++N+  +  ++P+ YA   G  EI K+L  + +C+I     +++RP+H A   G  + V H++ID+ CD+  +  +   P+  A    + EIV++L TNH  CN++     N++P+H AC+ G V++V+ L+I+ HC++N  +     P+H A E G  E VKIL  H                                     D N I     TPL+ A EKGH+++ K+L ++  CN+E +     RP+H AC++G  +I + L++D HC ++ ++     P+H AC  G+   VK+L +H   N+E  D  N RP+H ACE+GN+D+++ LV   +C ++ K     TPL      G+ + V FL+
Sbjct:  317 YTPLHYACEKGHFEIVKIL-TNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKIL-TNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLT 812          

HSP 3 Score: 267.314 bits (682), Expect = 1.513e-69
Identity = 159/497 (31.99%), Postives = 269/497 (54.12%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAK-LLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLL-----------------------------------ITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEIVR-LLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGS-NLECPDRSNKRPIHYACENGNLDLIKALV-HNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLS 1838
            +T LHYAC++G+ +IV++L +   QC +       +R +H AC S + +IV  ++I K C++N K  +   PLHYAC  G+  I ++L + P CN+  ++   ++P+H AC+ G+ +I + L+I+K+C++N++    ++P+ YA   G  EI K+L                                   I   CD+N   R    P+H+A   G  E   +L +  QC+IE E     RP+  A  + NV+IVR L+I  HC++         P+H AC+KG  E+V++L ++  CNI   +    +P+H A E+G V+IV+ ++++   D N       TPL+ A EKGH+++ K+L ++  CN+E +     RP+H AC++G  +I + L+++ HC ++ ++     P+H AC  G+   VK+L +H   N+E  D  N RP+H ACE+GN+D+++ LV   +C ++       TPL      G+ + V  L+
Sbjct:  181 YTPLHYACEKGHFEIVKIL-TNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILT 676          

HSP 4 Score: 266.544 bits (680), Expect = 2.134e-69
Identity = 164/497 (33.00%), Postives = 268/497 (53.92%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIA-KLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLL-----------------------------------ITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEIVR-LLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVK-ILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGS-NLECPDRSNKRPIHYACENGNLDLIKALVHN-NCAIHCKNHASSTPLDLLKTFGYDDCVSFLS 1838
            +T LHYAC++G+ +IV++L +   QC I       +R +H AC S + +IV  ++I K C++N        PLHYAC  G+  I ++L +   CN+  +     +P+H AC+ G+ +I   L+I+K+C++N+  K  ++P+ YA   G  EI K+L                                   I   CD+N        P+H+A   G  E+  +L +  QC++E E     RP+  A  + NV+IVR L+I  HC++   +     P+H AC+KG  E V++L ++  CNI   ++   +P+H A E+G V+IV+ ++++   D N       TPL+ A EKGH+++ K+L ++  CNIE +   K RP+HNAC++G  +I + L++D HC ++ +      P+H AC  G+  IVK+L +H   NLE     N RP+H ACE+GN+D+++ LV N +C ++ K+    TPL      G+ + V  L+
Sbjct:  113 YTPLHYACEKGHFEIVKIL-TNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDYSKDRPLHNACESGNVDIVRHLVIDKHCDVNAKGRIGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILT 608          

HSP 5 Score: 246.128 bits (627), Expect = 1.037e-62
Identity = 148/450 (32.89%), Postives = 253/450 (56.22%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAK-LLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLIT-NKCDINCSTRTQERPIHFASTLGFTE-VAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNH--CNIKCINDENEQPIHVACQKGFVEVVQ-LLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGA-DTNCICTYARTPLYLATEKGHYDVSKVL-IDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD-SHCSIDTENDNKQKPIHLACSSGNLNIVKLLV-DHGSNLECPDRSNKRPIHYACENGNLDLIKALV-HNNCAIHCKNHASSTPLDL 1796
            +T LHYAC++G+ +IV++L +   QC +       +R +H AC S + +IV  ++I K C++N K+     PLHYAC  G+    ++L + P CN+  K+   ++P+H AC+ G+ +I + L+I+K+C++N++    ++P+ YA   G  EI K+L   ++C++       +RP+H A   G  + V H++ID+ CD+  +  +   P+  A    + E V++L TNH  CNI+  ++ N +P+H AC+ G V++V+ L+ID HC++N        P+H A E G  EIVK L  H   +T         PL+ A +  + D+ + L ID   ++  +    + P+H AC+ G  EI ++L +   C+ + E+    + +H AC  G L+IV+ LV D   ++    R+   P+HYACE G+ +++K L  H  C I  +N+ +  PL L
Sbjct:  521 YTPLHYACEKGHFEIVKIL-TNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKIL-TNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLHKACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKILTNHPQCNTEAEDVYDDRSLHKACEFGRLDIVRYLVIDKHRDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAENNDNKWPLHL 968          

HSP 6 Score: 245.358 bits (625), Expect = 1.965e-62
Identity = 150/462 (32.47%), Postives = 244/462 (52.81%), Query Frame = 3
Query:  591 RAIHFACMSESEEIVE-ILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIA-KLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITN-KCDINCSTRTQERPIHFASTLGFTE-VAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNH--CNIKCINDENEQPIHVACQKGFVEVV-QLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGA-----------------------------------DTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGS-NLECPDRSNKRPIHYACENGNLDLIKALV-HNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLS 1838
            R++ +AC   + +IV  ++I K C++N K      PLHYAC  G   I ++L D P CN+  ++    +P+H AC+ G+ +I   L+I+K+C +N+  +  ++P+ YA   G  EI K+L  + +C+I       +RP+H A   G  + V H++ID+ CD+         P+  A    + EIV++L TNH  CN++   + N++P+H AC+ G V++V  L+ID HC++N        P+H A E G  EIVKIL  H                                     D N I     TPL+ A EKGH+++ K+L ++  CN+E +     RP+H AC++G  +I + L+++ HC ++ ++     P+H AC  G+   VK+L +H   N+E  D  N RP+H ACE+GN+D+++ LV   +C ++ K     TPL      G+ + V  L+
Sbjct:   12 RSLVYACKFRNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEEGCFEIVRILTDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKIL-TNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKILT 472          

HSP 7 Score: 226.098 bits (575), Expect = 2.327e-56
Identity = 144/413 (34.87%), Postives = 218/413 (52.78%), Query Frame = 3
Query:  492 LHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIG-KKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLI-EKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNK-CDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEIVR-LLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVKIL-LEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQLLV-DSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGS-NLECPDRSNKRPIHYA 1700
            LH AC+ GN DIVR LV  K  C +N   +     +H+AC     E V+IL    +C I  K++    PLH AC +GN  I + L+    C+VN        P+H AC+ GHFEI K+L     C + +       P+  A  SG ++I + L+ +K CD+N   R    P+H+A   G  E   +L +  QC+IE E     RP+  A  + NV+IVR L+I  HC++         P+H AC+KG  E+V+ L ++  CN    +    +P+H A ++  V+IV+ L ++   D N       TPL+ A EKGH+++ K+L ++  CN E + +   R +H AC+ G  +I + LV D H  ++ +  N   P+H AC  G+  IVK+L +H   N+E  +  NK P+H A
Sbjct:  558 LHKACESGNVDIVRHLVINK-HCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAKDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAKDRIGYTPLHYACEKGHFETVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEKGHFEIVKFLTNHPQCNTKAEDVCDDRPLHKACKSRNVDIVRYLVIDKHRDVNAKGRDGYTPLHYACEKGHFEIVKILTNHPQCNTEAEDVYDDRSLHKACEFGRLDIVRYLVIDKHRDVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEAENNDNKWPLHLA 969          

HSP 8 Score: 220.705 bits (561), Expect = 1.084e-54
Identity = 137/396 (34.60%), Postives = 217/396 (54.80%), Query Frame = 3
Query:  681 EEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIE-KNCEMNSMNKQEFSPILYALNSGQIEIA-KLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDR-QCDIECETILKRRPIFIASSNNNVEIVR-LLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLID-NHCNINCANDKLMKPIHIASENGRVEIV-KILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGFCEIAQ-LLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGS-NLECPDRSNKRPIHYACENGNLDLIKALVHN-NCAIHCKNHASSTPLDLLKTFGYDDCVSFLS 1838
            E+   L YAC   N  I + L+    C+VN K      P+H AC+ G FEI ++L +   C +   +     P+  A  SG ++I   L+I   C++N   R    P+H+A   G  E+  +L +  QC+IE E     RP+  A  + NV+IVR L+I  HC++  I      P+H AC+KG  E+V++L + + CN+    +   +P+H A E+G V+IV  ++++   D N       TPL+ A EKGH+++ K+L ++  CNIE +     RP+H AC++G  +I + L++D HC ++    N   P+H AC  G+  IVK+L +H   NLE     N RP+H ACE+GN+D+++ LV N +C ++ K+    TPL      G+ + V  L+
Sbjct:    9 EDRRSLVYACKFRNVDIVRHLVIDKHCDVNAKGRNGYTPLHYACEEGCFEIVRILTDHPQCNIEVEDNSNDRPLHKACESGNVDIVCHLVIDKHCNVNAKGRNGYTPLHYACEKGHFEIVKILTNHPQCNIEVEGSFNDRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGNFNDRPLHKACESGNVDIVHHLVIDKHCDVNAKGKDGYTPLHYACEKGHFEIVKILTNHPQCNIEAEDNWNNRPLHKACESGNVDIVRHLVIDKHCDVNAIGWNGYTPLHYACEKGHFEIVKILTNHSQCNLEAEGSFNDRPLHKACESGNVDIVRHLVINKHCDVNAKDRIGYTPLHYACEKGHFETVKILT 404          
BLAST of SMED30013027 vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 206.068 bits (523), Expect = 2.156e-53
Identity = 113/453 (24.94%), Postives = 219/453 (48.34%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VR L+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  +  LL+     ++         P+H+A   GH  I K+L++K    N+ N +  +P+  A  +G  E+A+ L+ N   ++   +  +  +H A+ +G  E+  +L++ + +    T     P+ IA+   + + VR+L+  +     +  +   P+HVA + G V+V +LL++   N N A    + P+H+A  +  +++V +L+  G   +       TPL++A+++   +V+  L+  G +   +S++   P+H A Q G  ++  LL+    +++  N +   P+HL    G++ I  +LV  G+++    R    P+H AC  GN+ ++K L+     ++ K  A  TPL      G+ D V+ L K
Sbjct:  278 LSPIHMAAQGDHMDCVRQLL--QYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKH-SASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLK 727          

HSP 2 Score: 197.593 bits (501), Expect = 1.032e-50
Identity = 120/451 (26.61%), Postives = 214/451 (47.45%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A    N ++ +LL++      +N   K+    +H A    +  +V +L+ +   I+ K  +E+ PLH A  NG+  I ++L+D     +  K      PIH+A Q  H +  + L++ N E++ +     +P+  A + G   +AK+L+      N        P+H A       V  +L+     +E  T     P+ +AS   ++ IV++L+    +    N + E P+H+A + G  EV + L+ N   ++         +H A+  G  E+VK+LLEH A+ N   T   TPL++A  +GH    ++L+D        + K + P+H A + G  ++A+LL++   + +    N   P+H+A    NL++V LLV  G +     R+   P+H A +   +++  +L+    + + ++    TPL L    G  D VS L
Sbjct:  179 FTPLHIAAHYENLNVAQLLLNRG--ANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQ-GAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLL 626          

HSP 3 Score: 195.282 bits (495), Expect = 5.128e-50
Identity = 116/451 (25.72%), Postives = 208/451 (46.12%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             T LH A   G+H + ++L+      K N    +    +H AC      ++++L+     +    +  + PLH A   G+  I ++L+     + N  N +   P+H+A + GH E+A+ L++    +++  K + + +  A   G  E+ KLL+ +K + N +T     P+H A+  G T+   +L+D        T     P+ +A+    V++  LL+    N          P+HVA     ++VV LL+    + + A      P+HIAS+  +VE+   LL++GA  N       TPL+LA ++G  D+  +LI    N+   +     P+H   Q G   IA +LV    S+         P+H+AC  GN+ +VK L+   +N+    R+   P+H A + G+ D++  L+ +    +      ++ L + K  GY   +  L
Sbjct:  311 LTPLHVAAHCGHHRMAKVLLDKG--AKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQ-KGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVL 758          

HSP 4 Score: 179.104 bits (453), Expect = 5.471e-45
Identity = 115/485 (23.71%), Postives = 222/485 (45.77%), Query Frame = 3
Query:  489 ALHYACQQGNHDIV-RLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID------VPD-----------------------CNVNCKN------AEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             LH A ++G+  +V  LL +G V   +   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L++      +P                         ++  KN      A    P+H+A  + +  +A+LL+ +   +N   K   +P+  A   G + + +LL+     I+  T+ +  P+H A+  G   +  +L+D+   I+ +T     PI +A+  ++++ VR L+  +  I  I  ++  P+HVA   G   + ++L+D     N        P+HIA +   + ++ +LL+H A    +     TPL++A+  GH ++ K+L+  G +    ++K   P+H A + G CE+A+ L+ +   +D +  + Q  +H A   G+  +VKLL++H +N      +   P+H A   G+   ++ L+  N           TPL +   +G  D    L
Sbjct:   46 GLHLASKEGHVKMVLELLHNGVV---LETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELL 527          

HSP 5 Score: 150.984 bits (380), Expect = 2.580e-36
Identity = 136/596 (22.82%), Postives = 248/596 (41.61%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFE------------------------IAKL---------LIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGF-----TEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL---SKVLDA----NREIFH---RVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERV--LLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPN---ENPYFNLMMAIKDNDPFSVQYLLAKFTFGAN 2372
            ID+   N N  N      +HLA + GH +                        IA L         L+     +N+ +++ F+P+  A     +E+ K L+ N  + +  T  +   +  A++  F     T  +H+ +   C     T     P+ IA+   N+ + +LL+    N+         P+H+A ++G V +V+LL+D    I+      + P+H A+ NG V I++ILL+ GA          +P+++A +  H D  + L+     I+  ++    P+H A   G   +A++L+D     +T   N   P+H+AC   +L ++ LL+ H ++LE    S   P+H A   G+L+++K L+    + +  N    TPL +    G+ +   FL   +  +DA    ++   H   R+ H ++VK    + A+         G + L +A     ++ +  +LD  +N Q+ +  K       +  +   + + E  L R    N               +N    G T L +A  H N D    +  +   P+    N Y  L +A K N    V+   +   +GA+
Sbjct:   34 IDINTANQNGLNG-----LHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFT--PLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNST--TTAGHTPLHIAAREGHTQTVRILLD--MNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPN------------AAGKN----GLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQ---VEVASSLLQYGAS 599          

HSP 6 Score: 103.605 bits (257), Expect = 8.039e-22
Identity = 82/381 (21.52%), Postives = 156/381 (40.94%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCN-----------INCAND-------------------------KLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSS---------------------------------GNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            L A  SG ++ A   I N  DIN + +     +H AS  G  ++   L+     +E  T      + IA+     ++V  L+    N+   + +   P+++A Q+  +EVV+ L++N  N           ++ AN                              P+HIA+    + + ++LL  GA+ N       TPL++A+ +G+  + ++L+D G  I+ ++  +  P+H A +NG   I ++L+D    I  +  N   PIH+A                                    G+  + K+L+D G+       +   P+H AC+  +L ++  L+ ++ ++     +  TPL +    G+ + V  L
Sbjct:   15 LRAARSGNLDKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKIL 395          
BLAST of SMED30013027 vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 201.445 bits (511), Expect = 6.091e-52
Identity = 119/451 (26.39%), Postives = 215/451 (47.67%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A    N  + +LL++      +N   K+    +H A    +  +V +L+ +  +I+ +  +E+ PLH A  NG+  + ++L+D     +  K      PIH+A Q  H +  + L++ N E++ +     +P+  A + G   +AK+L+      N        P+H A          +L+     +E  T     P+ +A+   ++ IV+ L+    +    N + E P+H+A + G  EV Q L+ N   ++        P+H A+  G  E+VK+LLEH A+ +   T   TPL++A  +GH   +++L+D        + K + P+H AC+ G  ++A+LL++   + +    N   P+H+A    NL++VKLLV  G +     R+   P+H A +   L++  +L+      + ++    TPL L    G  D V+ L
Sbjct:  182 FTPLHIAAHYENLSVAQLLLNRG--ANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQ-GAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALL 629          

HSP 2 Score: 187.963 bits (476), Expect = 8.446e-48
Identity = 118/516 (22.87%), Postives = 231/516 (44.77%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQK-----PIHL---------------------------------ACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYD 1916
             + +H A Q  + D VR L+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +     LL+     ++         P+H+A   GH  I K L+++    N+ N +  +P+  A  +G  E+A+ L+ N   ++   +  + P+H A+ +G  E+  +L++ + + +  T     P+ IA+   +    R+L+  +     +  +   P+HVAC+ G V+V +LL++   N N A    + P+H+A  +  +++VK+L+  G   +       TPL++A ++   +V+  L+  G N   +S++   P+H A Q G  ++  LL+    +++  N  + +     P+HL                                 AC  GN+ +VK L+   +++ C  R    P+H A + G+ D++  L+ +    +      ++PL + K  GY   +  L  V + +    HR+   + V  +E+ D
Sbjct:  281 LSPIHMAAQGDHMDCVRQLL--QYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKH-SASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESMSAKHRMSFPETV--DEILD 791          

HSP 3 Score: 181.415 bits (459), Expect = 1.020e-45
Identity = 127/524 (24.24%), Postives = 227/524 (43.32%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPI---------------------LYALNS------------GQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCN-----------------------IKCINDENEQ----------PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQK-----PIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             T LH A ++GN  +VRLL+    Q  I+  TK     +H A  +    ++EIL+ +   I  K    + P+H A    +    + L+   +  ++    +   P+H+A   GH  +AK+L++K  + N+     F+P+                     L A+              G + I K L+      N S    E P+H A+  G  EVA  L+     ++ +    + P+  A+   + E+V+LL+ +  N                        + + D N Q          P+HVAC+ G V+V +LL++   N N A    + P+H+A  +  +++VK+L+  G   +       TPL++A ++   +V+  L+  G N   +S++   P+H A Q G  ++  LL+    +++  N  + +     P+HL    G++ I  +LV  G+++    R     +H AC  GN+ ++K L+     ++CK     TPL      G+ D V+ L K
Sbjct:  215 ITPLHIAARRGNVIMVRLLLDRGAQ--IDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQY-NAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLK 735          

HSP 4 Score: 176.407 bits (446), Expect = 3.499e-44
Identity = 112/451 (24.83%), Postives = 212/451 (47.01%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  L+   +   +   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L++    N +    +   P+ +A Q GH  +  LLI    +     K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R  ++         P+ IA+   NV +VRLL+     I     +   P+H A + G V V+++L+D    I       + PIH+A++   ++ V+ LL++ A+ + I     TPL++A   GH+ ++KVL+D G     +++  + P+H AC+        LL+    S++   ++   P+H+A   G+LNIVK L+  G++    +   + P+H A   G+ ++ + L+ N   +  K     TPL      G+ + V  L
Sbjct:   21 LNGLHLASKEGHVKMVLELLHHGID--LETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLEN-GANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLL 464          

HSP 5 Score: 165.622 bits (418), Expect = 7.091e-41
Identity = 112/483 (23.19%), Postives = 209/483 (43.27%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEK---------------------------------GHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            TALH A   G   +V  LV       +N  ++     ++ A      E+V+ L+      +   ++   PL  A   G++ +  LLI     N   K       +H+A ++     A +L++ +   + ++K  F+P+  A +   + +A+LL+    ++N + +    P+H A+  G   +  +L+DR   I+  T  +  P+  A+ N +V ++ +L+     I+        PIH+A Q   ++ V+ L+  +  I+      + P+H+A+  G   + K+LL+ GA  N       TPL++A +K                                 GH ++ K L+  G +    ++K   P+H A + G CE+AQ L+ +   +D +  + Q P+H A   G+  +VKLL++H +N +    +   P+H A   G+    + L+  N           TPL +   +G  D    L
Sbjct:   55 TALHIAALAGQEKVVAELV--HYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLI-----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELL 530          

HSP 6 Score: 138.272 bits (347), Expect = 2.146e-32
Identity = 132/595 (22.18%), Postives = 232/595 (38.99%), Query Frame = 3
Query:  765 VNCKNAEESQPIHLACQHGHFE------------------------IAKL---------LIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLID----------------RQCDIECETILKR-------------RPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVL---DA----NREIFH---RVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLA-GTTFLELATIHGNDDFAQKIRERICFPN---ENPYFNLMMAIKDN 2321
            +N  N      +HLA + GH +                        IA L         L+     +N+ +++ FSP+  A     +E+ K L+ N  + +  T     P+  A   G   V  +LI+                R  D     +L +              P+ IA+   N+ + +LL+    N+         P+H+A ++G V +V+LL+D    I+      + P+H A+ NG V +++ILL+ GA          +P+++A +  H D  + L+     I+  ++    P+H A   G   +A++L+D     +    N   P+H+AC   ++  + LL+ H ++LE    S   P+H A   G+L+++K+L+    + +  N    TPL +    G+ +   FL + L   DA    ++   H   R+ H ++VK    + A+         G + L +A     +     +LD   N Q+ +  K       +                C       A   L    N N     G T L +A  H N D  + +  +   P+    N Y  L +A K N
Sbjct:   13 INTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSA--TTAGHTPLHIAAREGHAHTTRILLDG--NAQQTKMTKKGFTPLHVA---------------CKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQN 588          

HSP 7 Score: 128.257 bits (321), Expect = 2.099e-29
Identity = 70/304 (23.03%), Postives = 150/304 (49.34%), Query Frame = 3
Query:  846 IEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            I+    +N+ N+   + +  A   G +++   L+ +  D+  +T+     +H A+  G  +V   L+    ++  ++     P+++A+  N++E+V+ L+ N  N     ++   P+ VA Q+G   VV LLI    N        +  +HIA+ N       +LL++  + + +     TPL++A    +  V+++L++ G N+         P+H A + G   + +LL+D    ID    ++  P+H A  +G++ ++++L+D G+ ++   ++   PIH A +  ++D ++ L+  N  I
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI 306          

HSP 8 Score: 90.1225 bits (222), Expect = 1.168e-17
Identity = 59/245 (24.08%), Postives = 110/245 (44.90%), Query Frame = 3
Query: 1143 ITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS---------IDTENDNKQ--------------------KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            I N   I   N      +H+A ++G V++V  L+ +  ++     K    +HIA+  G+ ++V  L+ +GA+ N       +PLY+A ++ H +V K L++NG N    +   + P+  A Q G   +  LL++             I   ND+ +                     P+H+A    NL++ +LL++ G+N+    ++   P+H A   GN+ +++ L+     I  +     TPL
Sbjct:    7 IKNGIAINTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPL 251          
BLAST of SMED30013027 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 191.815 bits (486), Expect = 7.202e-49
Identity = 110/453 (24.28%), Postives = 209/453 (46.14%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEES--QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             + LH A Q  + + V+LL+   V   ++D T     A+H A      ++ ++++ KK   N K      PLH AC      + +LL+       + +   ES   PIH+A   GH  I K L       N+ N +  + +  A  +GQ ++ + L+ N   ++   +  +  +H AS LG  E+  +L+ +       T     P+ +A    + E   LL+ +  ++     +   P+HVA + G +E  +LL+      + A    + P+H+A+      +  +LL+HGA  +       TPL++A +K   ++   L++ G      + +   P+H A Q G  ++  LL+  + +++  N N   P+HLA     + + ++L++HG+ ++   ++   P+H AC  GN+ ++  L+ N   I+ K  +  TPL      G+   ++ L
Sbjct:  337 LSPLHMATQGDHLNCVQLLLQHDV--PVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLK---HGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINML 784          

HSP 2 Score: 189.504 bits (480), Expect = 3.862e-48
Identity = 130/528 (24.62%), Postives = 242/528 (45.83%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI---NDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL----SKVLDANR---EIFHRVRHDDIVKFNELY-------DAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILD 2015
            FT LH A   GN ++  LL++          ND T      +H A    +  +V++L+ +  +I+ K  + + PLH    +G++ + ++L+D     +  K      P+H+A Q  H    +LL++ +  ++ +     + +  A + G  ++AK+++  K + N        P+H A      +V  +L+     ++  T     PI +A+   +  IV+ L  +  +    N   E  +H+A + G  +VV+ L+ N   ++         +HIAS  G+ EIV++LL+ GA  +   T   TPL+LA  +GH + + +L+++G ++   + K + P+H A + G  E A+LL+    + DT       P+H+A    N  +  LL+DHG++     ++   P+H A +   L++   L+      +       +PL L    G  D VS L    + V   N+      H    +D V   E+        DAHT       TG + L VA    + ++++++L+
Sbjct:  238 FTPLHIAAHYGNINVATLLLNRGAAVDFMARNDIT-----PLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDR-GAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHT------KTGYTPLHVACHYGNMKMVSFLLE 753          

HSP 3 Score: 181.03 bits (458), Expect = 1.665e-45
Identity = 109/460 (23.70%), Postives = 211/460 (45.87%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN--RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDAN 1856
             TALH A   G++ + +++V  K     N   K+ N    +H AC     +++E+L+     +    +  + P+H A   G++ I + L      + N  N      +H+A + G  ++ + L++   +++   K + + +  A   G+ EI +LL+      + +T +   P+H A   G  E A +L++    +   T     P+ +A+    +E  +LL+               P+HVA       V  LL+D+  + + A      P+HIA++  ++EI   LLE GA+TN +     +PL+LA ++G  D+  +L+    N+   +     P+H A Q     +A++L++    +D        P+H+AC  GN+ +V  L+++ + +    +S   P+H A + G+  +I  L+ +  + +      +T L + +  GY   V  L  + D N
Sbjct:  370 LTALHVAAHCGHYKVAKVIVDKKA----NPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHH-GASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLTDEN 824          

HSP 4 Score: 180.644 bits (457), Expect = 2.324e-45
Identity = 108/449 (24.05%), Postives = 213/449 (47.44%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ALH A ++G+ ++V  L+  K+   ++ ATK  N A+H A ++   ++V  L+     +N ++     PL+ A    +  + + L++    + +    +   P+ +A Q GH ++  LL+E + +     K     +  A      + A LL+ N  + +  +++   P+H A+  G   VA +L++R   ++        P+ +A+   N  +V+LL+     I     +   P+H   + G  +VV++L+D    I       + P+H+A++   +  V++LL+H    + +     T L++A   GHY V+KV++D   N   +++  + P+H AC+    ++ +LL+    S+    ++   PIH+A   G+ NIVK L  HG++    +   +  +H A   G  D+++ L+ N   +  K     T L +    G  + V  L
Sbjct:   79 ALHLASKEGHVEVVAELL--KLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEH-GASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK----GKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLL 520          

HSP 5 Score: 177.178 bits (448), Expect = 2.415e-44
Identity = 107/451 (23.73%), Postives = 212/451 (47.01%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT L+ A Q+ + ++VR L+       I  AT+     +  A     +++V +L+    E + K    +  LH A    +   A LL+   D N + ++     P+H+A  +G+  +A LL+ +   ++ M + + +P+  A   G   + KLL+     I+  T+    P+H  +  G  +V  ML+DR   I  +T     P+ +A+  +++  V+LL+ +   +  + ++    +HVA   G  +V ++++D   N N        P+HIA +  RV+++++LL+HGA    +     TP+++A   GH ++ K L  +G +    +++    +H A + G  ++ + L+ +   +D +  + Q  +H+A   G   IV+LL+  G+       S   P+H A   G+ +    L+ +  ++        TPL +   +G  +    L
Sbjct:  143 FTPLYMAAQENHLEVVRFLLEHGASQSI--ATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKSAALLLQN-DHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLL 586          

HSP 6 Score: 140.969 bits (354), Expect = 3.058e-33
Identity = 98/460 (21.30%), Postives = 202/460 (43.91%), Query Frame = 3
Query:  555 QCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQN---------------------------------GFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            Q K +D+  S  RA     + ++ + ++  +    +IN  N   +  LH A   G+  +   L+ +   +V+    + +  +H+A   G  ++ + L+     +N+ ++  F+P+  A     +E+ + L+ +    + +T     P+  A   G  +V  +L++     + +  ++   + IA+  ++ +   LL+ N  N    +     P+H+A   G + V  LL++    ++      + P+H+A++ G   +VK+LL+ GA  +       TPL+     GH  V ++L+D G  I  ++     P+H A Q                                  G  ++A+++VD   + + +  N   P+H+AC    + +++LL+ HG++L+    S   PIH A   G+ +++K L H+  + +  N    T L +    G  D V +L
Sbjct:   37 QKKKSDSNASYLRAARAGNLEKALDYLKTGV----DINICNQNGLNALHLASKEGHVEVVAELLKL-GASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYL 487          

HSP 7 Score: 105.145 bits (261), Expect = 3.269e-22
Identity = 70/288 (24.31%), Postives = 131/288 (45.49%), Query Frame = 3
Query: 1104 ASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHC-----------------------------SIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVR 1880
            A+   N+E     +    +I   N      +H+A ++G VEVV  L+    +++ A  K    +HIAS  G+ ++V+ L+ +GA+ N       TPLY+A ++ H +V + L+++G +    +   + P+  A Q G  ++  LL+++                               + D E+ +   P+H+A   GN+N+  LL++ G+ ++   R++  P+H A + GN +++K L+     I  K     TPL      G++  V  L   LD    I  + +
Sbjct:   50 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEML---LDRGAPILSKTK 334          
BLAST of SMED30013027 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 191.43 bits (485), Expect = 1.178e-48
Identity = 110/453 (24.28%), Postives = 209/453 (46.14%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEES--QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             + LH A Q  + + V+LL+   V   ++D T     A+H A      ++ ++++ KK   N K      PLH AC      + +LL+       + +   ES   PIH+A   GH  I K L       N+ N +  + +  A  +GQ ++ + L+ N   ++   +  +  +H AS LG  E+  +L+ +       T     P+ +A    + E   LL+ +  ++     +   P+HVA + G +E  +LL+      + A    + P+H+A+      +  +LL+HGA  +       TPL++A +K   ++   L++ G      + +   P+H A Q G  ++  LL+  + +++  N N   P+HLA     + + ++L++HG+ ++   ++   P+H AC  GN+ ++  L+ N   I+ K  +  TPL      G+   ++ L
Sbjct:  309 LSPLHMATQGDHLNCVQLLLQHDV--PVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLK---HGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINML 756          

HSP 2 Score: 188.734 bits (478), Expect = 6.754e-48
Identity = 130/528 (24.62%), Postives = 242/528 (45.83%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKI---NDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSKVLDANR------EIFHRVRHDDIVKFNELY-------DAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILD 2015
            FT LH A   GN ++  LL++          ND T      +H A    +  +V++L+ +  +I+ K  + + PLH    +G++ + ++L+D     +  K      P+H+A Q  H    +LL++ +  ++ +     + +  A + G  ++AK+++  K + N        P+H A      +V  +L+     ++  T     PI +A+   +  IV+ L  +  +    N   E  +H+A + G  +VV+ L+ N   ++         +HIAS  G+ EIV++LL+ GA  +   T   TPL+LA  +GH + + +L+++G ++   + K + P+H A + G  E A+LL+    + DT       P+H+A    N  +  LL+DHG++     ++   P+H A +   L++   L+      +       +PL L    G  D VS  L+K  + N          H    +D V   E+        DAHT       TG + L VA    + ++++++L+
Sbjct:  210 FTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITP-----LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDR-GAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHT------KTGYTPLHVACHYGNMKMVSFLLE 725          

HSP 3 Score: 180.259 bits (456), Expect = 2.872e-45
Identity = 109/460 (23.70%), Postives = 211/460 (45.87%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN--RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDAN 1856
             TALH A   G++ + +++V  K     N   K+ N    +H AC     +++E+L+     +    +  + P+H A   G++ I + L      + N  N      +H+A + G  ++ + L++   +++   K + + +  A   G+ EI +LL+      + +T +   P+H A   G  E A +L++    +   T     P+ +A+    +E  +LL+               P+HVA       V  LL+D+  + + A      P+HIA++  ++EI   LLE GA+TN +     +PL+LA ++G  D+  +L+    N+   +     P+H A Q     +A++L++    +D        P+H+AC  GN+ +V  L+++ + +    +S   P+H A + G+  +I  L+ +  + +      +T L + +  GY   V  L  + D N
Sbjct:  342 LTALHVAAHCGHYKVAKVIVDKKA----NPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHH-GASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLTDEN 796          

HSP 4 Score: 173.326 bits (438), Expect = 3.918e-43
Identity = 110/457 (24.07%), Postives = 211/457 (46.17%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITN--------KCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ALH A ++G+ ++V  L+  K+   ++ ATK  N A+H A ++   ++V  L+     +N ++     PL+ A    +  + + L++    + +    +   P+ +A Q GH ++  LL+E + +     K     +  A      + A LL+ N        K      T +   P+H A+  G   VA +L++R   ++        P+ +A+   N  +V+LL+     I     +   P+H   + G  +VV++L+D    I       + P+H+A++   +  V++LL+H    + +     T L++A   GHY V+KV++D   N   +++  + P+H AC+    ++ +LL+    S+    ++   PIH+A   G+ NIVK L  HG++    +   +  +H A   G  D+++ L+ N   +  K     T L +    G  + V  L
Sbjct:   43 ALHLASKEGHVEVVAELL--KLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEH-GASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK----GKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLL 492          

HSP 5 Score: 169.859 bits (429), Expect = 4.605e-42
Identity = 107/459 (23.31%), Postives = 213/459 (46.41%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEES--------QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT L+ A Q+ + ++VR L+       I  AT+     +  A     +++V +L+    E + K    +  LH A    +   A LL+   D N + ++   +         P+H+A  +G+  +A LL+ +   ++ M + + +P+  A   G   + KLL+     I+  T+    P+H  +  G  +V  ML+DR   I  +T     P+ +A+  +++  V+LL+ +   +  + ++    +HVA   G  +V ++++D   N N        P+HIA +  RV+++++LL+HGA    +     TP+++A   GH ++ K L  +G +    +++    +H A + G  ++ + L+ +   +D +  + Q  +H+A   G   IV+LL+  G+       S   P+H A   G+ +    L+ +  ++        TPL +   +G  +    L
Sbjct:  107 FTPLYMAAQENHLEVVRFLLEHGASQSI--ATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKSAALLLQN-DHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLL 558          

HSP 6 Score: 135.576 bits (340), Expect = 1.511e-31
Identity = 98/434 (22.58%), Postives = 181/434 (41.71%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKC---------------------INDENEQ----------------PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQN---------------------------------GFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +D+  CN N  NA     +HLA + GH E+   L++    +++  K+  + +  A  +GQ ++ + L+TN  ++N  ++    P++ A+     EV   L++        T     P+ +A    + ++V LL+ N    K                       ND N                  P+H+A   G + V  LL++    ++      + P+H+A++ G   +VK+LL+ GA  +       TPL+     GH  V ++L+D G  I  ++     P+H A Q                                  G  ++A+++VD   + + +  N   P+H+AC    + +++LL+ HG++L+    S   PIH A   G+ +++K L H+  + +  N    T L +    G  D V +L
Sbjct:   31 VDINICNQNGLNA-----LHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYL 459          

HSP 7 Score: 123.635 bits (309), Expect = 8.261e-28
Identity = 75/325 (23.08%), Postives = 161/325 (49.54%), Query Frame = 3
Query:  807 ACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLE--HGADTNC-ICTYAR-----TPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            A + G+ E A   ++   ++N  N+   + +  A   G +E+   L+     ++ +T+     +H AS  G T+V   L+    ++  ++     P+++A+  N++E+VR L+ +  +     ++   P+ VA Q+G  +VV LL++N    +      +  +HIA+     +   +LL+  H AD    + TY       TPL++A   G+ +V+ +L++ G  ++  +     P+H A + G   + +LL+D    ID +  +   P+H    SG+  +V++L+D G+ +    ++   P+H A +  +L+ ++ L+ ++  +
Sbjct:   14 AARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPV 334          

HSP 8 Score: 120.168 bits (300), Expect = 8.139e-27
Identity = 127/527 (24.10%), Postives = 217/527 (41.18%), Query Frame = 3
Query:  900 LYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSI--------KKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEI------KERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFN---LMMAIKDNDPFSVQYLL---AKFTFGANPRQCLSTALGIAMSL 2417
            L A  +G +E A   +    DIN   +     +H AS  G  EV   L+     ++  T      + IAS     ++VR L+TN  N+   +     P+++A Q+  +EVV+ L+++  + + A +    P+ +A + G  ++V +LLE     N      R P L++A  K     + +L+ N  N + +S           + P+H A   G   +A LL++   ++D    N   P+H+A   GN N+VKLL+D G+ ++   +    P+H    +G+  +++ L+     I  K     +PL +     + +CV  L         + H V  DD+               +Y   L+ L VA      ++   I+D+  N         ALN F        K RV +++    H +             L++V       +G T + +A   G+++  +++      PN         L MA +      V+YLL   AK    A   Q   TAL IA  L
Sbjct:   12 LRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL---------LQHDVPVDDVTN-------------DY---LTALHVAAHCGHYKVAKVIVDKKANPN-----AKALNGFTPLHIACKKNRVKVMELLLKHGA------------SLQAVTE-----SGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQ---TALHIASRL 483          
BLAST of SMED30013027 vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 189.119 bits (479), Expect = 5.194e-48
Identity = 117/454 (25.77%), Postives = 211/454 (46.48%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLV--SGKVQCKI-NDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A   GN ++  LL+     V  K  ND T      +H A    +  +V++L+ +   I+ K  + + PLH    +G++ + ++L+D     +  K      P+H+A Q  H    +LL+     ++ +     + +  A + G  ++AK+++  K + N        P+H A      +V  +L+     I+  T     PI +A+   +  IV  L+ +  +    N   E  +H+A + G  EVV+ L+ N   ++  +     P+HI+S  G+ EI++ LL+HGA  +   T   TPL+LA  +GH DV+ +L+D G ++   + K + P+H A + G  E+A LL+      D    +   P+H+A    N  +  LL+D G++     ++   P+H A +   +++   L+      +       +PL L    G  D V+ L
Sbjct:  183 FTPLHIAAHYGNINVATLLLNRGAAVDFKARNDIT-----PLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDR-GAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLL 630          

HSP 2 Score: 187.193 bits (474), Expect = 2.265e-47
Identity = 111/449 (24.72%), Postives = 217/449 (48.33%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ALH A ++G+ ++V  L+  K+   ++ ATK  N A+H A ++   ++V+ L+     +N ++     PL+ A    +  + + L+D    + +    +   P+ +A Q GH ++  LL+E + +     K     +  A      + A LL+ N  + +  +++   P+H A+  G   VA +L++R   ++ +      P+ +AS   N  +V+LL+     I     +   P+H   + G  +VV++L+D    I       + P+H+A++   +  V++LL H    + +     T L++A   GHY V+KV++D   N   +++  + P+H AC+    ++ +LL+    SI    ++   PIH+A   G+ NIV  L++HG++    +   +  +H A   G  +++K LV N   +  K+    TPL +    G  + +  L
Sbjct:   24 ALHLASKEGHVEVVTQLI--KMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDN-GSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK----GKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQL 465          

HSP 3 Score: 181.03 bits (458), Expect = 1.902e-45
Identity = 110/454 (24.23%), Postives = 218/454 (48.02%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDR---SNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT L+ A Q+ + D+VR L+       I  AT+     +  A     +++V +L+    E + K    +  LH A    +   A LL+   D N + ++     P+H+A  +G+  +A LL+ +   ++   + + +P+  A   G   + KLL+     I+  T+    P+H  +  G  +V  ML+DR   I  +T     P+ +A+  +++  V+LL+ +   +  + ++    +HVA   G  +V ++++D   N N        P+HIA +  R++++++LL+HGA    +     TP+++A   GH ++   L+++G +    +++    +H A + G  E+ + LV +   +D ++ + Q P+H++   G   I++ L+ HG+   CPD    S   P+H A   G+ D+   L+    ++        TPL +   +G  +  + L
Sbjct:   88 FTPLYMAAQENHLDVVRYLLDNGSSQSI--ATEDGFTPLAVALQQGHDQVVSLLL----ENDTKGKVRLPALHIAARKDDTKAAALLLQN-DHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGA---CPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLL 531          

HSP 4 Score: 179.104 bits (453), Expect = 6.567e-45
Identity = 102/433 (23.56%), Postives = 204/433 (47.11%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS 1781
             + LH A Q  + + V+LL+  +V   ++D T     A+H A      ++ ++++ KK   N K      PLH AC      + +LL+     ++         PIH+A   GH  I   L+      N+ N +  + +  A  +GQ E+ K L+ N   ++  ++  + P+H +S LG  E+   L+      +  T     P+ +A+   + ++  +L+    ++     +   P+HVA + G +EV  LL+      + +    + P+H+A+     ++  +LL+ GA  +       TPL++A +K   +++  L++ G +    + +   P+H A Q G  ++  LL+    +I+  N +   P+HLA     +N+ ++LV+HG+ ++   +    P+H AC  GN+ ++  L+ N   ++ K   ++
Sbjct:  282 LSPLHMATQGDHLNCVQLLLHHEV--PVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKH-GASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVTA 711          

HSP 5 Score: 173.326 bits (438), Expect = 4.385e-43
Identity = 115/491 (23.42%), Postives = 224/491 (45.62%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLI--DVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQ---------------------------------LLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKV---LIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             T LH A ++GN ++V+LL+  +   +I+  TK     +H    S  E++VE+L+ +   I  K    + PLH A    +    QLL+  +VP   V+    +    +H+A   GH+++AK++++K    N+     F+P+  A    +I++ +LL+ +   I   T +   PIH A+ +G   +   L++         +     + +A+     E+V+ L+ N   +   + +++ P+H++ + G  E++Q                                 +L+D   ++     K   P+H+A++ G++E+  +LL+  A  +       TPL++A    HYD  KV   L+D G +    +   + P+H A +    EIA  L++     +        P+HLA   GN+++V LL+   + +   ++S   P+H A +   +++ + LV++   +  +     TPL +   +G    V FL K
Sbjct:  216 ITPLHVASKRGNSNMVKLLL--ERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVP---VDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVA---AHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLK 698          

HSP 6 Score: 138.658 bits (348), Expect = 1.720e-32
Identity = 94/393 (23.92%), Postives = 174/393 (44.27%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKC---------------------INDENEQ--------PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +D+  CN N  NA     +HLA + GH E+   LI+    +++  K+  + +  A  +GQ ++ K L+TN  ++N  ++    P++ A+     +V   L+D        T     P+ +A    + ++V LL+ N    K                       ND N          P+H+A   G + V  LL++    ++      + P+H+AS+ G   +VK+LLE GA  +       TPL+     GH  V ++L+D G  I  ++     P+H A Q       QLL+     +D   ++    +H+A   G+  + K++VD  +N      +   P+H AC+   + +++ L+ +  +I     +  TP+ +    G+++ V+ L
Sbjct:   12 VDINICNQNGLNA-----LHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQL 399          

HSP 7 Score: 125.176 bits (313), Expect = 2.102e-28
Identity = 83/325 (25.54%), Postives = 151/325 (46.46%), Query Frame = 3
Query:  924 IEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIV 1895
            +E A   + +  DIN   +     +H AS  G  EV   LI     ++  T      + IAS     ++V+ L+TN  N+   +     P+++A Q+  ++VV+ L+DN  + + A +    P+ +A + G  ++V +LLE     N      R P L++A  K     + +L+ N  N + +S   + P+H A   G   +A LL++   ++D +  N   P+H+A   GN N+VKLL++ G+ ++   +    P+H    +G+  +++ L+     I  K     +PL +     + +CV  L         + H V  DD+ 
Sbjct:    1 LEKALDYLKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLE-----NDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL---------LHHEVPVDDVT 311          
BLAST of SMED30013027 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.164 bits (557), Expect = 4.313e-59
Identity = 128/487 (26.28%), Postives = 232/487 (47.64%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL-------SKVLDANREIFHRVRHDDIVKFNELYDAH 1922
            FT LH A   GN ++  LL++  +   ++   ++    +H A    +  +V++L+ +  +I+ K  + + PLH A  +G++ + ++L++  D  +  K      P+H+A Q  H    +LL+ +   ++ +     +P+  A + G   +AKLL+    + N        P+H A      +V  +L+     I   T     PI +AS   ++ +V+LL+ N  +    N   E P+H+A + G +EVV+ L+ +   +     +   P+HIAS  G+ EIV++LL+ G+D N       TPLY A+ +GH DV+ +L++NG +I   + K + P+H A + G  E+A LL++ + S D +  N   P+H+A    +  +  LL+D G++     ++   P+H A +   L++ K L+      +        PL L    G+ D V+ L       S          H    +D V   E+   H
Sbjct:  213 FTPLHIAAHYGNMNVATLLLN--LGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLER-DAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKH 696          

HSP 2 Score: 201.83 bits (512), Expect = 1.740e-53
Identity = 114/451 (25.28%), Postives = 209/451 (46.34%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             + LH A Q G H     L+ G+ Q  ++D T      +H A       + ++L+ +  E N +      PLH AC      + +LL+     +++        PIH+A   GH  + +LL++     N+ N +  +P+  A  +GQ+E+ K L+ +   +    R  + P+H AS LG  E+  +L+ R  D    T     P++ AS   + ++  LL+ N  +I  +  +   P+H+A + G +EV  LL++ + + +      + P+H+A+     ++  +LL+ GA  +       TPL++A +K   +V KVL++ G      + +   P+H A Q G  ++  LL+  H SI          +HLA     +N+ ++L  H +++    +    P+H A   GN+ ++  L+ N   ++ K     TPL      G+   V+ L
Sbjct:  312 LSPLHMATQ-GEHLACVQLLLGR-QAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLK-HGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNAL 759          

HSP 3 Score: 196.438 bits (498), Expect = 8.050e-52
Identity = 120/459 (26.14%), Postives = 223/459 (48.58%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLL--------ITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
              ALH A ++G+ D+V  L+  K + +I+ ATK  N A+H A ++   +IV +L+     IN ++     PL+ A    +  I + L+D    N +    +   P+ +A Q GH ++  LL+E + +     K     +  A        A LL        +T+K  +N +T +   P+H A+  G   VA +L++    ++        P+ +A+   N  +V+LL+     I     +   P+H A + G  +V+++L++    I       + P+H+A++   +  V++LL   A  + +     TPL++A   GHY V+K+L+D G     +++  + P+H AC+    ++ +LL+    SI T  ++   PIH+A   G+LN+V+LL+ +G++    +   + P+H A   G L+++K L+ +   +  K     TPL +    G  + V  L
Sbjct:   44 LNALHLASKEGHVDVVTELL--KREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLD-NGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK----GKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL 495          

HSP 4 Score: 192.2 bits (487), Expect = 1.938e-50
Identity = 117/455 (25.71%), Postives = 216/455 (47.47%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLV--SGKVQCK-INDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLS 1838
             T LH A   G++ + +LL+   G+   + +N  T      +H AC     +++E+L+     I+   +  + P+H A   G+  + QLL+     + N  N     P+H+A + G  E+ K L++    +    +++ +P+  A   G+ EI +LL+    D N  T +   P++FAS  G  +VA +L++   DI   T     P+ IAS    +E+  LL+  + +          P+HVA      +V  LL+D   + +        P+HIA++  ++E+ K+LLE GA+TN +      PL+LA ++GH D+  +L+    +I   +      +H A Q     +A++L      ++T       P+H+A   GN+ +V  L+ + + +    R+   P+H A + G+  ++ AL+ +  + +      +T L + +  GY   V  LS
Sbjct:  345 LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTP-----LHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ-NGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLS 793          

HSP 5 Score: 131.339 bits (329), Expect = 3.179e-31
Identity = 90/401 (22.44%), Postives = 173/401 (43.14%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKC----------------------------------INDENEQ---PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +D+  CN N  NA     +HLA + GH ++   L+++  E+++  K   + +  A  +GQ +I ++L+    +IN  ++    P++ A+     E+   L+D   +    T     P+ +A    + ++V LL+ +    K                                   +N   E    P+H+A   G + V  LL++    ++      + P+H+A++ G   +VK+LL+ GA  +       TPL+ A   GH  V ++L++    I  ++     P+H A Q       QLL+     +D    +   P+H+A   G+  + KLL+D G        +   P+H AC+   + +++ L+ +  +IH    +  TP+ +    G+ + V  L
Sbjct:   34 MDINTCNQNGLNA-----LHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLL 429          

HSP 6 Score: 125.176 bits (313), Expect = 2.542e-29
Identity = 86/324 (26.54%), Postives = 153/324 (47.22%), Query Frame = 3
Query:  891 SPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSI--------KKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +  L A  +G +E     +    DIN   +     +H AS  G  +V   L+ R+ +I+  T +    + IA+     +IVR+L+    NI   +     P+++A Q+  +E+V+ L+DN  N + A +    P+ +A + G  ++V +LLE  +DT       R P L++A  K   + + +L+ +  N +  S           + P+H A   G   +A LL++   ++D    N   P+H+A   GN N+VKLL+D G+ ++   R    P+H A  +G+  +I+ L+  +  I  K     +PL +     +  CV  L
Sbjct:   12 TSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLE--SDTKGKV---RLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLL 330          
BLAST of SMED30013027 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.386 bits (542), Expect = 1.464e-57
Identity = 128/489 (26.18%), Postives = 232/489 (47.44%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTE--NDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL-------SKVLDANREIFHRVRHDDIVKFNELYDAH 1922
            FT LH A   GN ++  LL++  +   ++   ++    +H A    +  +V++L+ +  +I+ K  + + PLH A  +G++ + ++L++  D  +  K      P+H+A Q  H    +LL+ +   ++ +     +P+  A + G   +AKLL+    + N        P+H A      +V  +L+     I   T     PI +AS   ++ +V+LL+ N  +    N   E P+H+A + G +EVV+ L+ +   +     +   P+HIAS  G+ EIV++LL+ G+D N       TPLY A+ +GH DV+ +L++NG +I   + K + P+H A + G  E+A LL++ + S D +    N   P+H+A    +  +  LL+D G++     ++   P+H A +   L++ K L+      +        PL L    G+ D V+ L       S          H    +D V   E+   H
Sbjct:  206 FTPLHIAAHYGNMNVATLLLN--LGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLE-RDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKH 691          

HSP 2 Score: 197.208 bits (500), Expect = 3.485e-52
Identity = 116/451 (25.72%), Postives = 223/451 (49.45%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
              ALH A ++G+ D+V  L+  K + +I+ ATK  N A+H A ++   +IV +L+     IN ++     PL+ A    +  I + L+D    N +    +   P+ +A Q GH ++  LL+E + +     K     +  A        A LL+ ++ + + ++++   P+H A+  G   VA +L++    ++        P+ +A+   N  +V+LL+     I     +   P+H A + G  +V+++L++    I       + P+H+A++   +  V++LL   A  + +     TPL++A   GHY V+K+L+D G     +++  + P+H AC+    ++ +LL+    SI T  ++   PIH+A   G+LN+V+LL+ +G++    +   + P+H A   G L+++K L+ +   +  K     TPL +    G  + V  L
Sbjct:   45 LNALHLASKEGHVDVVTELL--KREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLD-NGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTK----GKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLL 488          

HSP 3 Score: 191.43 bits (485), Expect = 2.273e-50
Identity = 120/478 (25.10%), Postives = 220/478 (46.03%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID--------VPDCNVNCK---------------NAEESQ-----PIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            TALH A   G  DIVR+LV  +    IN  +++    ++ A      EIV+ L+      +   ++   PL  A   G++ +  LL++        +P  ++  +               NA+ +      P+H+A  +G+  +A LL+     ++   +   +P+  A   G   + KLL+     I+  TR    P+H A+  G  +V  ML++R   I  +T     P+ +A+   ++  V+LL+     +  +  +   P+HVA   G   V +LL+D     N        P+HIA +  R++++++LL+HGA  +       TP+++A+  GH +V ++L+ NG +    +++   P+H A + G  E+ + L+ S   +  +    Q P+H+A   G   IV+LL+  GS+   P  S   P+++A   G+ D+   L+ N   I        TPL +   +G  +  + L
Sbjct:   79 TALHIAALAGQTDIVRVLV--EFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLL 554          

HSP 4 Score: 190.66 bits (483), Expect = 4.144e-50
Identity = 118/457 (25.82%), Postives = 217/457 (47.48%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLV--SGKVQCK-INDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNI--KCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLS 1838
             T LH A   G++ + +LL+   G+   + +N  T      +H AC     +++E+L+     I+   +  + P+H A   G+  + QLL+     + N  N     P+H+A + G  E+ K L++    +    +++ +P+  A   G+ EI +LL+    D N  T +   P++FAS  G  +VA +L++   DI   T     P+ IAS    +E+  LL+  + +   K        P+HVA      +V  LL+D   + +        P+HIA++  ++E+ K+LLE GA+TN +      PL+LA ++GH D+  +L+    +I   +      +H A Q     +A++L      ++T       P+H+A   GN+ +V  L+ + + +    R+   P+H A + G+  ++ AL+ +  + +      +T L + +  GY   V  LS
Sbjct:  338 LTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTP-----LHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQ-NGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLS 788          

HSP 5 Score: 132.494 bits (332), Expect = 1.158e-31
Identity = 87/323 (26.93%), Postives = 154/323 (47.68%), Query Frame = 3
Query:  870 SMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            S      +  L A  +G +E     +    DIN   +     +H AS  G  +V   L+ R+ +I+  T +    + IA+     +IVR+L+    NI   +     P+++A Q+  +E+V+ L+DN  N + A +    P+ +A + G  ++V +LLE  +DT       R P L++A  K   + + +L+ +  N +  S   + P+H A   G   +A LL++   ++D    N   P+H+A   GN N+VKLL+D G+ ++   R    P+H A  +G+  +I+ L+  +  I  K     +PL +     +  CV  L
Sbjct:    6 SFQSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLE--SDTKGKV---RLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLL 323          

HSP 6 Score: 129.028 bits (323), Expect = 1.580e-30
Identity = 82/405 (20.25%), Postives = 178/405 (43.95%), Query Frame = 3
Query:  807 ACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHC-----------------------------NINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSS---------------------------------GNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A ++G+ E     ++   ++N+ N+   + +  A   G +++   L+  + +I+ +T+     +H A+  G T++  +L++   +I  ++     P+++A+  N++EIV+ L+ N  N     ++   P+ VA Q+G  +VV LL+++                               N +  +     P+HIA+  G + +  +LL  GA  +       TPL++A ++G+ ++ K+L+D G  I+ ++     P+H A ++G  ++ ++L++    I  +  N   P+H+A                                    G+  + KLL+D G        +   P+H AC+   + +++ L+ +  +IH    +  TP+ +    G+ + V  L
Sbjct:   18 AARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLL 422          

HSP 7 Score: 112.849 bits (281), Expect = 1.463e-25
Identity = 72/259 (27.80%), Postives = 125/259 (48.26%), Query Frame = 3
Query: 1104 ASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVR 1880
            A+ N N+E +   +    +I   N      +H+A ++G V+VV  L+     I+ A       +HIA+  G+ +IV++L+E GA+ N       TPLY+A ++ H ++ K L+DNG N    +   + P+  A Q G  ++  LL++S    DT+   +   +H+A    + N   LL+ H  N +   +S   P+H A   GN+++   L++   A+        TPL +    G ++ V  L   LD   +I  + R
Sbjct:   18 AARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLL---LDRGAKIDTKTR 269          
BLAST of SMED30013027 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.874 bits (455), Expect = 5.111e-46
Identity = 101/453 (22.30%), Postives = 209/453 (46.14%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + LH A Q  + + V++L+  + +  ++D T     A+H A         ++L+ K    N +      PLH AC      + +LL+     ++         P+H++   G+  I  +L++     N+ N +  + +  A  +GQ E+ + L+ N   ++   R ++ P+H A+ LG  E+  +L+      +  T     P+ +A+   + ++  +L+ +  ++     +   P+HVA + G +EV  LL+    + + A    + P+H+AS     ++  +LL+ GA  +       TPL++A +K   +++  L++ G      + +   P+H   Q G  ++A LL+  +  ++    +   P+HLA     +N+ ++LV HG+++    +    P+  AC  GN+ ++  L+ +   ++ K     TPL      G+   V+ L K
Sbjct:   40 LSPLHMATQGDHVECVQVLM--QYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKY-GASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLK 489          

HSP 2 Score: 172.17 bits (435), Expect = 1.228e-43
Identity = 111/450 (24.67%), Postives = 206/450 (45.78%), Query Frame = 3
Query:  687 MFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVS-FLSKVLDANREI------FHRVRHDDIVKFNELYDAHTLFV-LEYDTGLSVLEVAIGTRSSRIINYIL 2012
            + PLH A  +G++ + ++L++     +  K      P+H+A Q  H E  ++L++    ++ +     + +  A + G    AK+L+    + N        P+H A       V  +L+     IE  T     P+ +++   N+ IV +L+    +    N   E  +H+A + G  EVV+ L+ N   ++    +   P+HIA+  G++EIV++LL+H A  +   +   TPL++A  +GH DV+ +L+++G ++   + K + P+H A + G  E+A LL+    S D    N   P+H+A    N  +  LL+D G++     ++   P+H A +   L++   L+      +        PL L    G+ D  S  L++  D N          H    +D V   E+   H   V      G + L VA    + +++N++L
Sbjct:    7 LTPLHCAARSGHEQVVEILLE-QGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLL 455          

HSP 3 Score: 167.933 bits (424), Expect = 2.730e-42
Identity = 99/388 (25.52%), Postives = 178/388 (45.88%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID---VPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLL 1637
             T +H +   GN +IV +L+ G      N        A+H A  +   E+V  L+    +++ K  EE  PLH A   G   I QLL+     PD       +    P+H+A + GH ++  +L+E    +    K+ F+P+  A   G++E+A LL+      + + +    P+H AS     +VA +L+D+             P+ IA+  + +EI   L+        I  +   P+H+  Q+G  +V  LL+  + ++N A    + P+H+A++  +V + +IL++HGA  N       TPL +A   G+  +   L+ +G ++  ++   + P+H A Q G   I  LL+      +    N    + +A   G +++V  L
Sbjct:  139 LTPMHVSAFMGNLNIVLILLQGG--ASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDA----ATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 4 Score: 166.392 bits (420), Expect = 8.824e-42
Identity = 104/414 (25.12%), Postives = 186/414 (44.93%), Query Frame = 3
Query:  597 IHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID----VPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCV 1826
            +H A  S  E++VEIL+ +   I  K    + PLH A    +    Q+L+     V D  ++   A     +H+A   GH+  AK+L++K    N      F+P+  A    +I + +LL+     I   T +   P+H ++ +G   +  +L+          +     + +A+     E+VR L+ N   +     E + P+H+A + G +E+VQLL+ +  + + A      P+H+A+  G  ++  ILLEHGA          TPL++A++ G  +V+ +L+    + +        P+H A      ++A LL+D   S      N   P+H+A     L I   L+++G+      R    P+H   + G+ D+   L+     +   NHA+ + L  L     +D V
Sbjct:   10 LHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTA-----LHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADV---NHATKSGLSPLHLAAQEDKV 415          

HSP 5 Score: 159.844 bits (403), Expect = 7.944e-40
Identity = 102/417 (24.46%), Postives = 189/417 (45.32%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKA 1733
            FT LH AC++    ++ LL+  K    I   T+S    +H +    +  IV IL+      N  N      LH A   G   + + L+      V+ K  EE  P+H+A + G  EI +LL++     ++     ++P+  A   G  ++  +L+ +   +  +T+    P+H AS  G  EVA +L+ R    +        P+ +AS  +N ++  LL+    +          P+H+A +K  +E+   L++     N    + + P+H+ ++ G  ++  +LL   AD N       +PL+LA ++   +V+++L+ +G ++   +   + P+  AC  G  ++   L+     ++++  N   P+H A   G+ +IV LL      L+C  R N   +     NGN  L  A
Sbjct:  106 FTPLHIACKKNRIRVMELLL--KYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLR-NGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLL------LKCGARPNDVTV-----NGNTALAIA 508          
BLAST of SMED30013027 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 2.669e-43
Identity = 90/400 (22.50%), Postives = 185/400 (46.25%), Query Frame = 3
Query:  642 LIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
            L+ K    N +      PLH AC      + +LL+     ++         P+H++   G+  I  +L++     N+ N +  + +  A  +GQ E+ + L+ N   ++   R ++ P+H A+ LG  E+  +L+      +  T     P+ +A+   + ++  +L+ +  ++     +   P+HVA + G +EV  LL+    + + A    + P+H+AS     ++  +LL+ GA  +       TPL++A +K   +++  L++ G      + +   P+H   Q G  ++A LL+  +  ++    +   P+HLA     +N+ ++LV HG+++    +    P+  AC  GN+ ++  L+ +   ++ K     TPL      G+   V+ L K
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKY-GASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLK 399          

HSP 2 Score: 169.088 bits (427), Expect = 8.965e-43
Identity = 99/388 (25.52%), Postives = 178/388 (45.88%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLID---VPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLL 1637
             T +H +   GN +IV +L+ G      N        A+H A  +   E+V  L+    +++ K  EE  PLH A   G   I QLL+     PD       +    P+H+A + GH ++  +L+E    +    K+ F+P+  A   G++E+A LL+      + + +    P+H AS     +VA +L+D+             P+ IA+  + +EI   L+        I  +   P+H+  Q+G  +V  LL+  + ++N A    + P+H+A++  +V + +IL++HGA  N       TPL +A   G+  +   L+ +G ++  ++   + P+H A Q G   I  LL+      +    N    + +A   G +++V  L
Sbjct:   49 LTPMHVSAFMGNLNIVLILLQGG--ASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDA----ATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 3 Score: 160.999 bits (406), Expect = 2.662e-40
Identity = 102/417 (24.46%), Postives = 189/417 (45.32%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKA 1733
            FT LH AC++    ++ LL+  K    I   T+S    +H +    +  IV IL+      N  N      LH A   G   + + L+      V+ K  EE  P+H+A + G  EI +LL++     ++     ++P+  A   G  ++  +L+ +   +  +T+    P+H AS  G  EVA +L+ R    +        P+ +AS  +N ++  LL+    +          P+H+A +K  +E+   L++     N    + + P+H+ ++ G  ++  +LL   AD N       +PL+LA ++   +V+++L+ +G ++   +   + P+  AC  G  ++   L+     ++++  N   P+H A   G+ +IV LL      L+C  R N   +     NGN  L  A
Sbjct:   16 FTPLHIACKKNRIRVMELLL--KYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLR-NGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLL------LKCGARPNDVTV-----NGNTALAIA 418          
BLAST of SMED30013027 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003991.1 (pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1 gene:ENSPMAG00000003623.1 transcript:ENSPMAT00000003991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.081 bits (414), Expect = 3.614e-41
Identity = 125/493 (25.35%), Postives = 218/493 (44.22%), Query Frame = 3
Query:  513 GNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEI-VKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQ---------------------------------SIKKWRPIHNACQNGFCE-------------IAQLLVDSHC-----SIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTF-GYDDCVSF 1832
            G+ D VR L+  K +    D  K     +H A      EI+E+L+     +N K+++ + PLH AC + ++A  Q L+     +VN ++     P+H+A  +   + A+ +I      N  ++   + + +A  +G  E+   L+    +IN   +   R IH+A+ +G TEV  +L+    D+ C+      P+  ASS+  + +V+LL+    +I   N      +HVAC  G   VV  LID   N+N AN++   P+H A+ +    + +++L+ +GAD N      ++PL++    G +  S+ LI NG  I+C+                                  I    P+H A  +GF +             I     + H       IDT ++  +  +H A S GN+  + LL+  G+++   DR  +  +HYA  N N+  +  LV +   ++ ++    TPL       G    VSF
Sbjct:   17 GDPDEVRSLIYKKEEVNAVDDEK--RTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLK-HSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSF 506          

HSP 2 Score: 152.14 bits (383), Expect = 1.574e-37
Identity = 98/378 (25.93%), Postives = 177/378 (46.83%), Query Frame = 3
Query:  693 PLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEI-AQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDC 1823
            PL  A  NG+    + LI   +  VN  + E+  P+H A   G  EI +LL+     +NS + +  +P+  A  S      + L+ +  D+N   +  + P+H A+     + A  +I             R  +  A+ N + E+V  L+    NI   + ++ + IH A   G  EVV++L+ +  ++ C + K   P+H AS +G++ +VK+LL+ G D +   ++  T L++A   G   V   LID G N+   + + + P+H A  +    +  +LLV++   ++ ++ + + P+H+    G     + L+ +G  ++C DR    P+H A   G+  LI  L+ N      +      PL L    G+ DC
Sbjct:    9 PLIQAIFNGDPDEVRSLIYKKE-EVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDLGVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDC 385          

HSP 3 Score: 145.206 bits (365), Expect = 2.043e-35
Identity = 118/499 (23.65%), Postives = 218/499 (43.69%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEI-AKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVE-------------VVQLLIDNHC-----NINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQ------------------------NGFCEIAQLLVDSHCSIDTENDNKQK----PIHLACSSGNLNIVKLLVDHGSNLECPDRSNK--RPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            TALH+A   G+ ++V  LV+      IN   K   RAIH+A      E+V++L+    ++ CK+ +   PLH A ++G   + +LL+D+   +++  N+  +  +H+AC +G   +   LI+    +N  N++ F+P+ +A  S    +  +LL+ N  D+N  ++  + P+H  +  G    +  LI    +I+CE      P+ IA+   +  ++  LITN  +          P+H+A   GF +             +V    + H       I+  ++     +H A+  G VE + +LL  GAD N    + RT L+ A    +      L+ +G  +  Q  ++  P+H A                          +  C  AQ+ ++     D +   + K    P+H A + G+   ++LL++     +   +S     P+H A  +G+   ++ L+ +   +  +     TPL L    G+ DCV  L
Sbjct:  140 TALHHAAFNGHSEMVNFLVAKGAN--INAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLLDL-GVDIDDPNSFGNTALHVACYNGQDVVVNELIDCGANVNQANERGFTPLHFAAASTHGALCLELLVNNGADVNVQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCEDRDGNTPLHIAARYGHELLINTLITNGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSAGQKYSIVSSFSNEHVLSAGFEIDTPDEFGRTCLHAAASGGNVECLNLLLSTGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVL 635          

HSP 4 Score: 126.331 bits (316), Expect = 1.408e-29
Identity = 115/489 (23.52%), Postives = 205/489 (41.92%), Query Frame = 3
Query:  486 TALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACT-NGNKAIA----------QLLIDV----------------PDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNK--QEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRR-PIFIASSNNNVEIVRLLITNHCNIKCIN--DENEQ-PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLID----NGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDS--------------HCSIDTENDN--------------------KQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALV 1739
            T LH A   GN + + LL+S      +N   +    A+H+A  + + + V  L+     +N +++    PLHYA   +G+ +            Q  IDV                 D +   ++ +   P+H A  +GH    +LL+E+     S  K     SP+  A   G     ++LI +  D++        P+  A+  G T+   +LI     +  +    RR  +  A++N +VE +RLL+ N  + + ++  D NEQ P+ +A   G  +   LL+    +IN  ++K    +H  +  G  E V +LL+   D +      R PL++A   GH  +   L+     +G  I       + P+H AC NG     +LL++               HC++  +N++                     + P+H A  + ++  ++LL+ H + +   D + K P+  ACENG    ++ LV
Sbjct:  423 TCLHAAASGGNVECLNLLLS--TGADMNKKDRFERTALHYAAANCNVQCVVTLVASGARLNEQDERRCTPLHYAAAADGDGSTVSFSVYNTISVQSYIDVHSTCSEAQICLEHLLRKDADPGIQDKQGYTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLV 909          

HSP 5 Score: 114.005 bits (284), Expect = 1.006e-25
Identity = 98/447 (21.92%), Postives = 185/447 (41.39%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIE---KNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLI----TNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDN--------------HCN--------------------INCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNG-CNIECQSIKKWRPIHNACQNGF---CEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRP 1688
            +T +HYA   G+   + LL+      + +  +      +H A        +E+LI    +++ +      PL  A   G+    ++LI      +  +  +    +H A  +GH E  +LL+E    N  +++ +  E +P++ A+ +G  + A LL++    IN         +H  +  G  E   +L+ R  D+       R P+ +A++  ++ I+  L+     +   I   +     P+H AC  G    V+LL++               HC                     INC + K   P+H A+    VE +++LL H A  N      ++PL +A E G     +VL+++   +++ Q   +   +H AC         +    +D    I+  N   Q P+HLA  SG   +V++L++ G+++   D +   P
Sbjct:  549 YTPVHYAAAYGHRVCLELLLEQPGAFQSDGKSGHPISPLHLAAYHGHHGALEVLIRSLVDLDVREGNGYTPLGLAALRGHTDCVRVLIQHGASVLLKEGPDRRTALHSAATNGHVECLRLLVENADSNEAVDASDANEQTPVMLAVGNGHTDCASLLLSKGASINAKDNKGCTALHRGAATGHEECVDLLLQRSVDVSLRERRGRAPLHMAAACGHMGILSALVQAAMASGAPIPLTDRNGYTPLHWACYNGHDGCVELLLELDVFQKQEGNAFSPLHCAVLNDNESCAEMLIDTFGAKIINCPDAKGRMPLHAAAFTDHVECLQLLLSHNALVNVTDMAGKSPLMMACENGQATAVEVLVNSTKTDLKLQDANRNTALHLACSRSHETCALLILDKLDDLNLINATNAALQTPLHLAARSGMATVVQVLLNKGASILAVDHNGYTP 995          

HSP 6 Score: 105.916 bits (263), Expect = 2.735e-23
Identity = 59/219 (26.94%), Postives = 108/219 (49.32%), Query Frame = 3
Query: 1083 KRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALV 1739
             + P+  A  N + + VR LI     +  ++DE   P+H A   G  E+++LL+ +   +N  ++K + P+H A  +     V+ LL+H AD N      +TPL++A        ++ +I    +           +H+A  NG  E+   LV    +I+  +   ++ IH A   G+  +VK+LV HG+++ C D+    P+H A  +G + ++K L+
Sbjct:    6 SQAPLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARDKNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLLL 224          

HSP 7 Score: 81.2629 bits (199), Expect = 1.039e-15
Identity = 55/219 (25.11%), Postives = 104/219 (47.49%), Query Frame = 3
Query: 1182 NEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWR-PIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            ++ P+  A   G  + V+ LI     +N  +D+   P+H A+  G  EI+++L+  GA  N       TPL+ A         + L+ +  ++  +  K W+ P+H A  N   + A+ ++    S +  +   +  +H A  +G+  +V  LV  G+N+   D+ ++R IH+A   G+ +++K LV +   + CK+    +PL    + G    V  L
Sbjct:    6 SQAPLIQAIFNGDPDEVRSLIYKKEEVNAVDDEKRTPLHAAAYLGEAEIIELLVLSGARVNSKDNKWLTPLHRACASRSEAAVQTLLKHSADVNARD-KNWQTPLHVAAANRAVKCAEAIIPMLSSSNVSDRAGRTALHHAAFNGHSEMVNFLVAKGANINAFDKKDRRAIHWAAYMGHTEVVKVLVAHGADVRCKDKKGYSPLHAASSSGQIGVVKLL 223          
BLAST of SMED30013027 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 60.8474 bits (146), Expect = 1.061e-9
Identity = 35/98 (35.71%), Postives = 57/98 (58.16%), Query Frame = 3
Query: 1194 IHVACQKGFVEVVQLLIDNHC-NINCANDKLMKPIHIASENGRVEIVKILLEHGADTN--CICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIK 1478
            + +AC KG  +VV+ +I+    +IN  ++     +H A+  G +EIV++L+E+GAD N   I  +  TPL  A+  GH DV K L+ NG +   ++ K
Sbjct:  334 LQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAK 431          
BLAST of SMED30013027 vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 60.077 bits (144), Expect = 1.982e-9
Identity = 55/243 (22.63%), Postives = 104/243 (42.80%), Query Frame = 3
Query:  993 PIHFASTLGFTEVAHMLIDRQC--DIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYART------PLY------------LATEKGHYDVSKVLIDNGCNI-ECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNL 1658
            P+H+A+ LG  E  H L+      D++      + P+ +A +NN++++VR L+T       I   N  PI            + ++D   N+  +      P+++A +    +  K+LLE  +  N      ++      PL+            +A   G   + ++LI  G +  E     KW PI  A ++G  E+   L+  +  +D E+DN   P+  A    +++++  L+    NL
Sbjct:  427 PLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLT-------IGGANASPIE-----------KPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNL 651          
BLAST of SMED30013027 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 56.9954 bits (136), Expect = 3.001e-9
Identity = 34/124 (27.42%), Postives = 58/124 (46.77%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEK 854
            +T  H AC  GN ++V+ L    ++  +N  T      +H A   +  E+ + LI     +  K+     PLH A + G+  + +LL  +    VN ++ +   P+  A   GH + A LL+EK
Sbjct:   73 WTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEK 196          

HSP 2 Score: 54.299 bits (129), Expect = 2.270e-8
Identity = 42/157 (26.75%), Postives = 73/157 (46.50%), Query Frame = 3
Query: 1191 PIHVACQKGFVEVVQLLIDNHCNINC---ANDKLMKPIHIASENGRVEIVKILLEH--GADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVD-SHCSIDTENDNKQKPIHLACSSGNLNIVKLLVD 1643
            P+H +      E+   L+    N+N     +D    P HIA   G +E+VK L +     D N I     T L+LA  K  ++VS+ LI+NG ++  +      P+H A   G  ++ +LL      +++ ++     P+  A + G+ +   LLV+
Sbjct:   39 PLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          

HSP 3 Score: 51.6026 bits (122), Expect = 1.834e-7
Identity = 45/192 (23.44%), Postives = 84/192 (43.75%), Query Frame = 3
Query:  492 LHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKN---DEEMFPLHYACTNGNKAIAQLLIDVP-DCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLI-TNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDR 1052
            LH AC +     V+ L+  K    +    +     +H++   ++ EI   L+ K   +N  +   D    P H AC+ GN  + + L D P   ++N    +    +HLA     FE+++ LIE    +   +K    P+  A + G +++ +LL    K  +N   +    P+  A   G  + A +L+++
Sbjct:    6 LHQACMENEFFKVQELLHSKPSLLLQK-DQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEK 196          

HSP 4 Score: 50.447 bits (119), Expect = 3.906e-7
Identity = 38/158 (24.05%), Postives = 67/158 (42.41%), Query Frame = 3
Query: 1380 ARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKK---WRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQ--KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVH-NNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             R PL+ +     ++++  L+    N+          W P H AC  G  E+ + L D     D      Q    +HLA       + + L+++G+++   D+ N+ P+H A   G+L LI+ L      A++ ++    TPL      G+ D    L
Sbjct:   36 GRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLL 193          
BLAST of SMED30013027 vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 58.151 bits (139), Expect = 8.024e-9
Identity = 52/254 (20.47%), Postives = 107/254 (42.13%), Query Frame = 3
Query:  765 VNCKNAEESQPI----HLACQHGHFEIAKLLIE-KNCEMN--SMNKQEFSPILYALNSGQIEIAKLLITNKCDINC-STRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITN-----HCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGH-YDVSKVLIDNGCNIECQSIKKW 1484
            VN  +  E  P+    H ACQ G     K +I  K  E+N    + +  + + +A  + ++ +   L++   D+N  +      P+H+A+  G+  +   L+    D           + ++ +++N+ +V  ++ N       +I C + +    +  A  +G    V  L+    +I  A+ +   P+H  +  G+  ++K L++ GAD        +    +A E    Y + + L  +G +     IKKW
Sbjct:   62 VNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLREALTHSGFDYHGYPIKKW 315          
BLAST of SMED30013027 vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 51.2174 bits (121), Expect = 9.705e-7
Identity = 49/223 (21.97%), Postives = 99/223 (44.39%), Query Frame = 3
Query:  984 QERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCIND-ENEQPIHVACQKGFVEVVQLLIDN-HCNINCANDKLMKPIHIASENGRVEIVKILLEHGA-DTNCICT-YARTPLYLATEKGHYDVSKVLIDNGCNIEC-QSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLL 1637
            +  P+H++   G +EV  ++I          ++K   I+     N + I         ++    D E+  P+H+       +  ++L+ +   N+   +  L+   H+A+E     ++ +LL     D N        TPLYLA     ++ +  L+ NG ++E  + +  W  I  A   GF +I +LL+ ++ + D E++    P+  A   G+L+I  ++
Sbjct:  428 KRTPLHYSCQYGLSEVTKLII---------KLMKEWNIW-----NEIPI--------DDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQSLDPNVKLKSSSLL---HLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMV 625          

HSP 2 Score: 50.8322 bits (120), Expect = 1.396e-6
Identity = 46/200 (23.00%), Postives = 84/200 (42.00%), Query Frame = 3
Query:  480 KFTALHYACQQGNHDIVRLLVSGKVQC------KINDATKSAN----RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAE-ESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQ-EFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHML 1043
            K T LHY+CQ G  ++ +L++    +        I+D +   +      +H   +    +  E+L+ +  + N K       LH A    N  +  +L+     ++N ++ E    P++LAC+   FE A  L+    ++    K   ++ I  A   G  +I KLLI N  + +        P+  A   G   +A M+
Sbjct:  428 KRTPLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLL-QSLDPNVKLKSSSL-LHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMV 625          
BLAST of SMED30013027 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 142.51 bits (358), Expect = 6.851e-36
Identity = 123/440 (27.95%), Postives = 202/440 (45.91%), Query Frame = 3
Query:  579 KSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCN---------VNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMN----SMNKQEFSPILYALNS--GQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNI--KCINDEN--------------------EQPIHVACQK----GFVE-----------VVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHG-ADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALV 1739
            K+    +H AC      + + L+    ++   ++E+M PLH+AC  GN  +A+LL    +           V  ++ EE   +HLA + GH ++AKL +EK   +N    S NK     I+ A       I+++KL   + C      R  E  ++F   +    + +++  R C IEC    K  P+ IA+  N+V+ VR L+ +  +I  K IND N                    ++P+   C      G V              QLL+DN   I+  ND+ + PIH A++ GRV  V  LL+   A  N     + TPL+LA   GH  V K L+  G  I+ ++   W P+  A   G  E+A +L+D    +D  +  K  P+HLA   G++ +VKLL+   +N+   D + +  +  A E+ + ++  A++
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKR--EILLYFFDVVII--ICYIIRFRAC-IECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAII 436          

HSP 2 Score: 94.3597 bits (233), Expect = 4.771e-20
Identity = 91/414 (21.98%), Postives = 179/414 (43.24%), Query Frame = 3
Query:  684 EMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLI---EKNCEMNSMNK-------QEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSN-----------NNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCIC--------TYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCE-IAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            +M PLH AC++G   +A+ L++    ++   + E+  P+H AC  G+  +AKLL    E     ++++K       +E + +  A+  G  ++AKL +    ++N    ++ +  H            +++ R+C      + K + +    S            + V I+  +I     I+C + + + P+ +A +K  V+ V+ L+ +  +I   +      +  A+  G +E ++  LEH      IC              L L         S++L+DNG  I+ ++ +   PIH A + G    +  LL      I+ E+     P+HLA   G+  +VK L+  G  ++  + +   P+  A   G +++   L+  +  +   + A +TPL L    G+ + V  L
Sbjct:    4 QMTPLHVACSHGCIPVAKCLVEA-GADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKT----------IVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRIS----SQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLL 402          

HSP 3 Score: 75.8702 bits (185), Expect = 4.319e-14
Identity = 75/403 (18.61%), Postives = 147/403 (36.48%), Query Frame = 3
Query:  480 KFTALHYACQQGNHDIVRLLVSGK--------VQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCN----------------------------------VNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEI-------------------------------------AKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQ-CDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDN 1448
            + T LH+AC +GN  + +LL            V   + D  +    A+H A      ++ ++ + K   +N   + +    H       + I  ++I V                                      + C++ ++  P+ +A +  H +  + L++   ++ + +  + + +  A   G +E                                      ++LL+ N   I+        PIH+A+  G       L+ R    I  E      P+ +A+ + +  +V+ L+     I   N     P+  A  +G VEV  +L+D    ++  +     P+H+AS  G VE+VK+LL   A+     +  R  L +A E  H +V+  +ID+
Sbjct:   37 QMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIF-VMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          
BLAST of SMED30013027 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 80.4925 bits (197), Expect = 2.972e-16
Identity = 59/228 (25.88%), Postives = 109/228 (47.81%), Query Frame = 3
Query: 1095 IFIAS-SNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSI--KKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKN 1769
            +F+++ S+ +V+ V+ L+    +I   N +    +H AC     ++V++L+D   +++  +++    +H A+  G VEI K L+E+GAD   +      PL LA E+   D+  +L D    IE Q I     R +           AQ  ++ +C  ++++  +   +H+A S G L ++ LL+  G  +   D  N  P+H A   G  D  + L  N    + +N
Sbjct:   52 VFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEE---DMEDLLTD---EIENQGIDVDDARAVEEKI---MLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARN 270          

HSP 2 Score: 67.3958 bits (163), Expect = 6.436e-12
Identity = 50/217 (23.04%), Postives = 95/217 (43.78%), Query Frame = 3
Query:  897 ILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNH----------------------CNINCANDKLMK----PIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQ 1469
             L A++SG ++  K L+    DIN         +H A      ++  +L+D+   ++         +  A+S  +VEI + LI N  ++  +N+E E P+ +A ++   +++   I+N                        N NC N+   K     +H+AS  G ++++ +LL+ G + N       TPL+ A   G  D  ++L +NG +   +
Sbjct:   53 FLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNAR 269          

HSP 3 Score: 66.6254 bits (161), Expect = 9.374e-12
Identity = 54/232 (23.28%), Postives = 107/232 (46.12%), Query Frame = 3
Query:  588 NRAIHFACMSESEEIVEI--LIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKC-DINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCAN 1274
            N  I F     S ++ E+  L+ K  +IN +N + +  LH AC + N  + ++L+D    +++ ++ E    +H A   G  EIAK LIE   ++ ++N +   P+  A      ++    I N+  D++ +   +E+ +           A   +++ C  E +   +   + +ASS   ++++ LL+     I   + +N  P+H A   G  +  +LL +N  + N  N
Sbjct:   48 NSGIVFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVD-KGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIM--------LNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARN 270          

HSP 4 Score: 64.6994 bits (156), Expect = 4.246e-11
Identity = 53/206 (25.73%), Postives = 88/206 (42.72%), Query Frame = 3
Query: 1302 ASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVK--------------------LLVDHGSNL------ECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
            A  +G V+ VK LL  GAD N       T L+ A    ++D+ KVL+D G +++ +  + W  +H A   G  EIA+ L+++   +   N+  + P+ LA      +++                     +L D  S L      E  D++    +H A   G L +I  L+     I+ K+  + TPL     +G  D    LS+
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSE 261          

HSP 5 Score: 61.2326 bits (147), Expect = 5.872e-10
Identity = 50/191 (26.18%), Postives = 79/191 (41.36%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNG-----NKAIAQLLIDVPDC----------------NVNC----KNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTR 980
             TALH AC   N D+V++LV       + D       ++H A    S EI + LI    ++   N+E   PL  A            I    IDV D                 N NC    K+  E+  +H+A   G+ ++  LL++   E+N+ +   ++P+  A + GQ +  +LL  N  D N   +
Sbjct:   83 LTALHQACIDENFDLVKVLVDKGASMDVRD--NEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          
BLAST of SMED30013027 vs. Ensembl Nematostella
Match: EDO38725 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC11])

HSP 1 Score: 78.5666 bits (192), Expect = 3.373e-16
Identity = 59/218 (27.06%), Postives = 104/218 (47.71%), Query Frame = 3
Query: 1104 ASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            A+  N VE +  LI N      I D +  P+HVAC+KG +EV +LL++    ++  NDK   P+H+A+  G  + +K LL  G   +      RTP   A   G  + + +L++   N       +  P+H AC  G     + L  +  S +  ++  Q  +H+A  SG   +V  L+ +G+++   D +   P+  A + G++     L+ +  +I
Sbjct:   15 ATRYNRVEAMAELIRN----GSIEDLS-TPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKDEN-------QKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 2 Score: 75.485 bits (184), Expect = 3.983e-15
Identity = 54/207 (26.09%), Postives = 98/207 (47.34%), Query Frame = 3
Query: 1170 INDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            ++D     +H A +   VE +  LI N      + + L  P+H+A + G +E+ ++L+E GA  +       TPL++A   G +D  K L+  G  I+ +      P  +A   G  E A LL++       +++N++ P+HLAC++G    V+ L   G +    D   +  +H A  +G   ++  L+     I+ ++    TPL
Sbjct:    4 MDDTGFSALHHATRYNRVEAMAELIRNG-----SIEDLSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLE-------KDENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPL 198          

HSP 3 Score: 72.4034 bits (176), Expect = 4.637e-14
Identity = 57/232 (24.57%), Postives = 106/232 (45.69%), Query Frame = 3
Query:  663 INCKNDEEMFPLHYACT-NGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGA 1355
            +N  +D     LH+A   N  +A+A+L+        N    + S P+H+AC+ G  E+ +LL+EK   ++  N +  +P+  A   G  +  K L++    I+    +   P   A   G TE A +L+++  +       ++ P+ +A +      V  L     +    ++E +  +H+A   GF +VV  L+    +IN  +     P+  A++ G V+    LL+ GA
Sbjct:    1 LNKMDDTGFSALHHATRYNRVEAMAELI-------RNGSIEDLSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEKDEN-------QKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGA 218          

HSP 4 Score: 68.1662 bits (165), Expect = 1.221e-12
Identity = 54/222 (24.32%), Postives = 99/222 (44.59%), Query Frame = 3
Query:  798 IHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQ-PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNI 1460
            +H A ++   E    LI +N  +  ++    +P+  A   G +E+ +LL+     ++      E P+H A+ +G  +    L+ +   I+      R P   A +    E   LL+          DEN++ P+H+AC  G    V+ L     + N  +++    +H+A+ +G  ++V  LL +GAD N   +   TPL  A + G       L+ +G +I
Sbjct:   12 LHHATRYNRVEAMAELI-RNGSIEDLS----TPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLSKGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK--------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          

HSP 5 Score: 53.5286 bits (127), Expect = 1.057e-7
Identity = 51/227 (22.47%), Postives = 95/227 (41.85%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNI 1163
            F+ALH+A +    + +  L+        N + +  +  +H AC   S E+  +L+ K   ++ KND+   PLH A   G+    + L+      ++ ++     P   A   G  E A LL+EK       ++ + SP+  A  +G+    + L       N      +  +H A+  GF +V   L+    DI      +  P+  A+   +V+    L+ +  +I
Sbjct:    9 FSALHHATRYNRVEAMAELIR-------NGSIEDLSTPLHVACKKGSMEVGRLLVEKGAALDKKNDKGETPLHMAACIGSFDALKFLLS-KGVAIDERDFSHRTPFLSAVAAGRTENAMLLLEK-------DENQKSPLHLACAAGRALHVEALTRAGLSTNERDEEGQSALHMAALSGFRKVVTQLLRYGADINARDSNRWTPLMCAAKTGSVKTCMELLQSGASI 220          
BLAST of SMED30013027 vs. Ensembl Nematostella
Match: EDO49485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG84])

HSP 1 Score: 78.1814 bits (191), Expect = 5.843e-16
Identity = 54/221 (24.43%), Postives = 106/221 (47.96%), Query Frame = 3
Query: 1188 QPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGF-CEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKR----PIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            QP+H+AC  GF E  + L+    ++N  ++    P+H A+ +G V  +++L+    D NCI    R PL+ A    ++     L+  G N+     K   P+H A  +    +  + L+ +  +    +      +H A ++G+   +++L+D  +N +  +RS+      P+H A  +G+   ++ L+ +   +  ++    TPLDL    G+ +CV  L
Sbjct:    2 QPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSAN-DLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECL 221          

HSP 2 Score: 74.7146 bits (182), Expect = 8.846e-15
Identity = 52/223 (23.32%), Postives = 104/223 (46.64%), Query Frame = 3
Query:  792 QPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPI-FIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNI---NCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDN 1448
            QP+HLAC  G  E  K L+    ++N+ +  + +P+  A  SG +   +LL++   D NC  +    P+H+A+          L+    ++         P+ + A+S+ + + V  L+ N  N    + +    +H A   G    +++L+D   N      +    + P+H+A+ +G    +++L++   D        RTPL LA+ +GH +  + L+++
Sbjct:    2 QPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNH 224          

HSP 3 Score: 69.3218 bits (168), Expect = 5.632e-13
Identity = 59/256 (23.05%), Postives = 109/256 (42.58%), Query Frame = 3
Query:  591 RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSG-QIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGA 1355
            + +H AC+    E  + L+    ++N K++ +  PLH A  +GN    +LL+     + NC +     P+H A  H +F     L+     +N  + +  +P+ YA  S    +  + L+ N+ + +   +     +H+AS  G      ML+D                   S+N+       L+       C+      P+H+A   G    +++LI +  ++   +D+   P+ +AS  G VE V+ LL H A
Sbjct:    2 QPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAG-DFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLD------------------VSAND-------LLNRSSGSPCV-----TPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNHNA 226          

HSP 4 Score: 67.781 bits (164), Expect = 2.084e-12
Identity = 52/223 (23.32%), Postives = 99/223 (44.39%), Query Frame = 3
Query:  990 RPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENG-RVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNI---ECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDH 1646
            +P+H A   GFTE    L+    D+  +    R P+  A+ + NV  + LL++   +  CI+     P+H A        V  L+    N+N  + K   P+H A+ +    + V+ LL +  + +       + ++ A+  GH    ++L+D   N             P+H A  +G     ++L+ S   ++  +D  + P+ LA   G++  V+ L++H
Sbjct:    2 QPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLLNH 224          

HSP 5 Score: 53.5286 bits (127), Expect = 1.055e-7
Identity = 46/190 (24.21%), Postives = 81/190 (42.63%), Query Frame = 3
Query: 1284 MKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSG-NLNIVKLLVDHGSNLECPDRSNKRPIHYACENGN---LDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
            M+P+H+A   G  E  K LL +G D N      RTPL+ A   G+ +  ++L+    +  C       P+H A  +        LV +  +++  +     P+H A +S  +   V+ L+ +  N    D+     +HYA  NG+   ++++  +  N+           TPL L    G+   +  L K
Sbjct:    1 MQPLHLACLGGFTECCKKLLFYGVDVNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLVTAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIK 190          

HSP 6 Score: 53.5286 bits (127), Expect = 1.270e-7
Identity = 56/222 (25.23%), Postives = 94/222 (42.34%), Query Frame = 3
Query:  492 LHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHG-HFEIAKLLIEKNCEMNSMNKQEFSPILYALNSG-QIEIAKLLITNKCDI--NCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLI 1145
            LH AC  G  +  + L+   V   +N    +    +H A  S +   +E+L+ +  + NC +     PLHYA  + N      L+     NVN  + +   P+H A       +  + L+      +  +KQ +S + YA  +G ++ I  LL  +  D+    S      P+H A+  G      +LI    D+E      R P+ +AS   +VE V  L+
Sbjct:    4 LHLACLGGFTECCKKLLFYGVD--VNAKDNNDRTPLHCAACSGNVNCLELLMSQAGDFNCIDKLGRNPLHYAAGHTNFRCVMSLV-TAGSNVNKPDTKACTPLHYAAASDLDAKCVEHLLRNRGNASKRDKQGYSAVHYASANGHKLAIEMLLDVSANDLLNRSSGSPCVTPLHLAAFHGHKPALEVLIKSFNDLEVRDDRGRTPLDLASFQGHVECVECLL 222          
BLAST of SMED30013027 vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 70.0922 bits (170), Expect = 5.329e-14
Identity = 42/152 (27.63%), Postives = 77/152 (50.66%), Query Frame = 3
Query: 1194 IHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYA---RTPLYLATEKGHYDVS-KVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTEN-DNKQKPIHLACSSGNLNIVKL 1634
            +H A + G  + ++LL+ +   +N       +PIH A+ NG  E V++LL +G+  N          TPL+ A   GH D + ++L++ G ++E      WR IH A  NG  ++   L+D+   I+++  + +   +H+A   G + +  L
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          

HSP 2 Score: 57.3806 bits (137), Expect = 1.525e-9
Identity = 43/153 (28.10%), Postives = 70/153 (45.75%), Query Frame = 3
Query:  696 LHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQ---EFSPILYALNSGQIEIA-KLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKR-RPIFIASSNNNVEIVRL 1139
            LHYA   GN+   +LL+      +N       +PIH A  +GH E  ++L+      N+   +     +P+ YA   G ++ A ++L+    D+    R   R IH AS  G  +V   L+D   DIE +T  +R   + +A+    V +  L
Sbjct:    1 LHYAARYGNEKCIELLLK-SGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          

HSP 3 Score: 56.9954 bits (136), Expect = 1.884e-9
Identity = 41/147 (27.89%), Postives = 74/147 (50.34%), Query Frame = 3
Query:  996 IHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLIT--NHCNIKCIND-ENEQPIHVACQKGFVE-VVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYAR--TPLYLATEKGH 1418
            +H+A+  G  +   +L+     +        RPI  A+ N + E VR+L+   +H N K      N  P+H A + G ++  V++L++   ++        + IH+AS+NGRV+++  LL+ G D     TY R  T +++A  +G 
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESK-TYERRLTAVHVAARQGQ 146          

HSP 4 Score: 48.521 bits (114), Expect = 1.664e-6
Identity = 34/148 (22.97%), Postives = 75/148 (50.68%), Query Frame = 3
Query:  597 IHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQ---PIHLACQHGHFEIA-KLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQER---PIHFASTLG 1019
            +H+A    +E+ +E+L+    ++N        P+H A  NG+    ++L+     + N K  +  +   P+H A + GH + A ++L+E+  ++ ++ +  +  I  A ++G++++   L+    DI   ++T ER    +H A+  G
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRY-GSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDI--ESKTYERRLTAVHVAARQG 145          

HSP 5 Score: 48.521 bits (114), Expect = 1.976e-6
Identity = 39/154 (25.32%), Postives = 69/154 (44.81%), Query Frame = 3
Query:  492 LHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDE---EMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMN-KQEFSPILYALNSGQIEIAKL 941
            LHYA + GN   + LL+  K   K+N   +   R IH A M+   E V +L+      N K  +    M PLHYA   G+   A  ++     ++     +  + IH+A  +G  ++   L++   ++ S   ++  + +  A   GQ+ +  L
Sbjct:    1 LHYAARYGNEKCIELLL--KSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          
BLAST of SMED30013027 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 214.542 bits (545), Expect = 7.284e-56
Identity = 116/453 (25.61%), Postives = 219/453 (48.34%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSK 1841
             + +H A Q  + D VR L+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +     LL+     ++         P+H+A   GH  I K L+++    N+ N +  +P+  A  +G  E+A+ L+ N   ++   +  + P+H A+ +G  E+  +L+D + + +  T     P+ IA+   ++  +R+L+        +  +   P+HVA + G V+V +LL++   N N A    + P+H+A  +  +++VK+L+  G   +       TPL++A ++   +V+ VL+ NG +  C+S++   P+H A Q G  ++  +L+    +++  N N   P+HL    G++ I   LV  G+++    R    P+H AC  GN+ ++K L+     ++ K     TPL      G+ D V+ L K
Sbjct:  304 LSPIHMAAQGDHMDCVRQLL--QYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKH-SASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLK 753          

HSP 2 Score: 201.445 bits (511), Expect = 8.738e-52
Identity = 119/451 (26.39%), Postives = 216/451 (47.89%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A    N  + +LL++      +N   K+    +H A    +  +V +L+ +  +I+ +  +E+ PLH A  NG+  I ++L++     +  K      PIH+A Q  H +  + L++ N E++ +     +P+  A + G   +AK+L+      N        P+H A          +L+     +E  T     P+ +A+   ++ IV+ L+    +    N + E P+H+A + G  EV Q L+ N   ++        P+H A+  G  E+VK+LL+H A+ +   T   TPL++A  +GH    ++L+D G      + K + P+H A + G  ++A+LL++   + +    N   P+H+A    NL++VKLLV  G +     R+   P+H A +   +++   L+ N  + +C++    TPL L    G  D V+ L
Sbjct:  205 FTPLHIAAHYENMSVAQLLLNRG--ANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEH-GAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAML 652          

HSP 3 Score: 193.356 bits (490), Expect = 2.371e-49
Identity = 120/478 (25.10%), Postives = 221/478 (46.23%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYD 1916
             T LH A   G+H + ++L+      K N    +    +H AC       +++L+     +    +  + PLH A   G+  I + L+     + N  N +   P+H+A + GH E+A+ L++   ++++  K + +P+  A   G  E+ KLL+ +K + + +T     P+H A+  G      +L+D        T     P+ +AS    V++  LL+    N          P+HVA     ++VV+LL+    + +        P+HIA++  ++E+  +LL++GA  NC      TPL+LA+++G  D+  +LI    N+   +     P+H   Q G   IA  LV    S+   +     P+H+AC  GN+ +VK L+   +++    R    P+H A + G+ D++  L+ +    +      ++PL + K  GY   +  L  V + +    HR+   + V  +E+ D
Sbjct:  337 LTPLHVAAHCGHHRMAKVLLDKG--AKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQR-GASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLKLVTEESVST-HRMSFPETV--DEILD 808          

HSP 4 Score: 177.178 bits (448), Expect = 2.566e-44
Identity = 113/452 (25.00%), Postives = 215/452 (47.57%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIV-RLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
               LH A ++G+  +V  LL SG    ++   TK  N A+H A ++  E++V  L+     +N ++ +   PL+ A    +  + + L++    N +    +   P+ +A Q GH  +  LLI    +     K     +  A  +     A +L+ N  + +  ++T   P+H A+      VA +L++R  ++         P+ IAS   NV +VRLL+     I     +   P+H A + G V ++++L+++   I       + PIH+A++   ++ V+ LL++ A+ + I     TPL++A   GH+ ++KVL+D G     +++  + P+H AC+        LL+    S++   ++   P+H+A   G+LNIVK L+  G++    +   + P+H A   G+ ++ + L+ N   +  +     TPL      G+ + V  L
Sbjct:   44 LNGLHLASKEGHVKMVLELLHSG---IELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLEN-GANQSLPTEDGFTPLAVALQQGHENVVALLINYGTK----GKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLL 487          

HSP 5 Score: 141.354 bits (355), Expect = 2.774e-33
Identity = 123/550 (22.36%), Postives = 218/550 (39.64%), Query Frame = 3
Query:  762 NVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEM---------------------------------NSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLID----------------RQCDIECETILKR-------------RPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL---SKVLDA----NREIFH---RVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERV--LLIQECFLHRSICDNDSTSFARFCLRSVVNRNVL 2189
            N+N  N      +HLA + GH ++   L+    E+                                 N+ + + FSP+  A     +E+ K L+ N  + +  T     P+  A   G   V  +LI+                R  D     +L +              P+ IA+   N+ + +LL+    N+         P+H+A ++G V +V+LL+D    I+      + P+H A+ NG V I++ILLEHGA          +P+++A +  H D  + L+     I+  ++    P+H A   G   +A++L+D     +    N   P+H+AC   ++  + LL+ H ++LE    S   P+H A   G+L+++K L+    + +  N    TPL +    G+ +   FL   +  +DA    ++   H   R+ H ++VK   L D           G + L +A        I  +LD     Q+++  K       +  +   + + E  L R    N +       L   V+ N L
Sbjct:   35 NINIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKL--LLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLD--AGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNL 580          

HSP 6 Score: 130.568 bits (327), Expect = 6.067e-30
Identity = 73/317 (23.03%), Postives = 158/317 (49.84%), Query Frame = 3
Query:  807 ACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            A + G+ + A   I+    +N  N+   + +  A   G +++   L+ +  ++  +T+     +H A+  G  +V   L++   ++  ++     P+++A+  N++E+V+ L+ N  N     ++   P+ VA Q+G   VV LLI    N        +  +HIA+ N       +LL++  + + +     TPL++A    +  V+++L++ G N+         P+H A + G   + +LL+D    ID +  ++  P+H A  +G++ I+++L++HG+ ++   ++   PIH A +  ++D ++ L+  N  I
Sbjct:   17 AARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLI----NYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEI 329          

HSP 7 Score: 91.2781 bits (225), Expect = 5.934e-18
Identity = 61/258 (23.64%), Postives = 116/258 (44.96%), Query Frame = 3
Query: 1104 ASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCS---------IDTENDNKQ--------------------KPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
            A+ + N++     I N  NI   N      +H+A ++G V++V  L+ +   +     K    +HIA+  G+ ++V  L+ +GA+ N       +PLY+A ++ H +V K L++NG N    +   + P+  A Q G   +  LL++             I   ND+ +                     P+H+A    N+++ +LL++ G+N+    ++   P+H A   GN+ +++ L+     I  +     TPL
Sbjct:   17 AARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPL 274          

HSP 8 Score: 53.5286 bits (127), Expect = 1.914e-6
Identity = 35/152 (23.03%), Postives = 66/152 (43.42%), Query Frame = 3
Query: 1380 ARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A T    A   G+ D +   I NG NI   +      +H A + G  ++   L+ S   ++         +H+A  +G   +V  LV++G+N+         P++ A +  +L+++K L+ N            TPL +    G+++ V+ L
Sbjct:   10 AATSFLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALL 161          
BLAST of SMED30013027 vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 200.29 bits (508), Expect = 1.880e-51
Identity = 120/493 (24.34%), Postives = 230/493 (46.65%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI-----------HCKNH----ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYD 1916
             + +H A Q  + D V+ L+  +   +I+D T      +H A       + ++L+ K  + N +      PLH AC   +  +  LL+     ++         P+H+A   GH  I K+L++K    ++ N +  +P+  A  SG  E+A+ L+ N   ++   +  + P+H A+ +G  E+  +L++ + +    T     P+ IA+   +V+ VRLL+        +  +   P+HVA + G V+V +LL++   N N A    + P+H+A  +  +++V +L+  G   +       T L++A ++   +V+  L+ +G +   +S++   P+H A Q G  +I  LL+    +++  N +   P+HL    G++ I  +LV  G+++    R    P+H AC  GN+ ++K L+     +           H K+H      +TPL      GY   +  L  V +    + HR+   + V  +E+ D
Sbjct:  244 LSPIHMAAQGDHMDCVKQLL--QYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKH-SASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCHYKDHYCEYKHTTPLHTHLWLGYISVIDVLKLVTEETVSMKHRMSFPETV--DEILD 731          

HSP 2 Score: 194.126 bits (492), Expect = 1.672e-49
Identity = 125/460 (27.17%), Postives = 220/460 (47.83%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVS----GKVQCK-IND----ATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT L  A QQG+ ++V LL+S    GKV+   + D     + +    +H A   E+  + ++L+      N   ++E+ PLH A  NG+  I ++L+D     +  K      PIH+A Q  H +  K L++ N E++ +     +P+  A + G   +AK+L+      N        P+H A       V  +L+     IE  T     P+ +AS   ++ IV++L+    +    N + E P+H+A + G  EV + L+ N   ++        P+H A+  G  E+VK+LLEH A+ N   T   +PL++A  +GH    ++L+D        + K + P+H A + G  ++A+LL++   + +    N   P+H+A    NL++V LLV  G +     R+    +H A +   +++  +L+ +  + + ++    TPL L    G  D VS L
Sbjct:  140 FTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLL------NRGANDELTPLHCAARNGHFRIIEILLDN-GAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLL 592          

HSP 3 Score: 162.54 bits (410), Expect = 8.009e-40
Identity = 113/445 (25.39%), Postives = 201/445 (45.17%), Query Frame = 3
Query:  501 ACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A + GN D  + L   K    IN A ++   A+H A      ++V  L+     +     +    LH A   G + +   L++    NVN ++ +   P+++A Q  H E+ K L+E     +   +  F+P+  AL  G   +  LLI+                 F S  GFT                      P+ IA+   N+ + +LL+      +  NDE   P+H A + G   ++++L+DN   I       + PIH+A++   ++ VK LL++ A+ + I     TPL++A   GH+ ++KVL+D G     +++  + P+H AC+     +  LL+    SI+   ++   P+H+A   G+LNIVK+L+  G++    +   + P+H A  +G+ ++ + L+ N   +  K     TPL      G+ + V  L
Sbjct:   14 AARSGNLD--KALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNY-GTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFT----------------------PLHIAAHYENLNVAQLLLN-----RGANDE-LTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLL 427          

HSP 4 Score: 109.383 bits (272), Expect = 1.411e-23
Identity = 118/561 (21.03%), Postives = 213/561 (37.97%), Query Frame = 3
Query:  897 ILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNC-------ICTYAR-------------------------------TPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQN---------------------------------GFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL---SKVLDA----NREIFH---RVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERV--LLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPN---ENPYFNLMMAIKDN 2321
             L A  SG ++ A   I N  DIN + +     +H AS  G  ++   L+     +E  T      + IA+     ++V  L+    N+   + +   P+++A Q+  +EVV+ L++N  N +   +    P+ +A + G   +V +L+ +G             C +                                 TPL+ A   GH+ + ++L+DNG  I+ ++     PIH A Q                                  G   +A++L+D     ++   N   P+H+AC   +L ++ LL+ H +++E    S   P+H A   G+L+++K L+    +    N    TPL +    G+ +   FL   +  +DA    ++   H   R+ H ++VK    + A+         G S L +A      + +  +LD  +  Q+ +  K       +  +   + + E  L R    N               +N    G T L +A  H N D    +  +   P+    N Y  L +A K N
Sbjct:   11 FLRAARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTT--TAGHSPLHIAAREGHVQTVRLLLD--MEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPN------------AAGKN----GLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQN 551          
BLAST of SMED30013027 vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 191.045 bits (484), Expect = 1.384e-48
Identity = 120/455 (26.37%), Postives = 222/455 (48.79%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKR---PIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
              ALH A ++G+ D+V+ LL  G     ++ +TK  N A+H + ++   E+V+ L+ +  +IN ++     PL+ A    +  + + L++    N +    +   P+ +A Q GH ++  +L+E + +     K     +  A      + A LL+ N  + +  +++   P+H A+  G   VA +L++R   ++        P+ +AS   N  +VRLL+     I     +   P+H A + G    V++L++    +       + P+H+A++   VE VK LL+H A  + +     T L++A   GHY V+K+L+D   N   +++  + P+H AC+    ++ +LLV    SI    ++   PIH+A   G+LNIV LL+ +G++   PD SN R    +H A   G  ++++ L+ N   +  +     TPL +    G  + V  L
Sbjct:   66 LNALHLAAKEGHMDLVQELLDRG---APVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLE-NGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTK----GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGAS---PDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLL 509          

HSP 2 Score: 184.111 bits (466), Expect = 2.079e-46
Identity = 114/442 (25.79%), Postives = 204/442 (46.15%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGN----KAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDL 1796
             T LH A ++GN ++VRLL+    Q  I+  T+     +H A  S  E  VE+L+ K   +  +    + PLH A    +    K + Q    V D  ++   A     +H+A   GH+ + KLL++K    N+     F+P+  A    ++++ +LL+     I   T +   PIH A+ +G   +  +L+      +   I     + +A+     E+VR L+ N   +     E++ P+H+A + G  E+VQLL+ +  + + A      P+HI++  G++E   +LLE GA  +       TPL++ ++ G  DV+K+L+      +        P+H A      ++A LL+D   S  T   N   P+H+A     ++I  +L+ +G+      +    P+H A + G+ D+   L+     I+    +  T L L
Sbjct:  260 ITPLHVASKRGNTNMVRLLLDRGSQ--IDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTA-----LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHL 694          

HSP 3 Score: 183.726 bits (465), Expect = 2.404e-46
Identity = 111/451 (24.61%), Postives = 211/451 (46.78%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A   GN ++  LL++      ++   ++    +H A    +  +V +L+ +  +I+ K  + + PLH A  +G++A  ++L++     +  +      P+H+A Q  H E  K L++    ++ +     + +  A + G   + KLL+  + + N        P+H A      +V  +L+     I+  T     PI +A+   ++ IV LL+ N  +    N   E  +H+A + G  EVV+ L+ N   ++    +   P+HIAS  G+ EIV++LL+H A  +   T   TPL+++  +G  + + VL++ G +    + K + P+H   + G  ++A+LL+      D+   N   P+H+A    N  +  LL+D G++     ++   P+H A +   +D+   L+      +       TPL L    G+ D  + L
Sbjct:  227 FTPLHIAAHYGNVNVATLLLN--RGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLE-KGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALL 674          

HSP 4 Score: 176.792 bits (447), Expect = 3.738e-44
Identity = 106/453 (23.40%), Postives = 213/453 (47.02%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSAN--RAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             TALH A   G++ + +LL+  +     N   ++ N    +H AC     +++E+L+     I    +  + P+H A   G+  I  LL+     + +  N      +H+A + G  E+ + L+     +++  +++ +P+  A   G+ EI +LL+ +    + +T     P+H ++  G  E A +L++        T     P+ + S   ++++ +LL+               P+HVA      +V  LL+D   + +        P+HIA++  +++I  +LL++GA+TN +     TPL+LA+++GH D++ +L+  G  I   +      +H A Q     +A++LV +  ++D +      P+ +AC  GN  +V  L+ +G+++    ++   P+H A + GN  +I  L+ +    +      +T L + +  GY   V  L
Sbjct:  359 LTALHVAAHCGHYRVTKLLLDKRA----NPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQN-GASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          

HSP 5 Score: 176.407 bits (446), Expect = 5.039e-44
Identity = 105/436 (24.08%), Postives = 197/436 (45.18%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
             + LH A Q  + + V+ L+  K    ++D T     A+H A       + ++L+ K+   N +      PLH AC      + +LL+     ++         PIH+A   GH  I  LL++     +  N +  + +  A  +GQ E+ + L+ N   ++   R  + P+H AS LG TE+  +L+      +  T     P+ I++    +E   +L+    +      +   P+HV  + G ++V +LL+      + A    + P+H+A+     ++  +LL+ GA  +       TPL++A +K   D++ VL+  G      + +   P+H A Q G  ++A LL+     I+    +    +HLA     + + ++LV +G+NL+   +    P+  AC  GN  ++  L+ N  +++ K     TPL
Sbjct:  326 LSPLHMAAQGDHVECVKHLLQHK--APVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKY-GASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPL 758          

HSP 6 Score: 130.954 bits (328), Expect = 4.577e-30
Identity = 94/423 (22.22%), Postives = 176/423 (41.61%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKC---------------------INDENEQ--------PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQN---------------------------------GFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCV 1826
            +D+  CN N  NA     +HLA + GH ++ + L+++   ++S  K+  + +  +  +GQ E+ K L+    DIN  ++    P++ A+     +V   L++   +    T     P+ IA    + ++V +L+ N    K                       ND N          P+H+A   G V V  LL++    ++      + P+H+AS+ G   +V++LL+ G+  +       TPL+ A   GH    +VL++ G  +  ++     P+H A Q                                  G   + +LL+D   + +    N   P+H+AC    + +++LLV +G++++    S   PIH A   G+L+++  L+ N  +    N    T L +    G  + V
Sbjct:   56 VDISTCNQNGLNA-----LHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVV 473          

HSP 7 Score: 123.635 bits (309), Expect = 6.629e-28
Identity = 72/319 (22.57%), Postives = 159/319 (49.84%), Query Frame = 3
Query:  807 ACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLE--HGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            A + G+ +     ++   ++++ N+   + +  A   G +++ + L+     ++ ST+     +H +S  G  EV   L+ R  DI  ++     P+++A+  N++++VR L+ N  N     ++   P+ +A Q+G  +VV +L++N    +      +  +HIA+     +   +LL+  H AD      +  TPL++A   G+ +V+ +L++ G  ++  +     P+H A + G   + +LL+D    ID +  +   P+H A  SG+   V++L++ G+ L    ++   P+H A +  +++ +K L+ +   +
Sbjct:   39 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGF--TPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPV 351          

HSP 8 Score: 115.161 bits (287), Expect = 2.927e-25
Identity = 69/273 (25.27%), Postives = 127/273 (46.52%), Query Frame = 3
Query: 1104 ASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEI-----------------------------AQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            A+   N++ V   +    +I   N      +H+A ++G +++VQ L+D    ++ +  K    +HI+S  G+ E+VK L++ GAD N       TPLY+A ++ H DV + L++NG N    +   + P+  A Q G  ++                             A LL+ +  + D ++ +   P+H+A   GN+N+  LL++ G+ ++   R+   P+H A + GN ++++ L+     I  K     TPL      G++  V  L
Sbjct:   39 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVL 311          

HSP 9 Score: 56.225 bits (134), Expect = 2.705e-7
Identity = 33/150 (22.00%), Postives = 65/150 (43.33%), Query Frame = 3
Query: 1386 TPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            T    A   G+ D     +  G +I   +      +H A + G  ++ Q L+D    +D+        +H++  +G   +VK LV  G+++    ++   P++ A +  +LD+++ L+ N            TPL +    G++  VS L
Sbjct:   34 TSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSIL 183          
BLAST of SMED30013027 vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 191.045 bits (484), Expect = 1.416e-48
Identity = 120/455 (26.37%), Postives = 222/455 (48.79%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVR-LLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKR---PIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
              ALH A ++G+ D+V+ LL  G     ++ +TK  N A+H + ++   E+V+ L+ +  +IN ++     PL+ A    +  + + L++    N +    +   P+ +A Q GH ++  +L+E + +     K     +  A      + A LL+ N  + +  +++   P+H A+  G   VA +L++R   ++        P+ +AS   N  +VRLL+     I     +   P+H A + G    V++L++    +       + P+H+A++   VE VK LL+H A  + +     T L++A   GHY V+K+L+D   N   +++  + P+H AC+    ++ +LLV    SI    ++   PIH+A   G+LNIV LL+ +G++   PD SN R    +H A   G  ++++ L+ N   +  +     TPL +    G  + V  L
Sbjct:   81 LNALHLAAKEGHMDLVQELLDRG---APVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLE-NGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTK----GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGAS---PDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLL 524          

HSP 2 Score: 184.111 bits (466), Expect = 2.021e-46
Identity = 114/442 (25.79%), Postives = 204/442 (46.15%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGN----KAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDL 1796
             T LH A ++GN ++VRLL+    Q  I+  T+     +H A  S  E  VE+L+ K   +  +    + PLH A    +    K + Q    V D  ++   A     +H+A   GH+ + KLL++K    N+     F+P+  A    ++++ +LL+     I   T +   PIH A+ +G   +  +L+      +   I     + +A+     E+VR L+ N   +     E++ P+H+A + G  E+VQLL+ +  + + A      P+HI++  G++E   +LLE GA  +       TPL++ ++ G  DV+K+L+      +        P+H A      ++A LL+D   S  T   N   P+H+A     ++I  +L+ +G+      +    P+H A + G+ D+   L+     I+    +  T L L
Sbjct:  275 ITPLHVASKRGNTNMVRLLLDRGSQ--IDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTA-----LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHL 709          

HSP 3 Score: 184.111 bits (466), Expect = 2.297e-46
Identity = 111/451 (24.61%), Postives = 211/451 (46.78%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
            FT LH A   GN ++  LL++      ++   ++    +H A    +  +V +L+ +  +I+ K  + + PLH A  +G++A  ++L++     +  +      P+H+A Q  H E  K L++    ++ +     + +  A + G   + KLL+  + + N        P+H A      +V  +L+     I+  T     PI +A+   ++ IV LL+ N  +    N   E  +H+A + G  EVV+ L+ N   ++    +   P+HIAS  G+ EIV++LL+H A  +   T   TPL+++  +G  + + VL++ G +    + K + P+H   + G  ++A+LL+      D+   N   P+H+A    N  +  LL+D G++     ++   P+H A +   +D+   L+      +       TPL L    G+ D  + L
Sbjct:  242 FTPLHIAAHYGNVNVATLLLN--RGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLE-KGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALL 689          

HSP 4 Score: 177.178 bits (448), Expect = 3.011e-44
Identity = 105/451 (23.28%), Postives = 211/451 (46.78%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             TALH A   G++ + +LL+  +     N    +    +H AC     +++E+L+     I    +  + P+H A   G+  I  LL+     + +  N      +H+A + G  E+ + L+     +++  +++ +P+  A   G+ EI +LL+ +    + +T     P+H ++  G  E A +L++        T     P+ + S   ++++ +LL+               P+HVA      +V  LL+D   + +        P+HIA++  +++I  +LL++GA+TN +     TPL+LA+++GH D++ +L+  G  I   +      +H A Q     +A++LV +  ++D +      P+ +AC  GN  +V  L+ +G+++    ++   P+H A + GN  +I  L+ +    +      +T L + +  GY   V  L
Sbjct:  374 LTALHVAAHCGHYRVTKLLLDKR--ANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQ-NGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          

HSP 5 Score: 176.407 bits (446), Expect = 4.692e-44
Identity = 105/436 (24.08%), Postives = 197/436 (45.18%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPL 1790
             + LH A Q  + + V+ L+  K    ++D T     A+H A       + ++L+ K+   N +      PLH AC      + +LL+     ++         PIH+A   GH  I  LL++     +  N +  + +  A  +GQ E+ + L+ N   ++   R  + P+H AS LG TE+  +L+      +  T     P+ I++    +E   +L+    +      +   P+HV  + G ++V +LL+      + A    + P+H+A+     ++  +LL+ GA  +       TPL++A +K   D++ VL+  G      + +   P+H A Q G  ++A LL+     I+    +    +HLA     + + ++LV +G+NL+   +    P+  AC  GN  ++  L+ N  +++ K     TPL
Sbjct:  341 LSPLHMAAQGDHVECVKHLLQHK--APVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKY-GASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPL 773          

HSP 6 Score: 130.954 bits (328), Expect = 4.010e-30
Identity = 94/423 (22.22%), Postives = 176/423 (41.61%), Query Frame = 3
Query:  744 IDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKC---------------------INDENEQ--------PIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQN---------------------------------GFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCV 1826
            +D+  CN N  NA     +HLA + GH ++ + L+++   ++S  K+  + +  +  +GQ E+ K L+    DIN  ++    P++ A+     +V   L++   +    T     P+ IA    + ++V +L+ N    K                       ND N          P+H+A   G V V  LL++    ++      + P+H+AS+ G   +V++LL+ G+  +       TPL+ A   GH    +VL++ G  +  ++     P+H A Q                                  G   + +LL+D   + +    N   P+H+AC    + +++LLV +G++++    S   PIH A   G+L+++  L+ N  +    N    T L +    G  + V
Sbjct:   71 VDISTCNQNGLNA-----LHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVV 488          

HSP 7 Score: 127.872 bits (320), Expect = 3.513e-29
Identity = 101/405 (24.94%), Postives = 176/405 (43.46%), Query Frame = 3
Query:  858 CEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDF 2069
             EM S +   F   L A  +G I+     +    DI+   +     +H A+  G  ++   L+DR   ++  T      + I+S     E+V+ L+    +I   +     P+++A Q+  ++VV+ L++N  N + A +    P+ IA + G  ++V ILLE     N      R P L++A  K     + +L+ N  N + QS   + P+H A   G   +A LL++   ++D    N   P+H+A   GN N+V+LL+D GS ++   R    P+H A  +G+   ++ L+     +  +     +PL +     + +CV  L         + H+   DD+              L+Y   L+ L VA      R+   +LD+  N         ALN F
Sbjct:   41 AEMLSDSNTSF---LRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLE-----NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHL---------LQHKAPVDDV-------------TLDY---LTALHVAAHCGHYRVTKLLLDKRANPN-----ARALNGF 407          

HSP 8 Score: 123.635 bits (309), Expect = 6.594e-28
Identity = 72/319 (22.57%), Postives = 159/319 (49.84%), Query Frame = 3
Query:  807 ACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLE--HGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
            A + G+ +     ++   ++++ N+   + +  A   G +++ + L+     ++ ST+     +H +S  G  EV   L+ R  DI  ++     P+++A+  N++++VR L+ N  N     ++   P+ +A Q+G  +VV +L++N    +      +  +HIA+     +   +LL+  H AD      +  TPL++A   G+ +V+ +L++ G  ++  +     P+H A + G   + +LL+D    ID +  +   P+H A  SG+   V++L++ G+ L    ++   P+H A +  +++ +K L+ +   +
Sbjct:   54 AARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGF--TPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPV 366          
BLAST of SMED30013027 vs. Ensembl Medaka
Match: ENSORLT00000006308.2 (pep primary_assembly:ASM223467v1:1:12516834:12530692:1 gene:ENSORLG00000005003.2 transcript:ENSORLT00000006308.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.637 bits (444), Expect = 3.591e-47
Identity = 105/399 (26.32%), Postives = 199/399 (49.87%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSN 1679
              ALH A ++G+ D+V  L+  +    ++ ATK  N A+H A ++  +E+V++L+ +  ++N ++     PL+ A    +  + +  ++  + N +    +   P+ +A Q GH  +  LL+E + +     K     +  A      + A LL+ N  + +  +++   P+H A+  G   V+ +L++R   ++        P+ +AS   N  +V LL+     I     +   P+H A + G    V+LL++    I       + P+H++++   +E VK+LL+H A  + +     T L++A   GHY V+KVL+D   N   +++  + P+H AC+    ++ +LLV    SI    ++   PIH+A   G+LNIV LL+ +G++   PD  N
Sbjct:   21 LNALHLAAKEGHKDLVEELL--QRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLE-NEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEHDTK----GKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGAS---PDVRN 409          

HSP 2 Score: 137.502 bits (345), Expect = 4.063e-34
Identity = 87/393 (22.14%), Postives = 179/393 (45.55%), Query Frame = 3
Query:  657 CEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFL 1835
             +I+  N   +  LH A   G+K + + L+      V+    + +  +H+A   G  E+ KLL+ +  ++N+ ++  F+P+  A     +E+ +  + N+ + + +T     P+  A   G   V  +L++     + +  ++   + IA+  ++ +   LL+ N  N    +     P+H+A   G V V  LL++    ++      + P+H+AS+ G   +V +LL+ GA  +       TPL+ A   GH    ++L++ G  I  ++     P+H + Q    E  +LL+     +D    +    +H+A   G+  + K+L+D  +N      +   P+H AC+   + +++ LV    +I     +  TP+ +    G+ + V  L
Sbjct:   11 VDISTCNQNGLNALHLAAKEGHKDLVEELLQ-RGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEH----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLL 398          

HSP 3 Score: 125.176 bits (313), Expect = 5.806e-30
Identity = 94/377 (24.93%), Postives = 166/377 (44.03%), Query Frame = 3
Query:  942 LITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTP-LYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDF 2069
             + N  DI+   +     +H A+  G  ++   L+ R   ++  T      + IAS     E+V+LL++   ++   +     P+++A Q+  +EVV+  ++N  N + A +    P+ IA + G   +V +LLEH  DT       R P L++A  K     + +L+ N  N + QS   + P+H A   G   ++ LL++   ++D    N   P+H+A   GN N+V LL+D G+ ++   R    P+H A  +G+   ++ L+     I  +     +PL +     + +CV  L         + H+   DD+              L+Y   L+ L VA      R+   +LD+  N         ALN F
Sbjct:    6 FLKNGVDISTCNQNGLNALHLAAKEGHKDLVEELLQRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEH--DTKG---KVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLL---------LQHQAPVDDV-------------TLDY---LTALHVAAHCGHYRVTKVLLDKKANPNA-----RALNGF 347          

HSP 4 Score: 121.324 bits (303), Expect = 9.671e-29
Identity = 69/307 (22.48%), Postives = 151/307 (49.19%), Query Frame = 3
Query:  843 LIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLE--HGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAI 1757
             ++   ++++ N+   + +  A   G  ++ + L+     ++ +T+     +H AS  G  EV  +L+ R  D+  ++     P+++A+  N++E+VR  + N  N     ++   P+ +A Q+G   VV LL+++    +      +  +HIA+     +   +LL+  H AD      +  TPL++A   G+ +VS +L++ G  ++  +     P+H A + G   +  LL+D    ID +  +   P+H A  SG+   V+LL++ G+ +    ++   P+H + +  +++ +K L+ +   +
Sbjct:    6 FLKNGVDISTCNQNGLNALHLAAKEGHKDLVEELLQRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEH----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGF--TPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPV 306          
BLAST of SMED30013027 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 428/434 (98.62%), Postives = 429/434 (98.85%), Query Frame = 3
Query:  480 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS 1781
            KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITN CDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKC NDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVD GSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNH  +
Sbjct:  172 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKT 605          

HSP 2 Score: 472.241 bits (1214), Expect = 3.101e-140
Identity = 226/229 (98.69%), Postives = 228/229 (99.56%), Query Frame = 3
Query: 1773 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLH 2459
            ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVA+ TRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSIC+NDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLH
Sbjct:  941 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAVRTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICENDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLH 1169          

HSP 3 Score: 301.597 bits (771), Expect = 1.734e-83
Identity = 169/456 (37.06%), Postives = 265/456 (58.11%), Query Frame = 3
Query:  489 ALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNK--CDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLI-TNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVL 1847
            ALH +C+ GN D V+ L+  K  C I        + IH+AC   + +IV+ LI   C +N   ++   P+HYAC NG+ A+A++LI      VN K  ++S+PIH AC+ G+ ++ KLL+   C +N  + ++F+ + YA   G  +I +LL++ K  C IN +T++  R IHFA      E+  +LI ++C+I C+   +  P+  A +N N  I +LLI    CN+ C N E  QPIH+ACQ G  E+ +LLI+ +C +N  N +   PI  A  +G++EI K+L+ +  D NC       P++ A+  G  +V+ +LID  C+IEC++I K RPI  A  N   EI +LL+ +HC+I   ND  ++PIH+AC  G + +V+LL+D+  N+ C +    +PIH A ENG ++++K L+ +    +C    + TPL L    G+ D    +SKVL
Sbjct:   44 ALHCSCKNGNLDYVKFLIDHK--CDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL--VNIKAPDDSRPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYD----VSKVL 491          
BLAST of SMED30013027 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 884.019 bits (2283), Expect = 0.000e+0
Identity = 428/434 (98.62%), Postives = 429/434 (98.85%), Query Frame = 3
Query:  480 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS 1781
            KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITN CDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKC NDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVD GSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNH  +
Sbjct:  171 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKT 604          

HSP 2 Score: 473.781 bits (1218), Expect = 7.945e-147
Identity = 229/233 (98.28%), Postives = 231/233 (99.14%), Query Frame = 3
Query: 1767 NHASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 2465
            N ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVA+ TRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSIC+NDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL
Sbjct:  929 NLASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAVRTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICENDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 1161          

HSP 3 Score: 300.827 bits (769), Expect = 1.473e-84
Identity = 169/458 (36.90%), Postives = 265/458 (57.86%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNK--CDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLI-TNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVL 1847
              ALH +C+ GN D V+ L+  K  C I        + IH+AC   + +IV+ LI   C +N   ++   P+HYAC NG+ A+A++LI      VN K  ++S+PIH AC+ G+ ++ KLL+   C +N  + ++F+ + YA   G  +I +LL++ K  C IN +T++  R IHFA      E+  +LI ++C+I C+   +  P+  A +N N  I +LLI    CN+ C N E  QPIH+ACQ G  E+ +LLI+ +C +N  N +   PI  A  +G++EI K+L+ +  D NC       P++ A+  G  +V+ +LID  C+IEC++I K RPI  A  N   EI +LL+ +HC+I   ND  ++PIH+AC  G + +V+LL+D+  N+ C +    +PIH A ENG ++++K L+ +    +C    + TPL L    G+ D    +SKVL
Sbjct:   41 LNALHCSCKNGNLDYVKFLIDHK--CDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL--VNIKAPDDSRPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYD----VSKVL 490          
BLAST of SMED30013027 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 882.863 bits (2280), Expect = 0.000e+0
Identity = 428/434 (98.62%), Postives = 429/434 (98.85%), Query Frame = 3
Query:  480 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS 1781
            KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITN CDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKC NDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVD GSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNH  +
Sbjct:  170 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKT 603          

HSP 2 Score: 472.241 bits (1214), Expect = 9.204e-147
Identity = 228/231 (98.70%), Postives = 230/231 (99.57%), Query Frame = 3
Query: 1773 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 2465
            ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVA+ TRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSIC+NDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL
Sbjct:  877 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAVRTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICENDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 1107          

HSP 3 Score: 300.827 bits (769), Expect = 7.262e-85
Identity = 169/458 (36.90%), Postives = 265/458 (57.86%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNK--CDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLI-TNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVL 1847
              ALH +C+ GN D V+ L+  K  C I        + IH+AC   + +IV+ LI   C +N   ++   P+HYAC NG+ A+A++LI      VN K  ++S+PIH AC+ G+ ++ KLL+   C +N  + ++F+ + YA   G  +I +LL++ K  C IN +T++  R IHFA      E+  +LI ++C+I C+   +  P+  A +N N  I +LLI    CN+ C N E  QPIH+ACQ G  E+ +LLI+ +C +N  N +   PI  A  +G++EI K+L+ +  D NC       P++ A+  G  +V+ +LID  C+IEC++I K RPI  A  N   EI +LL+ +HC+I   ND  ++PIH+AC  G + +V+LL+D+  N+ C +    +PIH A ENG ++++K L+ +    +C    + TPL L    G+ D    +SKVL
Sbjct:   40 LNALHCSCKNGNLDYVKFLIDHK--CDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL--VNIKAPDDSRPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYD----VSKVL 489          
BLAST of SMED30013027 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 882.863 bits (2280), Expect = 0.000e+0
Identity = 428/434 (98.62%), Postives = 429/434 (98.85%), Query Frame = 3
Query:  480 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS 1781
            KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITN CDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKC NDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVD GSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNH  +
Sbjct:  172 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKT 605          

HSP 2 Score: 472.241 bits (1214), Expect = 9.941e-147
Identity = 228/231 (98.70%), Postives = 230/231 (99.57%), Query Frame = 3
Query: 1773 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 2465
            ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVA+ TRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSIC+NDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL
Sbjct:  879 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAVRTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICENDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 1109          

HSP 3 Score: 300.827 bits (769), Expect = 6.958e-85
Identity = 169/458 (36.90%), Postives = 265/458 (57.86%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNK--CDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLI-TNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVL 1847
              ALH +C+ GN D V+ L+  K  C I        + IH+AC   + +IV+ LI   C +N   ++   P+HYAC NG+ A+A++LI      VN K  ++S+PIH AC+ G+ ++ KLL+   C +N  + ++F+ + YA   G  +I +LL++ K  C IN +T++  R IHFA      E+  +LI ++C+I C+   +  P+  A +N N  I +LLI    CN+ C N E  QPIH+ACQ G  E+ +LLI+ +C +N  N +   PI  A  +G++EI K+L+ +  D NC       P++ A+  G  +V+ +LID  C+IEC++I K RPI  A  N   EI +LL+ +HC+I   ND  ++PIH+AC  G + +V+LL+D+  N+ C +    +PIH A ENG ++++K L+ +    +C    + TPL L    G+ D    +SKVL
Sbjct:   42 LNALHCSCKNGNLDYVKFLIDHK--CDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL--VNIKAPDDSRPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYD----VSKVL 491          
BLAST of SMED30013027 vs. Planmine SMEST
Match: SMESG000076350.1 (SMESG000076350.1)

HSP 1 Score: 882.478 bits (2279), Expect = 0.000e+0
Identity = 428/434 (98.62%), Postives = 429/434 (98.85%), Query Frame = 3
Query:  480 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASS 1781
            KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITN CDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKC NDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVD GSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNH  +
Sbjct:  170 KFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDRGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHVKT 603          

HSP 2 Score: 472.241 bits (1214), Expect = 1.182e-146
Identity = 228/231 (98.70%), Postives = 230/231 (99.57%), Query Frame = 3
Query: 1773 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 2465
            ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVA+ TRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSIC+NDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL
Sbjct:  887 ASSTPLDLLKTFGYDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSVLEVAVRTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFLHRSICENDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRERICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAMSLDHRICCEAIVRFLHCL 1117          

HSP 3 Score: 300.827 bits (769), Expect = 9.326e-85
Identity = 169/458 (36.90%), Postives = 265/458 (57.86%), Query Frame = 3
Query:  483 FTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNK--CDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLI-TNHCNIKCINDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQNGFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLECPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFGYDDCVSFLSKVL 1847
              ALH +C+ GN D V+ L+  K  C I        + IH+AC   + +IV+ LI   C +N   ++   P+HYAC NG+ A+A++LI      VN K  ++S+PIH AC+ G+ ++ KLL+   C +N  + ++F+ + YA   G  +I +LL++ K  C IN +T++  R IHFA      E+  +LI ++C+I C+   +  P+  A +N N  I +LLI    CN+ C N E  QPIH+ACQ G  E+ +LLI+ +C +N  N +   PI  A  +G++EI K+L+ +  D NC       P++ A+  G  +V+ +LID  C+IEC++I K RPI  A  N   EI +LL+ +HC+I   ND  ++PIH+AC  G + +V+LL+D+  N+ C +    +PIH A ENG ++++K L+ +    +C    + TPL L    G+ D    +SKVL
Sbjct:   40 LNALHCSCKNGNLDYVKFLIDHK--CDIECVDFHGYKPIHYACQGGNPDIVKYLIESGCMMNFLQEKAFHPIHYACMNGHLAVARILISRQL--VNIKAPDDSRPIHYACRSGNVDLVKLLLASKCAINVADSEKFTALHYACQQGNHDIVRLLVSGKVQCKINDATKSANRAIHFACMSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDCNVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYALNSGQIEIAKLLITNNCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCDIECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCTNDENEQPIHVACQKGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADTNCICTYARTPLYLATEKGHYD----VSKVL 489          
The following BLAST results are available for this feature:
BLAST of SMED30013027 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK13.810e-5526.27ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK13.878e-5526.27ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK14.298e-5526.27ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK21.809e-5124.69ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK22.469e-5024.64ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of SMED30013027 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-442.670e-5226.87AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.670e-5226.87AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.591e-5226.87AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-443.591e-5226.87AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-444.605e-5226.87AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of SMED30013027 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank21.209e-5225.44gene:FBgn0261788 transcript:FBtr0334062[more]
Ank23.799e-5025.44gene:FBgn0261788 transcript:FBtr0303120[more]
Ank1.155e-4927.96gene:FBgn0011747 transcript:FBtr0089172[more]
Ank1.155e-4927.96gene:FBgn0011747 transcript:FBtr0300497[more]
Ank1.155e-4927.96gene:FBgn0011747 transcript:FBtr0089171[more]
back to top
BLAST of SMED30013027 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b1.401e-5525.93ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b2.447e-5525.93ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
BX640476.12.558e-5525.81ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
BX640476.13.562e-5525.49ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
ank1a3.583e-5425.49ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30013027 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK11.528e-5427.23ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK11.721e-5427.23ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK11.816e-5425.83ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK11.952e-5427.23ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK12.066e-5427.23ankyrin 1 [Source:NCBI gene;Acc:613080][more]
back to top
BLAST of SMED30013027 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank16.873e-5124.66ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank13.207e-5024.66ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank13.245e-5024.66ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank13.410e-5024.66ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank14.156e-5025.05ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
back to top
BLAST of SMED30013027 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16157|ANK1_HUMAN1.863e-5426.27Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|Q4UMH6|Y381_RICFE1.443e-5027.06Putative ankyrin repeat protein RF_0381 OS=Rickett... [more]
sp|Q02357|ANK1_MOUSE3.026e-4924.66Ankyrin-1 OS=Mus musculus OX=10090 GN=Ank1 PE=1 SV... [more]
sp|G5E8K5|ANK3_MOUSE1.084e-4725.77Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q12955|ANK3_HUMAN2.593e-4723.95Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
back to top
BLAST of SMED30013027 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q16FI94.115e-8332.18AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
Q16FR14.171e-8031.77AAEL014668-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
A0A182GGY84.549e-7433.04ANK_REP_REGION domain-containing protein OS=Aedes ... [more]
A0A3D8S8064.791e-7430.05ANK_REP_REGION domain-containing protein OS=Coleop... [more]
A0A1X7T5X61.545e-7233.94Uncharacterized protein OS=Amphimedon queenslandic... [more]
back to top
BLAST of SMED30013027 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a2.156e-5324.94ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ank1b6.091e-5226.39ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3a7.202e-4924.28ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.178e-4824.28ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3b5.194e-4825.77ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
back to top
BLAST of SMED30013027 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.14.313e-5926.28pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.11.464e-5726.18pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007446.15.111e-4622.30pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.12.669e-4322.50pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000003991.13.614e-4125.35pep scaffold:Pmarinus_7.0:GL484476:255315:281660:1... [more]
back to top
BLAST of SMED30013027 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HOS41.061e-935.71Subunit of the Set3 complex; complex is a meiotic-... [more]
PHO811.982e-922.63Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
NAS63.001e-927.42Evolutionarily conserved 19S regulatory particle a... [more]
AKR18.024e-920.47Palmitoyl transferase involved in protein palmitoy... [more]
GDE19.705e-721.97Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
back to top
BLAST of SMED30013027 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387026.851e-3627.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436902.972e-1625.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387253.373e-1627.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494855.843e-1624.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460995.329e-1427.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30013027 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b7.284e-5625.61ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ank1a1.880e-5124.34ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
ENSORLT00000039458.11.384e-4826.37ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000031565.11.416e-4826.37ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000006308.23.591e-4726.32pep primary_assembly:ASM223467v1:1:12516834:125306... [more]
back to top
BLAST of SMED30013027 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076350.13.101e-14098.62SMESG000076350.1[more]
SMESG000076350.17.945e-14798.62SMESG000076350.1[more]
SMESG000076350.19.204e-14798.62SMESG000076350.1[more]
SMESG000076350.19.941e-14798.62SMESG000076350.1[more]
SMESG000076350.11.182e-14698.62SMESG000076350.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013027 ID=SMED30013027|Name=SMED30013027|organism=Schmidtea mediterranea sexual|type=transcript|length=3699bp
ATTAAGCTCCAGAACCACATCTTAATCACTTATCATTGTTTCCCCCAATC
ATTTTGCATGTTTATTAATTATTTTGTTCTATTATTTTGGTATTCTCAAC
AGTTTTTGCATTCATTACATTAGAGCCGCCGATATTCTACTGAGAATTCA
TTAGTCCAATTACACGCCTGGAAATCACATTGAACATTATCAATGACTTC
GGGGTCAGATATTGCAGCAAATGCAGGTTGAAAATTGGCAAAATTAATTA
ATTAATCAATATAACAACAAACATTATCGGTTGGCTACACAAGTCAATAA
AGCATTTATAAAGCTGGTTACAAATCAATGAATAGATGTAAATCATTACA
ATAATCAGTCACGGAATTCAAAATGCGCTACTGCCCCATCCCTCCACTTA
AGCTAATAGATTAAAATTTTGTTTGTTATAACCGAGTTTGGCTGGAGTGG
ACGTTTCTAATTCCTAATTGCTAACCTAGAAATTCACTGCACTCCATTAC
GCCTGCCAGCAAGGAAACCACGATATTGTACGGCTGTTGGTTTCAGGGAA
AGTCCAATGCAAAATCAACGATGCTACGAAATCAGCAAATCGAGCGATTC
ATTTTGCTTGCATGAGTGAAAGTGAGGAAATTGTTGAAATATTGATCGGG
AAGAAATGTGAAATTAATTGCAAAAATGATGAAGAAATGTTTCCACTTCA
TTATGCCTGCACAAATGGAAATAAGGCAATCGCACAATTACTGATTGATG
TTCCAGACTGCAATGTCAACTGCAAAAACGCTGAGGAATCTCAACCGATT
CATTTAGCATGTCAACACGGCCATTTTGAAATTGCCAAGTTATTGATAGA
GAAAAATTGCGAAATGAACTCTATGAATAAACAAGAATTTTCTCCTATTC
TTTATGCGCTGAATAGCGGTCAAATAGAAATCGCGAAATTGCTCATCACT
AATAAATGTGACATAAATTGTTCGACTCGAACCCAAGAGAGGCCCATCCA
TTTCGCCAGCACCCTCGGATTTACCGAGGTGGCCCATATGCTCATCGATA
GACAATGCGATATTGAATGTGAAACGATTTTAAAAAGGAGGCCCATCTTT
ATCGCAAGCTCGAATAATAATGTGGAAATTGTGAGATTATTAATTACCAA
TCACTGCAACATCAAGTGTATCAATGATGAGAATGAGCAACCGATTCATG
TGGCATGTCAGAAAGGGTTTGTAGAGGTCGTCCAATTATTGATTGACAAC
CACTGCAATATCAACTGTGCAAATGATAAGCTGATGAAGCCTATTCATAT
TGCAAGCGAAAACGGCAGGGTAGAAATAGTAAAAATATTATTGGAACATG
GAGCCGATACAAATTGCATATGTACATATGCTAGGACTCCTCTTTATCTA
GCAACAGAAAAAGGCCATTACGATGTCTCGAAGGTGCTGATTGACAATGG
GTGTAATATTGAATGCCAATCAATAAAGAAATGGAGGCCAATTCATAATG
CTTGTCAAAACGGTTTCTGTGAGATAGCTCAACTGCTTGTCGACAGTCAC
TGCTCTATTGATACCGAGAATGACAATAAGCAAAAGCCGATTCATCTGGC
TTGTAGCAGTGGGAATCTAAACATTGTCAAATTACTGGTTGACCACGGCT
CGAATTTAGAATGTCCAGACCGCTCGAACAAGCGCCCAATCCATTATGCT
TGTGAGAATGGAAACCTTGATTTAATAAAAGCTTTAGTCCATAACAATTG
TGCTATTCATTGTAAGAATCACGCTTCAAGTACTCCTCTGGATCTACTGA
AGACATTTGGATATGACGACTGCGTTTCATTCCTCAGTAAAGTATTGGAC
GCAAATCGCGAAATATTTCATAGGGTTAGACATGACGACATCGTGAAATT
CAATGAACTATATGATGCGCATACGCTGTTTGTGCTGGAATATGACACAG
GCCTGTCTGTATTGGAAGTAGCCATAGGGACCCGTTCCTCCCGAATCATC
AACTATATTCTTGATCAACCAATTAATTATCAAGAAATCCGGTTTCTGAA
AAATGCGTTAAATGATTTTGAAATCAAAGAAAGAGTTCTTTTAATTCAGG
AGTGCTTTCTTCATCGATCGATCTGCGATAATGATTCTACAAGTTTTGCC
AGGTTTTGCTTGAGAAGTGTTGTCAACCGAAACGTTCTCCTGGCCGGCAC
GACATTTTTGGAATTGGCAACTATTCATGGCAATGACGATTTTGCACAGA
AAATAAGAGAAAGGATTTGTTTTCCTAACGAGAATCCATATTTCAATTTG
ATGATGGCAATCAAGGACAATGATCCATTTTCGGTGCAATATTTATTGGC
CAAGTTTACCTTCGGTGCAAATCCACGGCAATGTTTAAGCACGGCGCTCG
GCATTGCGATGTCATTGGATCACCGAATATGTTGCGAAGCTATCGTGAGA
TTCCTTCATTGTCTCTGAGAGTGCTCAAATCAAATTCAGTTTTTGTTGTG
ATTTATTGATTGAGTTCATTTAATTGTGTTCTTATAATTATTTCTATATA
AATTTAAATACATTCAAAGGGAGGGGGCTGGTGAACACAATCATTCATGA
GGACTGTCTGATAATGATAATGCATTTGGTGTCTTCGTATTGGTTCCCAC
AAGTATTTAACTATAAAAAACAATAATATTATTAATTTTGAATGATATAG
AAAAGTAGAATAATGACGTAATAGAATGTTACACAGAAGTGATTGAAAAG
AATACTAAACATTTGTTTTTATTCAGGCGTTGATAATCTACTTTCCACAA
TTTCACCAACTCCAGTAGTTCAATATGTTATTTCCAGAAGTTATATATTT
ATCCCCTATCACTTCTGAATGTTGCTATCGTGTAGGAGAATATTCATTGC
GCTTTTACTTGATAGCGGTGATTCTTACTCTTTGGTAATGAAGGAGCACT
TTGTTATCTCAAAGTTTTTGGCTAAACAACTGGGATCATTTCAACTAAGA
ACCGATAGAAAACAAAGCGAAAAACCCATCTAAACGTTATGTTTGGTGTT
GTGGGGAGGAGAGAGGCCCCACACCGCAAAATGTTTTTTGAAAATGTACA
TGTGGAATTGCAATTTTAAAACATTTCAATGTGAAAATGAAACTAAATTC
AATTCTGAAAAAGCATATTATTCTGAATTGATAAAAAATTACAAATACAA
TAAAAATACCGATAAATTATTAATATTGCAATTGAATAATTTTAAATGGG
GCATTTGGGCCAGGCGGGATTTTATACATAACGTTTGATAATATCATTTT
CTGAATATGTAAGTTTGGCGGAACATTCCACCCAATTCCTCGGAACACGG
GTTAAGAATCCCTGCTTTATAGAATAAATTATATTTGACATTATATATTA
AATAGTTTGAATGGAATATGTATATAAATTTCATAATTATAAATGACTCT
CAAATTATTCATAAGTTTTCCTTAAAAAGGCAATGAACTTGTAACGAGGT
TCAAGGAAAGGGCTTTATCATAAATGAATTTCATGTTACCTTTTCTTGTC
CACAATTCATTAAGTTATTAAATATCTATCAGATTTGTATTTGTGTAAGA
TATTATATTTTTGTTTTTATTATGCAATATTTTAGAACTTGTTTTATATA
TTCCTTATACTAAATACCGATGAATTCCTGGTTTTGTTTTAAACAATTG
back to top

protein sequence of SMED30013027-orf-1

>SMED30013027-orf-1 ID=SMED30013027-orf-1|Name=SMED30013027-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=619bp
MSESEEIVEILIGKKCEINCKNDEEMFPLHYACTNGNKAIAQLLIDVPDC
NVNCKNAEESQPIHLACQHGHFEIAKLLIEKNCEMNSMNKQEFSPILYAL
NSGQIEIAKLLITNKCDINCSTRTQERPIHFASTLGFTEVAHMLIDRQCD
IECETILKRRPIFIASSNNNVEIVRLLITNHCNIKCINDENEQPIHVACQ
KGFVEVVQLLIDNHCNINCANDKLMKPIHIASENGRVEIVKILLEHGADT
NCICTYARTPLYLATEKGHYDVSKVLIDNGCNIECQSIKKWRPIHNACQN
GFCEIAQLLVDSHCSIDTENDNKQKPIHLACSSGNLNIVKLLVDHGSNLE
CPDRSNKRPIHYACENGNLDLIKALVHNNCAIHCKNHASSTPLDLLKTFG
YDDCVSFLSKVLDANREIFHRVRHDDIVKFNELYDAHTLFVLEYDTGLSV
LEVAIGTRSSRIINYILDQPINYQEIRFLKNALNDFEIKERVLLIQECFL
HRSICDNDSTSFARFCLRSVVNRNVLLAGTTFLELATIHGNDDFAQKIRE
RICFPNENPYFNLMMAIKDNDPFSVQYLLAKFTFGANPRQCLSTALGIAM
SLDHRICCEAIVRFLHCL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005198structural molecule activity
GO:0005200structural constituent of cytoskeleton
GO:0008093cytoskeletal adaptor activity
GO:0019899enzyme binding
GO:0030507spectrin binding
GO:0051117ATPase binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0014731spectrin-associated cytoskeleton
GO:0016020membrane
GO:0016323basolateral plasma membrane
GO:0016529sarcoplasmic reticulum
GO:0030018Z disc
GO:0030673axolemma
GO:0031430M band
GO:0031672A band
GO:0042383sarcolemma
GO:0043005neuron projection
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0006887exocytosis
GO:0006888ER to Golgi vesicle-mediated transport
GO:0007010cytoskeleton organization
GO:0007165signal transduction
GO:0010638positive regulation of organelle organization
GO:0045199maintenance of epithelial cell apical/basal polarity
GO:0072661protein targeting to plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 239..253
score: 43.2
coord: 59..74
score: 28.2
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 91..120
e-value: 0.022
score: 23.9
coord: 256..285
e-value: 0.001
score: 28.3
coord: 124..153
e-value: 250.0
score: 9.5
coord: 190..219
e-value: 0.002
score: 27.4
coord: 58..87
e-value: 0.0031
score: 26.8
coord: 24..54
e-value: 1.9
score: 17.5
coord: 289..318
e-value: 110.0
score: 11.6
coord: 355..384
e-value: 0.048
score: 22.8
coord: 157..186
e-value: 3.6
score: 16.6
coord: 529..558
e-value: 1500.0
score: 3.6
coord: 223..252
e-value: 1.4E-4
score: 31.2
coord: 447..476
e-value: 900.0
score: 5.3
coord: 322..351
e-value: 8.9E-5
score: 31.9
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 190..222
score: 10.713
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 223..251
score: 11.541
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 355..387
score: 9.431
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 58..90
score: 11.3
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 322..354
score: 12.262
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 91..123
score: 8.87
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 256..288
score: 10.9
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 80..195
e-value: 2.5E-25
score: 91.0
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 1..79
e-value: 8.2E-21
score: 76.6
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 196..277
e-value: 7.8E-24
score: 85.7
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 49..418
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 419..605
NoneNo IPR availablePFAMPF13637Ank_4coord: 95..145
e-value: 3.0E-5
score: 24.5
NoneNo IPR availablePANTHERPTHR24180FAMILY NOT NAMEDcoord: 158..251
coord: 4..122
NoneNo IPR availablePANTHERPTHR24180FAMILY NOT NAMEDcoord: 193..319
NoneNo IPR availablePANTHERPTHR24180:SF1526S PROTEASOME REGULATORY SUBUNIT P28-RELATEDcoord: 193..319
NoneNo IPR availablePANTHERPTHR24180:SF1526S PROTEASOME REGULATORY SUBUNIT P28-RELATEDcoord: 158..251
NoneNo IPR availablePANTHERPTHR24180:SF1526S PROTEASOME REGULATORY SUBUNIT P28-RELATEDcoord: 128..218
coord: 289..412
NoneNo IPR availablePANTHERPTHR24180FAMILY NOT NAMEDcoord: 128..218
NoneNo IPR availablePANTHERPTHR24180FAMILY NOT NAMEDcoord: 289..412
NoneNo IPR availablePANTHERPTHR24180:SF1526S PROTEASOME REGULATORY SUBUNIT P28-RELATEDcoord: 4..122
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 4..88
e-value: 2.0E-15
score: 57.1
coord: 163..251
e-value: 2.0E-17
score: 63.5
coord: 290..350
e-value: 6.4E-10
score: 39.5
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 1..409
score: 92.559