Corticotropin-releasing factor receptor 1

Overview
NameCorticotropin-releasing factor receptor 1
Smed IDSMED30013025
Length (bp)1744
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Corticotropin-releasing factor receptor 1 (SMED30013025) t-SNE clustered cells

Violin plots show distribution of expression levels for Corticotropin-releasing factor receptor 1 (SMED30013025) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Corticotropin-releasing factor receptor 1 (SMED30013025) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Corticotropin-releasing factor receptor 1 (SMED30013025) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013025

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30013025SMESG000051050.1 dd_Smed_v4_6632_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30013025SMESG000051050.1 dd_Smed_v4_6632_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30013025SMESG000051050.1 dd_Smed_v4_6632_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Human
Match: CRHR1 (corticotropin releasing hormone receptor 1 [Source:HGNC Symbol;Acc:HGNC:2357])

HSP 1 Score: 166.007 bits (419), Expect = 6.201e-45
Identity = 126/409 (30.81%), Postives = 192/409 (46.94%), Query Frame = 3
Query:  192 DDLCRALYELVGKNTTNALCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN-----KIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQA------SNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKI-LTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            D  C +L      +  + L C  S D     W  + +  +  + CP       YN   N  R CLANG WA + NY  C  + N     K+ YHV +   ++G+ IS +AL +A +LF   RS+RC+RN IH NLI ++I+R  TW+++   Q+T +  P    +      L + A      +N+ WMF EG YL   IV TY  D+L+ W +  IGWG P  +    AI     +N  + WF                    I     +L ++I  +F      +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF       +      I   + L S QGFFV++ YCFLN EVR  ++ ++  ++      +R  + +   T P R    +F  +KQ 
Sbjct:   27 DQHCESLSL---ASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVV---QLTMS--PEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDN-EKCWFGKRPG----------VYTDYIYQGPMILVLLINFIF-LFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTR---VSFHSIKQS 412          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Human
Match: CRHR1 (corticotropin releasing hormone receptor 1 [Source:HGNC Symbol;Acc:HGNC:2357])

HSP 1 Score: 166.007 bits (419), Expect = 6.201e-45
Identity = 126/409 (30.81%), Postives = 192/409 (46.94%), Query Frame = 3
Query:  192 DDLCRALYELVGKNTTNALCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN-----KIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQA------SNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKI-LTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            D  C +L      +  + L C  S D     W  + +  +  + CP       YN   N  R CLANG WA + NY  C  + N     K+ YHV +   ++G+ IS +AL +A +LF   RS+RC+RN IH NLI ++I+R  TW+++   Q+T +  P    +      L + A      +N+ WMF EG YL   IV TY  D+L+ W +  IGWG P  +    AI     +N  + WF                    I     +L ++I  +F      +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF       +      I   + L S QGFFV++ YCFLN EVR  ++ ++  ++      +R  + +   T P R    +F  +KQ 
Sbjct:   27 DQHCESLSL---ASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVV---QLTMS--PEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDN-EKCWFGKRPG----------VYTDYIYQGPMILVLLINFIF-LFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTR---VSFHSIKQS 412          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Human
Match: CRHR1 (corticotropin releasing hormone receptor 1 [Source:NCBI gene;Acc:1394])

HSP 1 Score: 166.007 bits (419), Expect = 6.201e-45
Identity = 126/409 (30.81%), Postives = 192/409 (46.94%), Query Frame = 3
Query:  192 DDLCRALYELVGKNTTNALCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN-----KIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQA------SNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKI-LTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            D  C +L      +  + L C  S D     W  + +  +  + CP       YN   N  R CLANG WA + NY  C  + N     K+ YHV +   ++G+ IS +AL +A +LF   RS+RC+RN IH NLI ++I+R  TW+++   Q+T +  P    +      L + A      +N+ WMF EG YL   IV TY  D+L+ W +  IGWG P  +    AI     +N  + WF                    I     +L ++I  +F      +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF       +      I   + L S QGFFV++ YCFLN EVR  ++ ++  ++      +R  + +   T P R    +F  +KQ 
Sbjct:   27 DQHCESLSL---ASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVV---QLTMS--PEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDN-EKCWFGKRPG----------VYTDYIYQGPMILVLLINFIF-LFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTR---VSFHSIKQS 412          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Human
Match: CRHR1 (corticotropin releasing hormone receptor 1 [Source:HGNC Symbol;Acc:HGNC:2357])

HSP 1 Score: 163.696 bits (413), Expect = 1.787e-44
Identity = 120/374 (32.09%), Postives = 183/374 (48.93%), Query Frame = 3
Query:  294 ISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN-----KIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQA------SNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKI-LTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            +S ++  Q C   SL    N  +N  R CLANG WA + NY  C  + N     K+ YHV +   ++G+ IS +AL +A +LF   RS+RC+RN IH NLI ++I+R  TW+++   Q+T +  P    +      L + A      +N+ WMF EG YL   IV TY  D+L+ W +  IGWG P  +    AI     +N  + WF                    I     +L ++I  +F      +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF       +      I   + L S QGFFV++ YCFLN EVR  ++ ++  ++      +R  + +   T P R    +F  +KQ 
Sbjct:   21 VSASLQDQHCESLSLAS--NISDNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVV---QLTMS--PEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDN-EKCWFGKRPG----------VYTDYIYQGPMILVLLINFIF-LFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTR---VSFHSIKQS 372          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Human
Match: CRHR1 (corticotropin releasing hormone receptor 1 [Source:HGNC Symbol;Acc:HGNC:2357])

HSP 1 Score: 163.696 bits (413), Expect = 1.787e-44
Identity = 120/374 (32.09%), Postives = 183/374 (48.93%), Query Frame = 3
Query:  294 ISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN-----KIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQA------SNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKI-LTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            +S ++  Q C   SL    N  +N  R CLANG WA + NY  C  + N     K+ YHV +   ++G+ IS +AL +A +LF   RS+RC+RN IH NLI ++I+R  TW+++   Q+T +  P    +      L + A      +N+ WMF EG YL   IV TY  D+L+ W +  IGWG P  +    AI     +N  + WF                    I     +L ++I  +F      +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF       +      I   + L S QGFFV++ YCFLN EVR  ++ ++  ++      +R  + +   T P R    +F  +KQ 
Sbjct:   21 VSASLQDQHCESLSLAS--NISDNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVV---QLTMS--PEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDN-EKCWFGKRPG----------VYTDYIYQGPMILVLLINFIF-LFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTR---VSFHSIKQS 372          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 98.5969 bits (244), Expect = 1.605e-21
Identity = 99/401 (24.69%), Postives = 180/401 (44.89%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPG-KSLKPYYNDKENITRMCLANGVWAKK------------SNYDRC-------IMMPNKIEYHVIATW---------FVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIV---------PQITTTDWPXXXXXXXXXXXLF-----SQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFN-ESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCL----FMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQ 1310
            C  +YD    W  T +N+  T +CP  K L P     +NIT+ C  +GVW+ +            +N+  C       IM     E   IA           FVG  +S ++L +A+ +F YFR LR  RN +H +L+++ ++ V    ++ +         P   + +             +F      +   + WMF+EG YL   IV+ +   + K+  Y + G+G P + + +  + + + ++F  E    S   +P + +I+  P +  ++ N+F +  +I  ++ K++++       +S+  L     +K++KAA +L+PLLG+ + +    F     ++     +    +     QG  VA IYCF N+EV  VLK  Y  +R    S +  R+
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPHMKGLDP----NKNITKDCHVSGVWSGRNAGEMGPTLPGWTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEP-EFWILDGPRMAELVINLFFICNVIRVLYSKVRESN-----NTSEAGL-----KKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRR 459          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 98.5969 bits (244), Expect = 1.605e-21
Identity = 99/401 (24.69%), Postives = 180/401 (44.89%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPG-KSLKPYYNDKENITRMCLANGVWAKK------------SNYDRC-------IMMPNKIEYHVIATW---------FVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIV---------PQITTTDWPXXXXXXXXXXXLF-----SQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFN-ESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCL----FMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQ 1310
            C  +YD    W  T +N+  T +CP  K L P     +NIT+ C  +GVW+ +            +N+  C       IM     E   IA           FVG  +S ++L +A+ +F YFR LR  RN +H +L+++ ++ V    ++ +         P   + +             +F      +   + WMF+EG YL   IV+ +   + K+  Y + G+G P + + +  + + + ++F  E    S   +P + +I+  P +  ++ N+F +  +I  ++ K++++       +S+  L     +K++KAA +L+PLLG+ + +    F     ++     +    +     QG  VA IYCF N+EV  VLK  Y  +R    S +  R+
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPHMKGLDP----NKNITKDCHVSGVWSGRNAGEMGPTLPGWTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEP-EFWILDGPRMAELVINLFFICNVIRVLYSKVRESN-----NTSEAGL-----KKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRR 459          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 98.2117 bits (243), Expect = 2.031e-21
Identity = 99/401 (24.69%), Postives = 180/401 (44.89%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPG-KSLKPYYNDKENITRMCLANGVWAKK------------SNYDRC-------IMMPNKIEYHVIATW---------FVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIV---------PQITTTDWPXXXXXXXXXXXLF-----SQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFN-ESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCL----FMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQ 1310
            C  +YD    W  T +N+  T +CP  K L P     +NIT+ C  +GVW+ +            +N+  C       IM     E   IA           FVG  +S ++L +A+ +F YFR LR  RN +H +L+++ ++ V    ++ +         P   + +             +F      +   + WMF+EG YL   IV+ +   + K+  Y + G+G P + + +  + + + ++F  E    S   +P + +I+  P +  ++ N+F +  +I  ++ K++++       +S+  L     +K++KAA +L+PLLG+ + +    F     ++     +    +     QG  VA IYCF N+EV  VLK  Y  +R    S +  R+
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPHMKGLDP----NKNITKDCHVSGVWSGRNAGEMGPTLPGWTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEP-EFWILDGPRMAELVINLFFICNVIRVLYSKVRESN-----NTSEAGL-----KKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRR 459          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 98.2117 bits (243), Expect = 2.031e-21
Identity = 99/401 (24.69%), Postives = 180/401 (44.89%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPG-KSLKPYYNDKENITRMCLANGVWAKK------------SNYDRC-------IMMPNKIEYHVIATW---------FVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIV---------PQITTTDWPXXXXXXXXXXXLF-----SQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFN-ESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCL----FMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQ 1310
            C  +YD    W  T +N+  T +CP  K L P     +NIT+ C  +GVW+ +            +N+  C       IM     E   IA           FVG  +S ++L +A+ +F YFR LR  RN +H +L+++ ++ V    ++ +         P   + +             +F      +   + WMF+EG YL   IV+ +   + K+  Y + G+G P + + +  + + + ++F  E    S   +P + +I+  P +  ++ N+F +  +I  ++ K++++       +S+  L     +K++KAA +L+PLLG+ + +    F     ++     +    +     QG  VA IYCF N+EV  VLK  Y  +R    S +  R+
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPHMKGLDP----NKNITKDCHVSGVWSGRNAGEMGPTLPGWTNFTMCYTDEVIYIMQNLNNESLTIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEP-EFWILDGPRMAELVINLFFICNVIRVLYSKVRESN-----NTSEAGL-----KKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRR 459          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 94.3597 bits (233), Expect = 3.200e-20
Identity = 93/391 (23.79%), Postives = 175/391 (44.76%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPG-KSLKPYYNDKENITRMCLANGVWAKK-----------SNYDRCIMM-------PNKIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIV---------PQITTTDWPXXXXXXXXXXXLF-----SQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFN-ESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCL----FMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQ 1310
            C  +YD    W  T +N+  T +CP  K L P     + I + C   G WA K           +N+  C  +         ++  +     FVG  +S ++L +A+ +F YFR LR  RN +H +L+++ ++ V    ++ +         P   + +             +F      +   + WMF+EG YL   IV+ +   + K+  Y + G+G P + + +  + + + ++F  E    S   +P + +I+  P +  ++ N+F +  +I  ++ K++++       +S+  L     +K++KAA +L+PLLG+ + +    F     ++     +    +     QG  VA IYCF N+EV  VLK  Y  +R    S +  R+
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPHMKGLDP----NKYIVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVTFCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEP-EFWILDGPRMAELVINLFFICNVIRVLYSKVRESN-----NTSEAGL-----KKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEVNHVLKTFYARYRLLHKSQNELRR 449          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Fly
Match: Dh44-R2 (gene:FBgn0033744 transcript:FBtr0087936)

HSP 1 Score: 174.866 bits (442), Expect = 5.883e-48
Identity = 117/367 (31.88%), Postives = 185/367 (50.41%), Query Frame = 3
Query:  207 ALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC-------IMMPN---KIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFR 1277
            A  E +       L CP S+D    W  T + ++A   C  +    +Y+  +N TR C  NG W   S+YDRC        ++P+    +E   I  +  GY +S   L +ALI+F  F+ LRC+RN IH NL ++YI     W L +  Q+ TT+          I+  +   +N+ WMFVEG YL  ++V T+  D +    Y+LIGWG P +   + +I+ A   +     FN  +     +   HI  +  + A++ +L  +++ +    +   + +T+  S  +L + +Y KA KA  VLIPL GI + L +   +    ++ ++ + A L STQGFFVAL YCFLN EVR  L+  +  +R
Sbjct:   69 ASLEALASGGKRILQCPSSFDSVLCWPRTNAGSLAVLPCFEEFKGVHYDTTDNATRFCFPNGTWDHYSDYDRCHQNSGSIPVVPDFSPNVELPAI-IYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLI----RIMWVLITKLRSAHTLETRQYYKASKALLVLIPLFGITYLLVLTGPEQGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWR 430          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Fly
Match: Dh44-R2 (gene:FBgn0033744 transcript:FBtr0113075)

HSP 1 Score: 174.481 bits (441), Expect = 6.438e-48
Identity = 117/367 (31.88%), Postives = 185/367 (50.41%), Query Frame = 3
Query:  207 ALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC-------IMMPN---KIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFR 1277
            A  E +       L CP S+D    W  T + ++A   C  +    +Y+  +N TR C  NG W   S+YDRC        ++P+    +E   I  +  GY +S   L +ALI+F  F+ LRC+RN IH NL ++YI     W L +  Q+ TT+          I+  +   +N+ WMFVEG YL  ++V T+  D +    Y+LIGWG P +   + +I+ A   +     FN  +     +   HI  +  + A++ +L  +++ +    +   + +T+  S  +L + +Y KA KA  VLIPL GI + L +   +    ++ ++ + A L STQGFFVAL YCFLN EVR  L+  +  +R
Sbjct:   69 ASLEALASGGKRILQCPSSFDSVLCWPRTNAGSLAVLPCFEEFKGVHYDTTDNATRFCFPNGTWDHYSDYDRCHQNSGSIPVVPDFSPNVELPAI-IYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLI----RIMWVLITKLRSAHTLETRQYYKASKALLVLIPLFGITYLLVLTGPEQGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWR 430          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Fly
Match: Dh44-R1 (gene:FBgn0033932 transcript:FBtr0087485)

HSP 1 Score: 167.162 bits (422), Expect = 4.844e-45
Identity = 131/396 (33.08%), Postives = 198/396 (50.00%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMP---NKIEYHVIAT-----WFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENF--------NESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMF-ESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLK---AKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQDY 1379
            C   +D    W  T   T+A  +C  +    +Y+  +N TR C ANG W K +NYD C  +P   +  E+ VI       +++GYT+S ++L +ALI+F YF+ LRC+RN IH NL  +YI+    W L++  QI+      + + + T+   F+  +N+ WM VEG YL +++V T+  D L+   Y+ IGWG P L     A++ +LT  +        N  W   +       +I   P+   +I N+  L  I++ +  KL+      TR          +YRKA KA  VLIPL GI + + +   S+S      + +L A+L STQGF V+L YCFLN EVR  L+   + +R  R    + +R   T   S G       + RPL   Y
Sbjct:   53 CLTQFDSILCWPRTARGTLAVLQCMDELQGIHYDSSKNATRFCHANGTWEKYTNYDACAHLPAPESVPEFEVIVELPTIIYYIGYTLSLVSLSLALIVFAYFKELRCLRNTIHANLFFTYIMSALFWILLLSVQISIRSGVGSCIALITLFHFFT-LTNFFWMLVEGLYLYMLVVKTFSGDNLRFNIYASIGWGGPALFVVTWAVAKSLTVTYSTPEKYEINCPWMQETHVD----WIYQGPVCAVLIINLTFLLRIMWVLITKLRSANTVETR----------QYRKAAKALLVLIPLFGITYLVVLAGPSESGLMGHMFAVLRAVLLSTQGFSVSLFYCFLNSEVRNALRHHISTWRDTRTIQLNQNRRYTTKSFSKGGGSPRAESMRPLTSYY 433          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Fly
Match: hec (gene:FBgn0030437 transcript:FBtr0343652)

HSP 1 Score: 108.997 bits (271), Expect = 5.798e-25
Identity = 115/421 (27.32%), Postives = 199/421 (47.27%), Query Frame = 3
Query:  144 LSNGYLEMSNI--SIIELDDLCRALYE--LVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKK-------SNYDRCIMMPNKIEYHVIATWFV-GYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYI---VRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNES-WFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDA-YKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYL----PSASRTRQTIDDSTGPVRR 1343
            ++ G ++M N+   + E ++L   +    +      N L CP ++DG+  W  T + TV +Q CP       +N K    + CL NG W +        SNY  C+   +      I   +V GY +S +AL I++I+F  F+SLRC R  IH +L  S     V    WY ++V +  T            +++ +    NY WMF EG +L +++V  +  D + M  + +I W  P  ++ +  ++   +   N+  W   S    L L+I  +PI +S++A+   L  ++  + +KL     P + + + L++     RKA++A  +L+PL G+ H L  +   +    D  Y++L+ +L S QGF V+ ++CF N +V F ++         L    P+ S T Q    +T P R 
Sbjct:   80 MNEGVIDMRNVDEELAEKEELMATVVSATMATNQKENRLFCPLNFDGYLCWPRTPAGTVLSQYCP--DFVEGFNRKFLAHKTCLENGSWYRHPVSNQTWSNYTNCVDYEDLEFRQFINELYVKGYALSLLALLISIIIFLGFKSLRCTRIRIHVHLFASLACTCVAWILWYRLVVERSETIAENPLWCIGLHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVKDTIVMRWFIVISWFSPIPIAIVYGLARHFSSPDNKHCWITDS----LYLWIFSVPITLSLLASFIFLINVLRVIVRKLH----PQSAQPAPLAI-----RKAVRATIILVPLFGLQHFLLPYRPDAGTQLDHFYQMLSVVLVSLQGFVVSFLFCFANHDVTFAIRTLLNKLLPSLVTPPPAGSNTGQMA--TTTPSRE 483          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Fly
Match: hec (gene:FBgn0030437 transcript:FBtr0073753)

HSP 1 Score: 108.997 bits (271), Expect = 5.798e-25
Identity = 115/421 (27.32%), Postives = 199/421 (47.27%), Query Frame = 3
Query:  144 LSNGYLEMSNI--SIIELDDLCRALYE--LVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKK-------SNYDRCIMMPNKIEYHVIATWFV-GYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYI---VRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNES-WFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDA-YKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYL----PSASRTRQTIDDSTGPVRR 1343
            ++ G ++M N+   + E ++L   +    +      N L CP ++DG+  W  T + TV +Q CP       +N K    + CL NG W +        SNY  C+   +      I   +V GY +S +AL I++I+F  F+SLRC R  IH +L  S     V    WY ++V +  T            +++ +    NY WMF EG +L +++V  +  D + M  + +I W  P  ++ +  ++   +   N+  W   S    L L+I  +PI +S++A+   L  ++  + +KL     P + + + L++     RKA++A  +L+PL G+ H L  +   +    D  Y++L+ +L S QGF V+ ++CF N +V F ++         L    P+ S T Q    +T P R 
Sbjct:   80 MNEGVIDMRNVDEELAEKEELMATVVSATMATNQKENRLFCPLNFDGYLCWPRTPAGTVLSQYCP--DFVEGFNRKFLAHKTCLENGSWYRHPVSNQTWSNYTNCVDYEDLEFRQFINELYVKGYALSLLALLISIIIFLGFKSLRCTRIRIHVHLFASLACTCVAWILWYRLVVERSETIAENPLWCIGLHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVKDTIVMRWFIVISWFSPIPIAIVYGLARHFSSPDNKHCWITDS----LYLWIFSVPITLSLLASFIFLINVLRVIVRKLH----PQSAQPAPLAI-----RKAVRATIILVPLFGLQHFLLPYRPDAGTQLDHFYQMLSVVLVSLQGFVVSFLFCFANHDVTFAIRTLLNKLLPSLVTPPPAGSNTGQMA--TTTPSRE 483          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Zebrafish
Match: crhr1 (corticotropin releasing hormone receptor 1 [Source:ZFIN;Acc:ZDB-GENE-081231-1])

HSP 1 Score: 179.104 bits (453), Expect = 8.653e-50
Identity = 136/405 (33.58%), Postives = 200/405 (49.38%), Query Frame = 3
Query:  210 LYELVGKNTTNA--LCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN-----KIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQA------SNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKY-QDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            L+      TTN+  L C  S DG    W  + +  V ++ CP   L   YN   N+ R CLANG WAKK NY +C  + N     K+ YH+ +   ++G+ IS  AL +A ILF   RS+RC+RN IH NLI ++I+R  TW+++   Q+T    P    +      L + A      +N+ WMF EG YL   IV TY  DKL+ W +  IGW  P  +    AI     +N  + WF   +A     YI   P+++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF       +  Q  +    + L S QGFFV++ YCFLN EVR  ++ ++  ++      +R  + +   T P R    +F  +KQ 
Sbjct:   43 LWNQTSSPTTNSTGLFCNTSIDGIGTCWPRSSAGEVVSRPCPESFLGVRYNTTNNVYRECLANGTWAKKGNYSQCQEILNEEKKSKLHYHIAVIINYLGHCISLGALLVAFILFMRLRSIRCLRNIIHWNLITAFILRNATWFVV---QLTMN--PEVHESNVIWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDN-EKCWF-GKRAGIYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEISQIVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHSIRARVARAMSIPTSPTR---VSFHSIKQS 427          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Zebrafish
Match: CRHR2 (corticotropin-releasing factor receptor 2 [Source:NCBI gene;Acc:100335005])

HSP 1 Score: 151.369 bits (381), Expect = 1.145e-40
Identity = 118/344 (34.30%), Postives = 173/344 (50.29%), Query Frame = 3
Query:  372 RMCLANGVWAKKSNYDRCIMM-------PNKIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLI-IVPQ-ITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFE-SKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQ 1373
            R CL NG WA KSNY  C  +       P   +  +I  +F G+ +S  AL IA ILF   RS+RC+RN IH NLI ++I+R   W+L+ +V Q I  T+ P   +  T     +   +N+ WMFVEG YL   IV TY  DKL+ W +  IGW  P  +  + AI+    EN  + WF     K +        IL+ +I  VF+  ++           +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF     +    Q  +    + L S QGFFV++ YCFLN EVR   + ++  ++       R  + +   T P R    +F  +KQ
Sbjct:    5 RECLENGTWALKSNYSNCEPILEEKRKYPMHYKIALIINYF-GHCVSVGALIIAFILFLCLRSIRCLRNIIHWNLITTFILRNVMWFLLQLVDQNIYETNEPWCRLITTIYN--YFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIIVWAIAKLYNEN-EQCWFGKEPGKYVDYIYQGPVILVLLINFVFLFNIV-----------RILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARKRWHRWQDNHALRVRVARAMSIPTSPTR---ISFHSIKQ 330          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Zebrafish
Match: calcrla (calcitonin receptor-like a [Source:NCBI gene;Acc:445508])

HSP 1 Score: 127.102 bits (318), Expect = 5.395e-31
Identity = 119/412 (28.88%), Postives = 196/412 (47.57%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYND---KENITRMCLANGVWAKK-------SNYDRCIMMPNKIEYHVIATWF---VGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVR---VFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYL-LIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFR----------GYLPSASRTRQTIDDSTGPVR-RGNSAFRPLK--QDYDNNVFK 1397
            C  ++DG+  W  T +   + Q CP      Y+ D    E +T++C  +G W          +N+ RC +   +     +  ++   +G+ +S  +L+I+L +F +F+SL C R  +H NL  S+++       W   +               I+  I L+    NY WM  EG YL  +I+V  +   +  MW+Y L+GWGFP + ++I A++ +   N N  W +S+ +    LYIIH PI  +++ N+F L  I+  +  KLK     VT ++      S+ Y KA++A  +L+PLLGI + L  ++       + Y  +  IL   QG  VA I+CF N EV+ VL+  +  +R            L SAS T  +I +  G     G++     K   D+DN + K
Sbjct:   77 CNRTWDGWLCWDDTEAGITSEQHCPD-----YFQDFDPTEMVTKICTESGQWFLHPESNRTWTNFTRCNLHTTEGRRTAMNLFYLALIGHGLSLTSLFISLGIFFHFKSLSCQRITLHKNLFFSFVLNSIITIIWLTAVANNQELVQQNPISCKISQFIHLYIFGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYY-LLGWGFPLIPATIHAVARSYYYNDN-CWISSNTSL---LYIIHGPICAAMLVNLFFLLNIVRVLITKLK-----VTHQAE-----SSLYMKAVRATLILVPLLGIQYVLLPYKPSGRVSAEIYDYIMHILMHYQGLLVATIFCFFNGEVQAVLRRHWNQYRIQFGSTITQSDALRSASYTASSITEVQGCYSIDGHTEHLNGKNYHDFDNAIIK 468          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Zebrafish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 121.709 bits (304), Expect = 7.321e-29
Identity = 113/388 (29.12%), Postives = 179/388 (46.13%), Query Frame = 3
Query:  228 KNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKS-------NYDRCI-MMPN-------KIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWY-----------LIIVPQITTTDWPXXXXX------------XXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKIL-------TAILTSTQGFFVALIYCFLNREVRFVLK 1256
            K+ T+   C P +DG   W   +   + +  CP       +N K +  R C  NG W   S       NY  C    P+       ++   +   + VGY+IS  +L +A ++  YFR L C RN IH +L +S+++R  + +           L  + +IT  D                   +   + L+  A+NY W+ VEG YL  +I  T+  D+  +W ++LIGWG P +  +I A   A   +  E W     A  LK +I+ IPIL +I+ N  +   II  +  KL++T     R  ++      +YRK +K+  VL+PL G+ + +FM    ++ Y +   +L         +  S QGFFVA+IYCF N EV+  +K
Sbjct:   55 KHKTSEGSCLPEWDGILCWPEGVPGKMVSTSCPEYIYD--FNHKGHAYRRCDLNGTWELASHNNKTWANYSECAKFFPHYNQNQEREVFDRLYLIYTVGYSISLGSLMVATVILGYFRRLHCTRNYIHMHLFLSFMLRAISIFVKDVVLYSGSALQEMERITVEDLKSITEAPPANKTQFIGCKVAVTLFLYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAMFVTIWASVRATLAD-TECW--DLSAGNLK-WIVQIPILTAIVVNFLLFLNIIRVLATKLRETN--AGRCDTR-----QQYRKLLKSTLVLMPLFGVHYIVFM----AMPYTEVSGVLWQIQMHYEMLFNSVQGFFVAIIYCFCNGEVQAEIK 425          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Zebrafish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 121.324 bits (303), Expect = 7.419e-29
Identity = 112/388 (28.87%), Postives = 177/388 (45.62%), Query Frame = 3
Query:  228 KNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKS-------NYDRCIM--------MPNKIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWY-----------LIIVPQITTTDWPXXXXX------------XXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKIL-------TAILTSTQGFFVALIYCFLNREVRFVLK 1256
            K+ T+   C P +DG   W   +   + +  CP       +N K +  R C  NG W   S       NY  C             ++   +   + VGY+IS  +L +A ++  YFR L C RN IH +L +S+++R  + +           L  + +IT  D                   +   + L+  A+NY W+ VEG YL  +I  T+  D+  +W ++LIGWG P +  +I A   A   +  E W     A  LK +I+ IPIL +I+ N  +   II  +  KL++T     R  ++      +YRK +K+  VL+PL G+ + +FM    ++ Y +   +L         +  S QGFFVA+IYCF N EV+  +K
Sbjct:   30 KHKTSEGSCLPEWDGILCWPEGVPGKMVSTSCPEYIYD--FNHKGHAYRRCDLNGTWELASHNNKTWANYSECAKFFPHYNQNQEREVFDRLYLIYTVGYSISLGSLMVATVILGYFRRLHCTRNYIHMHLFLSFMLRAISIFVKDVVLYSGSALQEMERITVEDLKSITEAPPANKTQFIGCKVAVTLFLYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAMFVTIWASVRATLAD-TECW--DLSAGNLK-WIVQIPILTAIVVNFLLFLNIIRVLATKLRETN--AGRCDTR-----QQYRKLLKSTLVLMPLFGVHYIVFM----AMPYTEVSGVLWQIQMHYEMLFNSVQGFFVAIIYCFCNGEVQAEIK 400          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Xenopus
Match: slc17a9 (solute carrier family 17 member 9 [Source:Xenbase;Acc:XB-GENE-5753894])

HSP 1 Score: 166.007 bits (419), Expect = 4.643e-45
Identity = 124/402 (30.85%), Postives = 192/402 (47.76%), Query Frame = 3
Query:  189 LDDLCRALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCI-MMPNKIEYHV-----IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFE-SKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQ 1373
            L+  C AL  L   N T   C          W  +I+  +  + CP       YN   ++TR C  NG WA   NY +C+ ++ NK +Y +     +   ++G+ IS +AL IA +LF   RS+RC+RN IH NLI ++I+R   W+L+ +      +         T I  +   +N+ WMFVEG YL   IV TY  DKL+ W +  IGW  P+ +    A+     EN  + W      K +        IL+ +I  VF+  ++           +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF     +    Q  +    + L S QGFFV++ YCFLN EVR   + ++  ++ +     R  + +   T P R    +F  +KQ
Sbjct:   28 LERYCEALSAL--YNITGPYCSATIDQIGTCWPRSIAGGLVERPCPDSFNGIRYNTTRSVTRECFENGTWASWMNYSQCVPILDNKRKYALHYKIALIINYLGHCISVLALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLLQMIDHRIHESNEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPSPIIVTWAVCKLFYEN-EQCWIGKEPGKYIDYIYQGPVILVLLINFVFLFNIV-----------RILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVSQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARKRWHRWQDHHSLRVRVARAMSIPTSPTR---ISFHSIKQ 412          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Xenopus
Match: slc17a9 (solute carrier family 17 member 9 [Source:Xenbase;Acc:XB-GENE-5753894])

HSP 1 Score: 165.622 bits (418), Expect = 4.955e-45
Identity = 126/409 (30.81%), Postives = 195/409 (47.68%), Query Frame = 3
Query:  171 NISIIELDDLCRALYELVGKNTTNALCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCI-MMPNKIEYHV-----IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFE-SKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQ 1373
             I I E +  C  L     K T   L  P + D     W  +I+  +  + CP       YN   ++TR C  NG WA   NY +C+ ++ NK +Y +     +   ++G+ IS +AL IA +LF   RS+RC+RN IH NLI ++I+R   W+L+ +      +         T I  +   +N+ WMFVEG YL   IV TY  DKL+ W +  IGW  P+ +    A+     EN  + W      K +        IL+ +I  VF+  ++           +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF     +    Q  +    + L S QGFFV++ YCFLN EVR   + ++  ++ +     R  + +   T P R    +F  +KQ
Sbjct:    7 EIIIDEFEGNCSLLDFFQDKRT--GLEIPATIDQIGTCWPRSIAGGLVERPCPDSFNGIRYNTTRSVTRECFENGTWASWMNYSQCVPILDNKRKYALHYKIALIINYLGHCISVLALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLLQMIDHRIHESNEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPSPIIVTWAVCKLFYEN-EQCWIGKEPGKYIDYIYQGPVILVLLINFVFLFNIV-----------RILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVSQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARKRWHRWQDHHSLRVRVARAMSIPTSPTR---ISFHSIKQ 398          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Xenopus
Match: yif1b (Yip1 interacting factor homolog B, membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-922881])

HSP 1 Score: 165.236 bits (417), Expect = 9.797e-45
Identity = 128/414 (30.92%), Postives = 194/414 (46.86%), Query Frame = 3
Query:  171 NISIIELDDLCRALYELVGKNTTNALCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMM-----PNKIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQ----ASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKI-LTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            + ++  L D C  L      +    L C  S D     W  T +  +  + CP       YN   N+ R C  NG WA + +Y +C  +       K+ YH+ I   F+G++IS  AL +A ILF   RS+RC+RN IH NLI ++I+R  TW+   V Q+T +        +   ++  +      +N+ WMF EG YL   IV TY  DKL+ W +  IGW  P  +    AI     +N  + WF   KA     +I   P+++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF       +      I   + L S QGFFV++ YCFLN EVR  ++ ++  ++      +R  + +   T P R    +F  +KQ 
Sbjct:   20 SFALTSLQDQCETLQH---NSNVTGLACNASIDMIGTCWPRTAAGQMVARPCPEYFQGVQYNTTGNVYRECHLNGSWAGRGDYTQCQEILKQEKKTKVHYHIAIVINFLGHSISLCALLVAFILFLRLRSIRCLRNIIHWNLITAFILRNVTWF---VMQLTLSHEAHDSNVVWCRLVTIAHNYFYVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDN-EKCWFG-KKAGVYTDFIYQGPVILVLLINFIFLFNIVRILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVTPGEDEISRVVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHSIRARVARAMSIPTSPTR---ISFHSIKQS 412          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Xenopus
Match: yif1b (Yip1 interacting factor homolog B, membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-922881])

HSP 1 Score: 164.081 bits (414), Expect = 1.358e-44
Identity = 125/392 (31.89%), Postives = 188/392 (47.96%), Query Frame = 3
Query:  234 TTNALCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMM----PNKIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQ----ASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKI-LTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            + N L C  S D     W  T +  +  + CP       YN   N+ R C  NG WA + +Y +C  +      K+ YH+ I   F+G++IS  AL +A ILF   RS+RC+RN IH NLI ++I+R  TW+   V Q+T +        +   ++  +      +N+ WMF EG YL   IV TY  DKL+ W +  IGW  P  +    AI     +N  + WF   KA     +I   P+++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF       +      I   + L S QGFFV++ YCFLN EVR  ++ ++  ++      +R  + +   T P R    +F  +KQ 
Sbjct:   11 SNNCLACNASIDMIGTCWPRTAAGQMVARPCPEYFQGVQYNTTGNVYRECHLNGSWAGRGDYTQCQEILKQEKTKVHYHIAIVINFLGHSISLCALLVAFILFLRLRSIRCLRNIIHWNLITAFILRNVTWF---VMQLTLSHEAHDSNVVWCRLVTIAHNYFYVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDN-EKCWFG-KKAGVYTDFIYQGPVILVLLINFIFLFNIVRILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVTPGEDEISRVVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHSIRARVARAMSIPTSPTR---ISFHSIKQS 384          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Xenopus
Match: slc17a9 (solute carrier family 17 member 9 [Source:Xenbase;Acc:XB-GENE-5753894])

HSP 1 Score: 164.081 bits (414), Expect = 1.737e-44
Identity = 116/371 (31.27%), Postives = 183/371 (49.33%), Query Frame = 3
Query:  282 WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCI-MMPNKIEYHV-----IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFE-SKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQ 1373
            W  +I+  +  + CP       YN   ++TR C  NG WA   NY +C+ ++ NK +Y +     +   ++G+ IS +AL IA +LF   RS+RC+RN IH NLI ++I+R   W+L+ +      +         T I  +   +N+ WMFVEG YL   IV TY  DKL+ W +  IGW  P+ +    A+     EN  + W      K +        IL+ +I  VF+  ++           +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF     +    Q  +    + L S QGFFV++ YCFLN EVR   + ++  ++ +     R  + +   T P R    +F  +KQ
Sbjct:   43 WPRSIAGGLVERPCPDSFNGIRYNTTRSVTRECFENGTWASWMNYSQCVPILDNKRKYALHYKIALIINYLGHCISVLALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLLQMIDHRIHESNEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPSPIIVTWAVCKLFYEN-EQCWIGKEPGKYIDYIYQGPVILVLLINFVFLFNIV-----------RILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVSQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARKRWHRWQDHHSLRVRVARAMSIPTSPTR---ISFHSIKQ 398          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Mouse
Match: Crhr1 (corticotropin releasing hormone receptor 1 [Source:MGI Symbol;Acc:MGI:88498])

HSP 1 Score: 168.703 bits (426), Expect = 4.503e-46
Identity = 126/409 (30.81%), Postives = 193/409 (47.19%), Query Frame = 3
Query:  192 DDLCRALYELVGKNTTNALCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN-----KIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQA------SNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKI-LTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            D  C +L      +  + L C  S D     W  + +  +  + CP       YN   N  R CLANG WA + NY  C  + N     K+ YH+ +   ++G+ IS +AL +A +LF   RS+RC+RN IH NLI ++I+R  TW+++   Q+T +  P    +      L + A      +N+ WMF EG YL   IV TY  D+L+ W +  IGWG P  +    AI     +N  + WF                    I     +L ++I  +F      +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF       +      I   + L S QGFFV++ YCFLN EVR  ++ ++R ++      +R  + +   T P R    +F  +KQ 
Sbjct:   27 DQQCESLSL---ASNVSGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHIAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVV---QLTVS--PEVHQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLYYDN-EKCWFGKRPG----------VYTDYIYQGPMILVLLINFIF-LFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTR---VSFHSIKQS 412          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 154.451 bits (389), Expect = 5.073e-41
Identity = 114/371 (30.73%), Postives = 176/371 (47.44%), Query Frame = 3
Query:  282 WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC-IMMPNKIEYHV-----IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKY-QDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQ 1373
            W  +    +  + CP       YN   N  R CL NG WA + NY  C  ++ +K +Y +     +   ++G+ +S +AL  A +LF   RS+RC+RN IH NLI ++I+R   W+L+ +      +         T I  +   +N+ WMFVEG YL   IV TY  + L+ W +  IGW  P  +    A+     EN  + WF   +A  L  YI   P+++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF          Q  +    + L S QGFFV++ YCF N EVR  L+ ++  ++ +        + +   T P R    +F  +KQ
Sbjct:   51 WPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYEN-EQCWF-GKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRKRWHRWQDHHALRVPVARAMSIPTSPTR---ISFHSIKQ 406          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 154.451 bits (389), Expect = 9.022e-41
Identity = 114/371 (30.73%), Postives = 176/371 (47.44%), Query Frame = 3
Query:  282 WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC-IMMPNKIEYHV-----IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKY-QDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQ 1373
            W  +    +  + CP       YN   N  R CL NG WA + NY  C  ++ +K +Y +     +   ++G+ +S +AL  A +LF   RS+RC+RN IH NLI ++I+R   W+L+ +      +         T I  +   +N+ WMFVEG YL   IV TY  + L+ W +  IGW  P  +    A+     EN  + WF   +A  L  YI   P+++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF          Q  +    + L S QGFFV++ YCF N EVR  L+ ++  ++ +        + +   T P R    +F  +KQ
Sbjct:   71 WPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYEN-EQCWF-GKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRKRWHRWQDHHALRVPVARAMSIPTSPTR---ISFHSIKQ 426          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 153.295 bits (386), Expect = 1.323e-40
Identity = 114/372 (30.65%), Postives = 176/372 (47.31%), Query Frame = 3
Query:  282 WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC--IMMPNKIEYHV-----IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFE-SKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQ 1373
            W  +    +  + CP       YN   N  R CL NG WA + NY  C  I+   + +Y +     +   ++G+ +S +AL  A +LF   RS+RC+RN IH NLI ++I+R   W+L+ +      +         T I  +   +N+ WMFVEG YL   IV TY  + L+ W +  IGW  P  +    A+     EN  + WF   +A  L  YI   P+++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF     +    Q  +    + L S QGFFV++ YCF N EVR  L+ ++  ++ +        + +   T P R    +F  +KQ
Sbjct:   51 WPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYEN-EQCWF-GKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRKRWHRWQDHHALRVPVARAMSIPTSPTR---ISFHSIKQ 407          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 152.91 bits (385), Expect = 2.639e-40
Identity = 114/372 (30.65%), Postives = 175/372 (47.04%), Query Frame = 3
Query:  282 WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC--IMMPNKIEYHV-----IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKY-QDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQ 1373
            W  +    +  + CP       YN   N  R CL NG WA + NY  C  I+   + +Y +     +   ++G+ +S +AL  A +LF   RS+RC+RN IH NLI ++I+R   W+L+ +      +         T I  +   +N+ WMFVEG YL   IV TY  + L+ W +  IGW  P  +    A+     EN  + WF   +A  L  YI   P+++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF          Q  +    + L S QGFFV++ YCF N EVR  L+ ++  ++ +        + +   T P R    +F  +KQ
Sbjct:   71 WPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYEN-EQCWF-GKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRKRWHRWQDHHALRVPVARAMSIPTSPTR---ISFHSIKQ 427          
BLAST of Corticotropin-releasing factor receptor 1 vs. UniProt/SwissProt
Match: sp|P35353|CRFR1_RAT (Corticotropin-releasing factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Crhr1 PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.706e-45
Identity = 124/393 (31.55%), Postives = 193/393 (49.11%), Query Frame = 3
Query:  231 NTTNALCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN-----KIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLI---IVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKI-LTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            +  + L C  S D     W  + +  +  + CP       YN   N  R CLANG WA + NY  C  + N     K+ YHV +   ++G+ IS +AL +A +LF   RS+RC+RN IH NLI ++I+R  TW+++   + P++  ++  +    + T    +   +N+ WMF EG YL   IV TY  D+L+ W +  IGWG P  +    AI     +N  + WF   +      YI   P+++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF       +      I   + L S QGFFV++ YCFLN EVR  ++ ++R ++      +R  + +   T P R    +F  +KQ 
Sbjct:   37 SNVSGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEVHQSN--VAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLHYDN-EKCWF-GKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTR---VSFHSIKQS 412          
BLAST of Corticotropin-releasing factor receptor 1 vs. UniProt/SwissProt
Match: sp|P35347|CRFR1_MOUSE (Corticotropin-releasing factor receptor 1 OS=Mus musculus OX=10090 GN=Crhr1 PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 3.150e-45
Identity = 126/409 (30.81%), Postives = 193/409 (47.19%), Query Frame = 3
Query:  192 DDLCRALYELVGKNTTNALCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN-----KIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQA------SNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKI-LTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            D  C +L      +  + L C  S D     W  + +  +  + CP       YN   N  R CLANG WA + NY  C  + N     K+ YH+ +   ++G+ IS +AL +A +LF   RS+RC+RN IH NLI ++I+R  TW+++   Q+T +  P    +      L + A      +N+ WMF EG YL   IV TY  D+L+ W +  IGWG P  +    AI     +N  + WF                    I     +L ++I  +F      +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF       +      I   + L S QGFFV++ YCFLN EVR  ++ ++R ++      +R  + +   T P R    +F  +KQ 
Sbjct:   27 DQQCESLSL---ASNVSGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHIAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVV---QLTVS--PEVHQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLYYDN-EKCWFGKRPG----------VYTDYIYQGPMILVLLINFIF-LFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTR---VSFHSIKQS 412          
BLAST of Corticotropin-releasing factor receptor 1 vs. UniProt/SwissProt
Match: sp|Q76LL8|CRFR1_MACMU (Corticotropin-releasing factor receptor 1 OS=Macaca mulatta OX=9544 GN=CRHR1 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 2.719e-44
Identity = 126/409 (30.81%), Postives = 192/409 (46.94%), Query Frame = 3
Query:  192 DDLCRALYELVGKNTTNALCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN-----KIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQA------SNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKI-LTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            D  C +L      +  + L C  S D     W  + +  +  + CP       YN   N  R CLANG WA + NY  C  + N     K+ YHV +   ++G+ IS +AL +A +LF   RS+RC+RN IH NLI ++I+R  TW+++   Q+T +  P    +      L + A      +N+ WMF EG YL   IV TY  D+L+ W +  IGWG P  +    AI     +N  + WF                    I     +L ++I  +F      +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF       +      I   + L S QGFFV++ YCFLN EVR  ++ ++  ++      +R  + +   T P R    +F  +KQ 
Sbjct:   27 DQHCESLSL---ASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVV---QLTMS--PEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDN-EKCWFGKRPG----------VYTDYIYQGPMILVLLINFIF-LFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTR---VSFHSIKQS 412          
BLAST of Corticotropin-releasing factor receptor 1 vs. UniProt/SwissProt
Match: sp|O42603|CRFR2_XENLA (Corticotropin-releasing factor receptor 2 OS=Xenopus laevis OX=8355 GN=crhr2 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 1.849e-43
Identity = 117/371 (31.54%), Postives = 182/371 (49.06%), Query Frame = 3
Query:  282 WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCI-MMPNKIEYHV-----IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFE-SKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQ 1373
            W  +++  +  + CP       YN   N+ R C  NG WA   NY +C+ ++ NK +Y +     +   ++G+ IS +AL IA +LF   RS+RC+RN IH NLI ++I+R   W+L+ +      +         T I  +   +N+ WMFVEG YL   IV TY  DKL+ W +  IGW  P+ +    AI     EN  + W      K +        IL+ +I  VF+  ++      ++  TK+  +  S  +     +YRKA+KA  VL+PLLGI + LF     +    Q  +    + L S QGFFV++ YCFLN EVR   + ++  ++ +     R  + +   T P R    +F  +KQ
Sbjct:   54 WPRSLAGELVERPCPDSFNGIRYNTTRNVYRECFENGTWASWMNYSQCVPILDNKRKYALHYKIALIINYLGHCISILALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLLQMIDHNIHESNEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPSPIIVTWAICKLFYEN-EQCWIGKEPGKYIDYIYQGRVILVLLINFVFLFNIV------RILMTKLRASTTSETI-----QYRKAVKATLVLLPLLGITYMLFFVNPGEDDVSQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARKRWHRWQDHHSLRVRVARAMSIPTSPTR---ISFHSIKQ 409          
BLAST of Corticotropin-releasing factor receptor 1 vs. UniProt/SwissProt
Match: sp|O42602|CRFR1_XENLA (Corticotropin-releasing factor receptor 1 OS=Xenopus laevis OX=8355 GN=crhr1 PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 2.914e-43
Identity = 128/414 (30.92%), Postives = 194/414 (46.86%), Query Frame = 3
Query:  171 NISIIELDDLCRALYELVGKNTTNALCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMM-----PNKIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQ----ASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKI-LTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            + ++  L D C  L      +    L C  S D     W  T +  +  + CP       YN   N+ R C  NG WA + +Y +C  +       K+ YH+ I   F+G++IS  AL +A ILF   RS+RC+RN IH NLI ++I+R  TW+   V Q+T +        +   ++  +      +N+ WMF EG YL   IV TY  DKL+ W +  IGW  P  +    AI     +N  + WF   KA     +I   P+++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF       +      I   + L S QGFFV++ YCFLN EVR  ++ ++  ++      +R  + +   T P R    +F  +KQ 
Sbjct:   20 SFALTSLQDQCETLQH---NSNFTGLACNASIDMIGTCWPSTAAGQMVARPCPEYFHGVQYNTTGNVYRECHLNGSWAGRGDYAQCQEILKQEKKTKVHYHIAIVINFLGHSISLCALLVAFILFLRLRSIRCLRNIIHWNLITAFILRNVTWF---VMQLTLSHEAHDSNVVWCRLVTIAHNYFYVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDN-EKCWFG-KKAGVYTDFIYQGPVILVLLINFIFLFNIVRILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVTPGEDEISRIVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHSIRARVARAMSIPTSPTR---ISFHSIKQS 412          
BLAST of Corticotropin-releasing factor receptor 1 vs. TrEMBL
Match: A0A1S3INA9 (corticotropin-releasing factor receptor 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106165372 PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.920e-54
Identity = 147/459 (32.03%), Postives = 232/459 (50.54%), Query Frame = 3
Query:  168 SNISIIELDDLCRALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMM-----PNKIEYH--VIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLI---IVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMF-ESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSF---RGYLPSASRTRQTIDDSTGPVRRG----NSAFRPLKQDYDNNVFKCRSYRSQHNNNGNNAKPVTPMNNESDVENQQ 1490
            SN++  EL  L   L   + +     + C  +++    W  T++ T+A  +CP K      +  +N TR C  NG WA+K+ Y  C+       P  IE++  V   ++ GY +S++AL +AL +F YFRSLRC+RN IHC+L+VS++VR  +W L+   ++P+I   +    +     ++  +  ++NY WMFVEG YL +++VW +  DK+K+W Y LIGWG P   S   A++    ++    W   +     + YI+  PIL  +  N+  L  I++ +  KL+ +    TR S          RKA+KA  +L+PL+G  + LF++  S        ++   A L STQGFFVAL YCF N EV+  LK K+  +   R  + S   TR ++D   G  R      N    PL +       +  S     + NGN A     +  E D+E+ +
Sbjct:   56 SNVTFSELCQLHFRLQGTLPEYDDGQIYCNSTWNTLSCWPTTLAGTLAVIQCPPKLGDYPLDATKNATRYCHVNGTWAEKAEYAACVPELPTPDPEDIEHNFPVRLVYYSGYGLSSLALLVALTIFVYFRSLRCLRNTIHCHLMVSFLVRNISWMLVMNLLLPKIHLEEETQWLCKAILVVWHYVHSTNYFWMFVEGLYLHLMVVWAFSADKVKLWVYLLIGWGAPAPTSIAWALTKHHLQSDENCWGAENYNSQPEDYIVTGPILFVLGVNLIFLGTIVWVLITKLRASNSLETRHS----------RKAVKATLILMPLVGATYMLFLYPPSNDPITTKVFRYTNAFLQSTQGFFVALFYCFFNGEVQNALKRKFSRWQDDRNIINSTRWTRTSMDK--GEARTSLCVNNDQLLPLNEKRKQTELR-HSTAPDRDRNGNKANGHVTVTVEMDIESSK 501          
BLAST of Corticotropin-releasing factor receptor 1 vs. TrEMBL
Match: A0A1S3IKV9 (corticotropin-releasing factor receptor 1-like OS=Lingula unguis OX=7574 GN=LOC106165168 PE=3 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 6.158e-54
Identity = 141/431 (32.71%), Postives = 221/431 (51.28%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMM-----PNKIEYH--VIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLI---IVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMF-ESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSF---RGYLPSASRTRQTIDDSTGPVRRG----NSAFRPLKQDYDNNVFKCRSYRSQHNNNGNNAKPVTPMNNESDVENQQ 1490
            C  +++    W  T++ T+A  +CP K      +  +N TR C  NG WA+K+ Y  C+       P  IE++  V   ++ GY +S++AL +AL +F YFRSLRC+RN IHC+L+VS++VR  +W L+   ++P+I   +    +     ++  +  ++NY WMFVEG YL +++VW +  DK+K+W Y LIGWG P   S   A++    ++    W   +     + YI+  PIL  +  N+  L  I++ +  KL+ +    TR S          RKA+KA  +L+PL+G  + LF++  S        ++   A L STQGFFVAL YCF N EV+  LK K+  +   R  + S   TR ++D   G  R      N    PL +       +  S     + NGN A     +  E D+E+ +
Sbjct:   10 CNSTWNTLSCWPTTLAGTLAVIQCPPKLGDYPLDATKNATRYCHVNGTWAEKAEYAACVPELPTPDPEDIEHNFPVRLVYYSGYGLSSLALLVALTIFVYFRSLRCLRNTIHCHLMVSFLVRNISWMLVMNLLLPKIHLEEETQWLCKAILVVWHYVHSTNYFWMFVEGLYLHLMVVWAFSADKVKLWVYLLIGWGAPAPTSIAWALTKHHLQSDENCWGAENYNSQPEDYIVTGPILFVLGVNLIFLGTIVWVLITKLRASNSLETRHS----------RKAVKATLILMPLVGATYMLFLYPPSNDPITTKVFRYTNAFLQSTQGFFVALFYCFFNGEVQNALKRKFSRWQDDRNIINSTRWTRTSMDK--GEARTSLCVNNDQLLPLNEKRKQTELR-HSTAPDRDRNGNKANGHVTVTVEMDIESSK 427          
BLAST of Corticotropin-releasing factor receptor 1 vs. TrEMBL
Match: K1Q4J6 (Corticotropin-releasing factor receptor 1 OS=Crassostrea gigas OX=29159 GN=CGI_10013121 PE=3 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 6.574e-54
Identity = 139/373 (37.27%), Postives = 202/373 (54.16%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC----IMMPNKIEYH-VIATWFV-------GYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLI---IVPQITTTD-WPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESW--FNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLK-YQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQT 1313
            C  + D F  W  T     A   CP     P  +  +N T+ C  NG W  K+NY+ C    I   N IE+H  +AT +V       G++IST+AL IAL +F +FRSLRC+RN IHC+LIV++I+R   W+++   +VP +   + W   +         ++Q +N+ WM VEG YL IIIVWTY  DK++ W+  ++GWGF           + LT      W  +N+S+  PL  YI  +P L+ +  N+  LA II+ +  KL+ +           SL + + RK +KA  +L+PLLGI + LF++     K   +A+K +   L S QGFFVAL YCFLN EV+ VLK K+ + R     A+R  +T
Sbjct:   17 CNATLDPFSCWPATPGGHYAVISCPEV---PGVDATKNATKYCFPNGTWMSKANYNACMPHGIADENDIEFHGELATDYVSRIIYNLGFSISTVALAIALFIFTHFRSLRCLRNVIHCHLIVTFILRNVVWFVLQHTLVPIVANQETWACKLQVAVFN---YAQMTNFFWMLVEGLYLHIIIVWTYSADKIRRWYLIVLGWGFE-------HKFLQLTRFSPNCWLPYNTSQMDPLD-YIHIVPTLLVLAINMLFLATIIWVLVTKLRASN----------SLETIQLRKVVKATLLLLPLLGITYLLFLYSPTDDKAVVEAHKFINTFLQSFQGFFVALFYCFLNEEVKSVLKKKFNTLRENRTLATRCTKT 365          
BLAST of Corticotropin-releasing factor receptor 1 vs. TrEMBL
Match: A0A1S3ILD2 (corticotropin-releasing factor receptor 2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106165372 PE=3 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 1.291e-53
Identity = 141/431 (32.71%), Postives = 221/431 (51.28%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMM-----PNKIEYH--VIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLI---IVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMF-ESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSF---RGYLPSASRTRQTIDDSTGPVRRG----NSAFRPLKQDYDNNVFKCRSYRSQHNNNGNNAKPVTPMNNESDVENQQ 1490
            C  +++    W  T++ T+A  +CP K      +  +N TR C  NG WA+K+ Y  C+       P  IE++  V   ++ GY +S++AL +AL +F YFRSLRC+RN IHC+L+VS++VR  +W L+   ++P+I   +    +     ++  +  ++NY WMFVEG YL +++VW +  DK+K+W Y LIGWG P   S   A++    ++    W   +     + YI+  PIL  +  N+  L  I++ +  KL+ +    TR S          RKA+KA  +L+PL+G  + LF++  S        ++   A L STQGFFVAL YCF N EV+  LK K+  +   R  + S   TR ++D   G  R      N    PL +       +  S     + NGN A     +  E D+E+ +
Sbjct:   29 CNSTWNTLSCWPTTLAGTLAVIQCPPKLGDYPLDATKNATRYCHVNGTWAEKAEYAACVPELPTPDPEDIEHNFPVRLVYYSGYGLSSLALLVALTIFVYFRSLRCLRNTIHCHLMVSFLVRNISWMLVMNLLLPKIHLEEETQWLCKAILVVWHYVHSTNYFWMFVEGLYLHLMVVWAFSADKVKLWVYLLIGWGAPAPTSIAWALTKHHLQSDENCWGAENYNSQPEDYIVTGPILFVLGVNLIFLGTIVWVLITKLRASNSLETRHS----------RKAVKATLILMPLVGATYMLFLYPPSNDPITTKVFRYTNAFLQSTQGFFVALFYCFFNGEVQNALKRKFSRWQDDRNIINSTRWTRTSMDK--GEARTSLCVNNDQLLPLNEKRKQTELR-HSTAPDRDRNGNKANGHVTVTVEMDIESSK 446          
BLAST of Corticotropin-releasing factor receptor 1 vs. TrEMBL
Match: A0A2C9L3F1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106051400 PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 8.474e-53
Identity = 128/364 (35.16%), Postives = 198/364 (54.40%), Query Frame = 3
Query:  219 LVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN---KIEYHVIAT----WF---VGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFES-KSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFR 1277
            L+  +  + L C  + D F  W  T +  VA ++CP  S+    +   N+T++C  NG W + +NY  C  MPN    +E H  +T    W    +G+TI+TIAL +AL +F  F+SLRC+RN IHCNL+V+ +V    W ++ +   +    P  +  I   I+ +  ++ + WMFVEG YL  I++W Y + K+++WHY LIGWG P +   I     +  ++    W        +  YIIH+P L  +  NVF + VII+T+  KL+ +    TR+S          RKA+KA  VL+PLLG+ + L +    +    +  Y +L+  L S QG FVA+ YCFLN EV+ VL+ K+ + +
Sbjct:   28 LLHLSEPDVLYCNSTSDTFTCWPATRAGAVAQERCPEHSV---VDQTANVTKLCRDNGTW-ETANYSAC--MPNTTHSMETHKTSTSPEAWILYDIGFTITTIALLVALTIFLNFKSLRCLRNIIHCNLMVALLVTNVKWLILRLASFSLASAPPVLCKILVTILTYFHSAIFFWMFVEGLYLFTIVIWAYSVHKIRLWHYILIGWGIPFVFVIIWVCVRSQYKDM-LCWLPEDGTNYVD-YIIHVPALTVLGINVFFITVIIWTLVTKLRASNTIETRQS----------RKALKAIVVLLPLLGVTYILLLVPPVRHETLERIYYVLSVTLQSLQGLFVAIFYCFLNGEVQTVLRQKFSALQ 373          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Cavefish
Match: crhr1 (corticotropin-releasing factor receptor 1-like [Source:NCBI gene;Acc:103028117])

HSP 1 Score: 167.933 bits (424), Expect = 9.156e-46
Identity = 123/378 (32.54%), Postives = 188/378 (49.74%), Query Frame = 3
Query:  282 WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN-----KIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQA------SNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKY-QDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
            W  +    V ++ CP       YN   N+ R CL NG WA+K++Y +C+ + N     K+ YH+ +   ++G+ IS  AL +A ILF   RS+RC+RN IH NLI ++I+R  TW+++   Q+T    P    +      L + A      +N+ WMF EG YL   IV TY  DKL+ W +  IGW  P  +    AI     +N  + WF   +A     YI   P+++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF       +  Q  +    + L S QGFFV++ YCFLN EVR  ++ ++  ++      +R  + +   T P R    +F  +KQ 
Sbjct:   68 WPKSSVGEVISRPCPDTFHGVRYNSTNNVYRECLDNGTWARKADYSQCLEILNEEKKSKLHYHIAVIINYLGHCISLGALLVAFILFMRLRSIRCLRNIIHWNLITAFILRNATWFVV---QLTMN--PEVHESNVIWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDN-EKCWF-GKRAGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEISQIVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHSIRARVARAMSIPTSPTR---VSFHSIKQS 425          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Cavefish
Match: ENSAMXT00000037591.1 (corticotropin releasing hormone receptor 1 [Source:NCBI gene;Acc:103036295])

HSP 1 Score: 166.777 bits (421), Expect = 2.249e-45
Identity = 122/395 (30.89%), Postives = 192/395 (48.61%), Query Frame = 3
Query:  225 GKNTTNALCCPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPN-----KIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLI---IVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKY-QDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQD 1376
              + ++ + C  S DG    W  +++  + ++ CP       YN    I R CLANG WA K NY +C  + N     K+ Y + +   ++G+ +S   L IA  LF   RS+RC+RN IH NLI ++I+R  TW+++   + P +  ++ P   +  T     +   +N+ WMF EG YL   IV TY  D+LK W +  IGW  P  +    A      +N  + WF   +A     YI   P+++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF       +  Q  +    + L S QGFFV++ YCFLN EVR  ++ ++  ++      +R  + +   T P R    +F  +KQ 
Sbjct:   47 ADSNSSGVFCRTSIDGIGTCWPRSMAGEMVSRPCPELLYGVRYNTTNKIFRKCLANGTWASKGNYSQCKAILNVQRKSKLHYRIAVIINYMGHCLSLFTLLIAFTLFLRLRSIRCLRNIIHWNLISAFILRNATWFIVQLTMSPDVHESNVPWCRLVTTLYN--YFHMANFFWMFGEGCYLHTAIVLTYSTDRLKKWMFICIGWCIPLPIIVAWAFGKLYYDN-EKCWFG-KRAGVYTDYIYQGPMILVLMINFIFLFNIVRILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSQIVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRKRWHRWQDKHSIRTRVARAMSIPTSPSRL---SFHSIKQS 424          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Cavefish
Match: ENSAMXT00000058121.1 (corticotropin-releasing factor receptor 2-like [Source:NCBI gene;Acc:107197140])

HSP 1 Score: 159.073 bits (401), Expect = 9.895e-43
Identity = 128/418 (30.62%), Postives = 194/418 (46.41%), Query Frame = 3
Query:  108 EELKILIGYTV*LSNGYLEMSNISIIELDDLCRALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC-IMMPNKIEYHV-----IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFE-SKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVR 1340
            E  K+LI       N   E+S  ++  L   C AL  L   N T   C   + +    W  + S  +  + CP       YN   +  R CL NG WA K NY  C  ++  K +Y +     +   ++G+ IS  AL +A ILF   RS+RC+RN IH NLI ++I+R   W+L+ +      +       + T I  +   +N+ WMFVEG YL   IV TY  DKL+ W +  IGW  P  +    AI     EN  + WF     K +        I++ +I  VF+  ++           +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF     +    Q  +    + L S QGFFV++ YCFLN E+R   + ++  ++       R  + +   T P R
Sbjct:    2 EATKVLICLLFICRNVLCELSLFTL--LQRYCEALSVL--HNVTGLYCNATTDEIGTCWPRSSSGRIVERPCPEYINGVKYNTTRSAYRECLENGTWAFKINYSSCEPILEEKRKYPMHYKIALIINYLGHCISVGALVVAFILFLCLRSIRCLRNVIHWNLITTFILRNVMWFLLQLIDHNIHERNEPWCRLITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVAWAIGKLYNEN-EQCWFGKEPGKYIDYIYQGPVIVVLLINFVFLFNIV-----------RILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEIRSAARKRWHRWQDNHTLRVRVARAMSIPTSPTR 403          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Cavefish
Match: ENSAMXT00000034852.1 (corticotropin-releasing factor receptor 2-like [Source:NCBI gene;Acc:107197140])

HSP 1 Score: 159.073 bits (401), Expect = 9.895e-43
Identity = 128/418 (30.62%), Postives = 194/418 (46.41%), Query Frame = 3
Query:  108 EELKILIGYTV*LSNGYLEMSNISIIELDDLCRALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC-IMMPNKIEYHV-----IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFE-SKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVR 1340
            E  K+LI       N   E+S  ++  L   C AL  L   N T   C   + +    W  + S  +  + CP       YN   +  R CL NG WA K NY  C  ++  K +Y +     +   ++G+ IS  AL +A ILF   RS+RC+RN IH NLI ++I+R   W+L+ +      +       + T I  +   +N+ WMFVEG YL   IV TY  DKL+ W +  IGW  P  +    AI     EN  + WF     K +        I++ +I  VF+  ++           +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF     +    Q  +    + L S QGFFV++ YCFLN E+R   + ++  ++       R  + +   T P R
Sbjct:    2 EATKVLICLLFICRNVLCELSLFTL--LQRYCEALSVL--HNVTGLYCNATTDEIGTCWPRSSSGRIVERPCPEYINGVKYNTTRSAYRECLENGTWAFKINYSSCEPILEEKRKYPMHYKIALIINYLGHCISVGALVVAFILFLCLRSIRCLRNVIHWNLITTFILRNVMWFLLQLIDHNIHERNEPWCRLITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVAWAIGKLYNEN-EQCWFGKEPGKYIDYIYQGPVIVVLLINFVFLFNIV-----------RILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEIRSAARKRWHRWQDNHTLRVRVARAMSIPTSPTR 403          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Cavefish
Match: ENSAMXT00000045916.1 (corticotropin-releasing factor receptor 2-like [Source:NCBI gene;Acc:107197140])

HSP 1 Score: 155.992 bits (393), Expect = 1.494e-41
Identity = 122/407 (29.98%), Postives = 191/407 (46.93%), Query Frame = 3
Query:  144 LSNGYLEMSNISIIELDDL-CRALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC-IMMPNKIEYHV-----IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFE-SKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVR 1340
              + + + S+++++ LD L C A  + +G       C P S  G           +  + CP       YN   +  R CL NG WA K NY  C  ++  K +Y +     +   ++G+ IS  AL +A ILF   RS+RC+RN IH NLI ++I+R   W+L+ +      +       + T I  +   +N+ WMFVEG YL   IV TY  DKL+ W +  IGW  P  +    AI     EN  + WF     K +        I++ +I  VF+  ++           +I +T+  +  +  + +YRKA+KA  VL+PLLGI + LF     +    Q  +    + L S QGFFV++ YCFLN E+R   + ++  ++       R  + +   T P R
Sbjct:   25 FQDTFYQNSSLTLMSLDGLYCNATTDEIGT------CWPRSSSG----------RIVERPCPEYINGVKYNTTRSAYRECLENGTWAFKINYSSCEPILEEKRKYPMHYKIALIINYLGHCISVGALVVAFILFLCLRSIRCLRNVIHWNLITTFILRNVMWFLLQLIDHNIHERNEPWCRLITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVAWAIGKLYNEN-EQCWFGKEPGKYIDYIYQGPVIVVLLINFVFLFNIV-----------RILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEIRSAARKRWHRWQDNHTLRVRVARAMSIPTSPTR 403          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004899.1 (pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-1 gene:ENSPMAG00000004402.1 transcript:ENSPMAT00000004899.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.229 bits (404), Expect = 8.544e-44
Identity = 125/396 (31.57%), Postives = 194/396 (48.99%), Query Frame = 3
Query:  204 RALYELVGKNTTN---ALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMM-----PNKIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFE-SKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFR 1361
            R L+ L   N T      C P S  G          TVAT  CP +     Y+  +++ R CLANG WA++SNY  C  +     PN   Y + +   ++G+ IS  AL  A   F + RS+RC+RN IH +L+ ++I+R   W L+ +  ++T +       +   +  + Q +N+ WMFVEG YL   IV TY  DKL+   +  IGW  P  +  + A+     E+  + WF  ++ K +  YI   PI++ ++ N   L  I+  +  KL+ +    T + S         RKA+KA  VL+PLLGI + LF     +    Q  +  + + L S QGFFV++ YCFLN EVR  L+ ++  +       +R  + +   T P R    +F+
Sbjct:   34 RKLHSLACCNATRDEIGTCWPESEAG---------RTVAT-PCPERFNGVRYDSSKSVIRECLANGTWAQRSNYSLCKPIIDAKKPNSQHYKIALIVNYLGHCISLAALITAFGFFWWLRSIRCLRNAIHWHLVTTFILRNAAWLLLQIIDLSTQERNEPWCRVVITVFNYFQVTNFFWMFVEGCYLHTAIVMTYSTDKLRKSIFVCIGWCIPAPIIIVWAMVKLFYED-EKCWFGKTEGKYID-YIYQGPIILVLLVNFIFLFNIVRILMTKLRASTTSETIQYS---------RKAVKATLVLLPLLGITYMLFFVNPGEDPVSQVIFIYVNSFLMSFQGFFVSVFYCFLNGEVRSALRKRWNRWMDNHRLQARVTRAMSIPTSPTRISFHSFK 408          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009958.1 (pep scaffold:Pmarinus_7.0:GL477206:37870:64312:-1 gene:ENSPMAG00000008983.1 transcript:ENSPMAT00000009958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 156.762 bits (395), Expect = 6.470e-43
Identity = 114/366 (31.15%), Postives = 188/366 (51.37%), Query Frame = 3
Query:  282 WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC--IMMPNKIEYH---VIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKY-QDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFR 1361
            W  + ++ V  + CP +     Y+  +++ R C+A+  WA++SNY  C  I++  +   H    +   ++G+ +S +AL  A  +F   RS+RC+RN IH NL+ ++I+R  TW+L+ +  ++T +       I   I  + Q +N+ WMFVEG YL   IV TY  DKL+ W +  IGW  P  +  I A+     E+  + WF  +  K +  YI   PI++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF       +  Q  +  + + L S QGFFV++ YCFLN EVR  ++ ++  +       +R  + +   T P R    +F+
Sbjct:   24 WPSSEASRVVIRPCPDRFNGVQYDTSKSVYRECMADATWARRSNYSLCEAIILSKRNSQHYKVALVVNYLGHCVSLLALMTAFTIFWCLRSIRCLRNAIHWNLMTTFILRNATWFLLQLIDLSTQERNEPWCCIIITIFNYFQVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWIFICIGWVIPAPIIIIWAMVKLHFED-EKCWFGKTPGKYID-YIYQGPIILVLLINFIFLFNIVTILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDEISQVIFLYVNSFLMSFQGFFVSVFYCFLNGEVRSAIRKRWHRWLDNHAIRARVTRAMSIPTSPTRISFHSFK 377          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Sea Lamprey
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 120.168 bits (300), Expect = 1.266e-29
Identity = 107/371 (28.84%), Postives = 173/371 (46.63%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKK------SNYDRC-------IMMPNKIEYHVIATWF-VGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYL------------IIVPQITT-TDWPXXXXXXXXXXXLF--SQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAI-------LTSTQGFFVALIYCFLNREVRFVLK 1256
            C   +DG   W + +  ++  +KCP       +N   +  R C +NG W         +NY  C       +    K   H ++  + +GY++S  +L IAL +   FR L C RN IH +L VS+++R  + ++            +  P  +   + P        ++ LF    A++Y W+ VEG YL  +I  T+     ++W ++LIGWGFP +   + A + A   N ++ W     A  LK +I   PIL ++  N  +   I+  +  KL++T     R+ S+      +YRK +K+  VL+PL G+ + LF     ++ Y D   +   I         S QGFFVA+IYCF N EVR  +K
Sbjct:   48 CTAEWDGLICWPWGLPGSMVREKCPSYIYD--FNAHGHAYRKCESNGTWKMSTANRLWANYSECTEFLNPHVQAKEKESIHRLSILYTIGYSVSLASLAIALCILTVFRRLHCTRNYIHMHLFVSFMLRAASIFVKDGVLYSDNELRLATPGPSPPAEAPHIFAGCRVVVTLFLYCLATSYFWVLVEGLYLYSLIFLTFSASG-RLWTFALIGWGFPVVFVFVWAAARATLAN-SQCW--DLSAGWLK-WIYQAPILAAVAVNFVLFVNIVRVLATKLRETN--AARQESR-----QQYRKLLKSTLVLMPLFGVHYVLF----AAMPYTDVIGLAWQIQMYYEMTFNSFQGFFVAIIYCFCNGEVRGEMK 400          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000542.1 (pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1 gene:ENSPMAG00000000476.1 transcript:ENSPMAT00000000542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.087 bits (292), Expect = 1.594e-28
Identity = 116/406 (28.57%), Postives = 193/406 (47.54%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKK-------SNYDRC-IMMPNKIEYHVIATWFV--GYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQ---ASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTS--TQGFFVALIYCFLNREVRFVLK---------AKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQDYDNNVFK 1397
            C  ++DG+  W  T++  VA Q CP     P ++ +E +T++C  +G W +        SNY  C     +K++  V   +    G+ +S + L ++L +F YF+SL C R  +H NL +SYI+      + +       +   +      ++  F Q     NY WM  EG YL  +IV     +K  ++ Y L+GWGFP + + + A++  +  + N  W +S+      LYIIH P++ +++ N+F L  I+  +  KLK     VT R+      ++ Y KA++A  +L+PLLGI   L  ++ +     + Y  +  I  +   QGF VA I+CF N EV+  LK            R  + ++ S S T  ++ +   P   G    R    D + N FK
Sbjct:   41 CNRTWDGWLCWGDTMAGDVAVQHCP--DYFPDFDLQEKVTKICNTDGQWFRHPDSNRTWSNYTLCNAFTADKLKMAVNLFYLAVTGHGVSILVLLVSLTIFFYFKSLSCQRITLHKNLFMSYILNSIITIIQLTAVANNQELVASKPVWCKVLQFFHQYMMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLFWYYLLGWGFPIVPALMHAVARTIYYDDN-CWISSATH---LLYIIHGPVVAALLVNLFFLLNIVRVLVTKLK-----VTHRAE-----TSMYMKAVRATLILVPLLGIQFVLVPWKPERF-VGEIYDYIMQIFPTHLIQGFLVATIFCFCNGEVQAALKRYWILYLRMGHERRDQYFMASTSYT-ASVTELPCP-NGGEHHGRMASSDAEANAFK 427          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003797.1 (pep scaffold:Pmarinus_7.0:GL477934:1164:14009:-1 gene:ENSPMAG00000003461.1 transcript:ENSPMAT00000003797.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 1.445e-23
Identity = 71/215 (33.02%), Postives = 104/215 (48.37%), Query Frame = 3
Query:  186 ELDDLCRALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC-IMMPNK------IEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGW 806
            ++D+ C  L +  G N T  +C     +    W  T    V ++ CP       Y     + R CL NG WA  SNY  C  ++ NK        Y V +   ++G+ IS  AL IA +LF   RS+RC+RN IH NLI ++I+R   +Y + +    T +       + + I  +   +N+ WMF EG YL   IV TY  DKL+ W +  +GW
Sbjct:   25 QVDEDCEFLSD--GINITGPVCNSTLDEIETCWPSTPVGQVVSRPCPEFFNGVRYEIHRTVYRECLENGTWALISNYSECKPIVENKEVQTESFHYEVALIINYLGHCISLAALVIAFLLFMGLRSIRCLRNIIHWNLISTFILRNSMFYTLQLIDFRTQEANEPWCRVVSTIYNYFHVTNFFWMFGEGCYLHTAIVMTYSTDKLRKWVFLCLGW 237          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Nematostella
Match: EDO34537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP31])

HSP 1 Score: 70.4774 bits (171), Expect = 2.187e-13
Identity = 73/275 (26.55%), Postives = 126/275 (45.82%), Query Frame = 3
Query:  435 PNKIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXX---XXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIA--HCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVR 1244
            P K+   +I   ++G  IS++AL I L++F    SL   R+ IH NL+++    +F   ++ +  I  T   I    +   +  F   + + WM  EG +L + +V  + I+ +++ HY + GWGFP ++  I A        TE+    W + S      ++    P+   I  N  +L V++ T+           T ++S         R  +K A VL+PLLG++    L      ++ +Q  +    AI  S QGF + L++   N EVR
Sbjct:   40 PEKLSLQIIT--YIGCGISSVALLITLVIFLSIESLSTERHRIHLNLVLA----LFLAQILFLSGINATGNKIGCQVVAAFLHYFYTVA-FTWMLNEGVHLYLKVVKVFRIENVRLLHYYIFGWGFPAVIVGISAAIKPNSYGTESI--CWLSLSDD---FVWAFIGPVTFIIAINCLILIVVVKTIVNSAS------TVKNSD----HAHIRAGVKGALVLMPLLGVSWISGLLAVNKDTVFFQYVF----AITNSFQGFLIFLLHVVFNTEVR 288          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Nematostella
Match: EDO32467 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV16])

HSP 1 Score: 56.225 bits (134), Expect = 3.628e-9
Identity = 50/187 (26.74%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  696 ASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRK---AIKAAAVLIPLLGI--AHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREV 1241
            ++++ WM +EGF+L + IV  +G + +K+ +Y + GWGFP        I + +  + + S + +  A  L +    I   +  +  + ++  +I ++  K+  T        S  S    EYR+    +K A VL+PLLGI     L     +++ +Q  +    AI  S QGF + +  C  N EV
Sbjct:   30 SASFTWMCIEGFHLYMKIVTVFGAEGVKLKYYYIFGWGFPA-------IMVGVAASVDSSGYGTRAACWLSMDKGFIWAFLGPVVAIILVNCVILSMVVKIVMT--------SSASQSEPEYRQILAGVKGALVLLPLLGITWVFGLLAVTKETVVFQYVF----AISNSLQGFCIFIFQCIGNSEV 197          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Nematostella
Match: EDO32853 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STW1])

HSP 1 Score: 56.9954 bits (136), Expect = 6.754e-9
Identity = 68/260 (26.15%), Postives = 127/260 (48.85%), Query Frame = 3
Query:  474 VGYTISTIALWIALIL-FRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGID-KLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIA--HCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREV 1241
            +G  IS  A+ + +IL   ++RS+R  R  +  N+ ++    V    ++++ + T  +       +  ++  F  A  + WM  EG  L IIIV   G   + K+ ++ L GWGFP ++ +I   +   T+     +  +  A  L +    I   ++    V ++ +I++ +   L+QT   +  R  +      + R A+KA AV++PLLGI     L  F ++++    A+K + AIL S QG  + + +C LN++V
Sbjct:   64 IGCAISLFAILLTIILTVAFWRSVRSPRAIVLLNICLA----VAAVCILVIAEGTARNSQKGCKALAILLHYFLLAV-FCWMLCEGALLYIIIVKVIGGKPEEKVKYFLLFGWGFPAIIVAISLGA---TQTKGYGYHGAQTACWLSVDNGLIWAFVAPALVVLMINIIVFVLV--LRQT---MGTRHVQNKSRDEKLRVAVKATAVILPLLGITWLFGLLAFSAETV----AFKYIFAILNSLQGLMIFIFHCVLNKQV 306          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Nematostella
Match: EDO49199 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHB5])

HSP 1 Score: 53.9138 bits (128), Expect = 1.967e-8
Identity = 50/182 (27.47%), Postives = 89/182 (48.90%), Query Frame = 3
Query:  699 SNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQD-AYKILTAILTSTQGFFVALIYCFLNREV 1241
            + + WMFVEG +L  ++V  Y    LK+ +Y L GWGFP +   +   S       + + + S +     ++   +P++I    N+ +L  ++Y +   ++++  P+T    K +      R AI+    L+PLLG+    +MF    +     A++ L AIL + QG FV   +C  N +V
Sbjct:   11 AAFAWMFVEGVHLYFMVVHVYNTQTLKIRYYMLFGWGFPFVFVGVSLASGFEGYGTDHACWISIETG--LIWAFVVPVIIFNSINIVILVKVLY-ILVSIEES--PLTPEEGKRA------RVAIRGVITLMPLLGLT---WMFGILCVNTDTVAFQYLFAILNTLQGVFVFGFHCVGNSQV 178          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Nematostella
Match: EDO39196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS3])

HSP 1 Score: 53.1434 bits (126), Expect = 1.301e-7
Identity = 70/266 (26.32%), Postives = 118/266 (44.36%), Query Frame = 3
Query:  471 FVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEG--FYLLIIIVWTYGIDKLKMWHYSLIGWG-----FPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIA--HCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREV 1241
            F+G  +S     + ++   +  SLR  R  IH NL+ + +   F   L IV    T   P ++     +++ F   S + WM VEG   Y L+I V+  G  + K+  Y++IGWG     FP+ +             F  S   SS+     L +    I   +   + V+A  +  +F  L+ T + + +  S+ S      R  +KA   L+P+LG+        F +K++ ++  +    AI  S QGF + + YC L+ EV
Sbjct:   59 FIGLGLSIAGCVLTILTHLFLPSLRSERVFIHINLVTAIL---FAQILFIVGA--THREPQSLCLSVAVLLYFFYMSVFTWMLVEGIHIYCLVIRVFNSGRGRKKI--YTVIGWGEFLSIFPSGM-----------PAFRNSSTTSSRC---WLSLESGAIWAFVAPALVVIAFNLVILFMVLRVTAV-MLKDESQTSSNVCLSRALVKAFVTLLPILGLTWLFGFLAFNNKTVMFEYLF----AIFNSMQGFLIFVFYCLLSSEV 298          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Medaka
Match: CRHR2 (corticotropin-releasing factor receptor 2 [Source:NCBI gene;Acc:101157488])

HSP 1 Score: 157.918 bits (398), Expect = 6.820e-42
Identity = 130/418 (31.10%), Postives = 199/418 (47.61%), Query Frame = 3
Query:  150 NGYLEMSNISIIELDDL-CRALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRC-IMMPNKIEYHV-----IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYL--IIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFE-SKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQ 1373
            + +LE +++S++  D L C A  + +G       C P S  G           +  + CP       YN   +  R C+ NG WA K NY  C  ++  K +Y +     +   ++G+ IS  AL +A +LF   RS+RC+RN IH NLI ++I+R   W+L  +I   I  ++ P   +  T     +   +N+ WMFVEG YL   IV TY  DKL+ W +  IGW  P  +    AI     EN  + WF     K +  YI   P+++ ++ N   L  I+  +  KL+ +    T           +YRKA+KA  VL+PLLGI + LF     +    Q  +    + L S QGFFV++ YCFLN EVR  ++ ++  ++       R  + +   T P R    +F  +KQ
Sbjct:   87 DTFLENASLSLLSADGLYCNATVDEIGT------CWPRSSTG----------RIVERPCPAYINGVKYNATRSAYRECMDNGTWALKINYSNCEPILEEKRKYPMHYKIALIINYLGHCISVGALVVAFVLFLCLRSIRCLRNIIHWNLITTFILRNVMWFLLQLIDHNIHESNEPWCRLITTIYN--YFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVTWAIGKLYFEN-EKCWFGKEPGKYMD-YIYQGPVILVLLINFVFLFNIVRILMTKLRASTTSET----------IQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAVRKRWHRWQDNHALRVRVARAMSIPTSPTR---ISFHSIKQ 471          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Medaka
Match: calcrla (calcitonin receptor like receptor [Source:NCBI gene;Acc:101158808])

HSP 1 Score: 131.724 bits (330), Expect = 1.227e-32
Identity = 120/388 (30.93%), Postives = 186/388 (47.94%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYND---KENITRMCLANGVWAKK-------SNYDRCIMMPNKIEYHVIATWF---VGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYI---VRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYL-LIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFR-----------GYLPSASRTRQTIDDSTG 1331
            C  ++DG+  W  T +   + Q CP      Y+ D    E +T++C  NG W          +NY RC    N+     +  ++   +G+ +S ++L+I+L +F +F+SL C R  +H NL  S++   V    W   +           T   ++  I L+    NY WM  EG YL  +I+V  +   +  MW+Y L+GWGFP + +SI AI+ +   N N  W +S   K   LYIIH PI  +++ NVF L  I+  +  KLK     VT ++      S+ Y KA++A  +L+PLLGI + L  ++       + Y  +  IL   QG  VA I+CF N EV+ VL+  +  +              L SAS T  +I +  G
Sbjct:   63 CNRTWDGWLCWDDTAAGVTSEQHCPD-----YFQDFDPSEMVTKICTENGHWFLHPESNRTWTNYTRCNEHTNEGRMTAMNLFYLALIGHGLSLVSLFISLAIFFHFKSLSCQRITLHKNLFFSFVLNSVITIIWLTAVANNQELVQRNPTSCKVSMFIHLYLFGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYY-LLGWGFPLIPASIHAIARSYYYNDN-CWISS---KTSLLYIIHGPICAALVVNVFFLLNIVRVLITKLK-----VTHQAE-----SSLYMKAVRATLILVPLLGIQYVLLPYKPGGRVSSEIYDYIMHILMHYQGLLVATIFCFFNGEVQAVLRRHWNQYNIQFGSSIGNHSDALRSASYTASSITEVQG 430          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Medaka
Match: calcrla (calcitonin receptor like receptor [Source:NCBI gene;Acc:101158808])

HSP 1 Score: 131.724 bits (330), Expect = 1.458e-32
Identity = 123/404 (30.45%), Postives = 193/404 (47.77%), Query Frame = 3
Query:  213 YELVGKNTTNA---LCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYND---KENITRMCLANGVWAKK-------SNYDRCIMMPNKIEYHVIATWF---VGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYI---VRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYL-LIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFR-----------GYLPSASRTRQTIDDSTG 1331
            Y+ + K  T++     C  ++DG+  W  T +   + Q CP      Y+ D    E +T++C  NG W          +NY RC    N+     +  ++   +G+ +S ++L+I+L +F +F+SL C R  +H NL  S++   V    W   +           T   ++  I L+    NY WM  EG YL  +I+V  +   +  MW+Y L+GWGFP + +SI AI+ +   N N  W +S   K   LYIIH PI  +++ NVF L  I+  +  KLK     VT ++      S+ Y KA++A  +L+PLLGI + L  ++       + Y  +  IL   QG  VA I+CF N EV+ VL+  +  +              L SAS T  +I +  G
Sbjct:   61 YQKIMKENTHSRQEAMCNRTWDGWLCWDDTAAGVTSEQHCPD-----YFQDFDPSEMVTKICTENGHWFLHPESNRTWTNYTRCNEHTNEGRMTAMNLFYLALIGHGLSLVSLFISLAIFFHFKSLSCQRITLHKNLFFSFVLNSVITIIWLTAVANNQELVQRNPTSCKVSMFIHLYLFGCNYFWMLCEGIYLHTLIVVAVFAEKQHLMWYY-LLGWGFPLIPASIHAIARSYYYNDN-CWISS---KTSLLYIIHGPICAALVVNVFFLLNIVRVLITKLK-----VTHQAE-----SSLYMKAVRATLILVPLLGIQYVLLPYKPGGRVSSEIYDYIMHILMHYQGLLVATIFCFFNGEVQAVLRRHWNQYNIQFGSSIGNHSDALRSASYTASSITEVQG 444          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Medaka
Match: crhr1 (corticotropin releasing hormone receptor 1 [Source:ZFIN;Acc:ZDB-GENE-081231-1])

HSP 1 Score: 115.161 bits (287), Expect = 4.857e-29
Identity = 70/197 (35.53%), Postives = 104/197 (52.79%), Query Frame = 3
Query:  252 CPPSYDGFRN-WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMM-----PNKIEYHV-IATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLI---IVPQITTTD--WPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGW 806
            C  S DG    W  + +  + ++ CP       YN   N+ R CLANG WA K NY  C  +      +K+ Y + +   F+G+ IS +AL IA  LF   RS+RC+RN IH NLI ++I+R  TW+++   + P++  ++  W   +         +  ++N+ WMF EG YL   IV TY  DKL+ W +  IGW
Sbjct:    9 CDTSIDGIGTCWPRSNAGQMISRPCPEMFYGVRYNTTNNVYRKCLANGTWALKGNYSMCKAILHEERKSKMHYQIAVIINFLGHCISMVALLIAFFLFLCLRSIRCLRNIIHWNLITAFILRNATWFIVQLTMSPEVHESNVIWCRLVTASFN----YFHSTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGW 201          
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Medaka
Match: vipr1a (vasoactive intestinal polypeptide receptor-like [Source:NCBI gene;Acc:101161752])

HSP 1 Score: 120.168 bits (300), Expect = 7.378e-29
Identity = 114/386 (29.53%), Postives = 192/386 (49.74%), Query Frame = 3
Query:  204 RALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYND--KENITRMCLANGVWAKKSNYDR-CIMMPNK-IEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYL--IIVPQITTTDWPXXXXXXXXXXXLFSQA--SNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRS--FRGYLPSASRTRQTIDDSTG 1331
            R++ E   +N T +  C   +D    W       V T  CP K L  +  D    N+++ C ANG+   + +Y R C   PN  +E + +  + VG+++S I+L IA+ +   FR L C RN IH +L VS I++  T ++  +++  +  TD     V    ++++F     ++Y W+ VEG YL  ++  ++  ++   W Y +IGWG PT+      I+ A  ++    W           +II IPI +SI+ N  +   II  + +K+    I   RR S       +Y +  K+  +LIPL GI + LF +  +++  Q    +   +L S QGF VA++YCFLN EV+  +K K+R    + +L + ++ +Q    S G
Sbjct:   23 RSICEAQIENKTTS--CSVEWDNITCWPGAEIGEVVTIPCP-KYLFYFSEDMPPRNVSKTCTANGLTPIRVDYVRECGYNPNNTVEENSVMGYTVGHSVSLISLMIAISILCLFRKLHCTRNYIHMHLFVSLILKAVTVFIKDVVLYDVGETDNCQGSVGCKAVVVIFHYGVMASYFWLLVEGLYLHALLAVSFFSERKYFWWYIVIGWGVPTIFICAWVITKAYLDH-PGCW---ETIDDNLWWIIRIPISLSILVNFLLFICIIRILLQKMNCPDI--GRRESN------QYSRLAKSTLLLIPLFGINYILFAYIPENMHVQ-VRMVFDLVLGSFQGFVVAILYCFLNGEVQSEIKRKWRRWMLQRFLGTDAKYQQPSMGSNG 392          
BLAST of Corticotropin-releasing factor receptor 1 vs. Planmine SMEST
Match: SMESG000051050.1 (SMESG000051050.1)

HSP 1 Score: 817.765 bits (2111), Expect = 0.000e+0
Identity = 442/443 (99.77%), Postives = 442/443 (99.77%), Query Frame = 3
Query:  165 MSNISIIELDDLCRALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPNKIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQDYDNNVFKCRSYRSQHNNNGNNAKPVTPMNNESDVENQQT 1493
            MSNISIIELDDLCRALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPNKIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPITIVNITTIIILFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTLLSSILAISIALTENFNESWFNSSKAKPLKLYIIHIPILISIIANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQDYDNNVFKCRSYRSQHNNNGNNA PVTPMNNESDVENQQT
Sbjct:    1 MSNISIIELDDLCRALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPNKIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPITIVNITTIIILFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTLLSSILAISIALTENFNESWFNSSKAKPLKLYIIHIPILISIIANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRPLKQDYDNNVFKCRSYRSQHNNNGNNANPVTPMNNESDVENQQT 443          
BLAST of Corticotropin-releasing factor receptor 1 vs. Planmine SMEST
Match: SMESG000064388.1 (SMESG000064388.1)

HSP 1 Score: 176.792 bits (447), Expect = 3.074e-49
Identity = 122/326 (37.42%), Postives = 179/326 (54.91%), Query Frame = 3
Query:  522 FRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPV--TRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLK------------AKYRSFRGYLPSASRT----RQTIDD--STGPVRRGN---SAFRPLKQ--DYDNNVFKCRSYRSQHN 1424
             R  +SLRC+RN IHCNLI+S+I+RV  W  I     +   +P  + N+   + + SQ +N+ WMFVEG YLLI+IVWTY I+K+K+WH+++IGW  P LL++   I +  TEN  E W        L +++  I IL+    N   L  I+ T+ +KLK TK     +RR++     + EY+KA+K+  VL+PLLG +H +F+      K    + I  AIL+S+QGF+V+LIYCF N EVR  L+             + R     +PS  ++     Q + D  +T P+       S  + LKQ  D +N +   R  RSQ N
Sbjct:  100 LRLVKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSK-PYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMV-TENI-EDWVGYRGKMKLIVHLPIILILV---VNAIALLFIVITLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVPLFNQQMSDTAATNPIENHKQIVSLMQKLKQTKDSENRINTNRRVRSQIN 419          
BLAST of Corticotropin-releasing factor receptor 1 vs. Planmine SMEST
Match: SMESG000049048.1 (SMESG000049048.1)

HSP 1 Score: 177.563 bits (449), Expect = 3.102e-49
Identity = 140/437 (32.04%), Postives = 218/437 (49.89%), Query Frame = 3
Query:  252 CPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVW-AKKSNYDRCIMMPNKIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKL------------KQTKIP---------VTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFR-GY-LPSASRTRQTIDDSTGPVRRGNSAFRPLKQDYDNNVFKCRS-YRSQHNNNGNNAKPVTPMNNESDVENQ 1487
            C   +DG   W  T +   A   CP       Y+  +N TR C  +G W A KSNY+ C+   ++ E +++  +  GY +S I L  AL LF +F++L+C RN IHC+L  ++I+R  ++ ++ +  IT +  P+ I+ I  +I   +  + + WM +EG YL  +I WTYG+ +L+  H+++IGWGFP  L+S   +    T   ++ W           Y   IPI+  +I N  ++  II+ +  KL            K+ ++P           R S +LS F  EYRKA+KA  VL+PLLG  + +F+      K +  +  L A+ TSTQGF VALIYCF N EVR +++ +  ++R GY  P  S   + +      + + N +          N  + RS Y  Q NN       V    N +DVE +
Sbjct:   26 CEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHE-EINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFI--ITPSGHPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSP-HDLWMRQLD------YFTDIPIITILIMNSIIMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFITHYHP-KVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYNNPKLSHVSRILLLILCCIYKPNPSI-------IQNGQRIRSIYHCQGNNQTYRKSTVAEKPNTTDVEGK 444          
BLAST of Corticotropin-releasing factor receptor 1 vs. Planmine SMEST
Match: SMESG000006966.1 (SMESG000006966.1)

HSP 1 Score: 132.109 bits (331), Expect = 1.976e-33
Identity = 106/372 (28.49%), Postives = 179/372 (48.12%), Query Frame = 3
Query:  252 CPPSYDG-FRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKK-------SNYDRCIMMPNKI-EYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTW--YLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSL-IGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXXXXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTG 1331
            CPP +D  +  W +T   +   Q CP     P ++ +   ++ C  NG W          +N+D CI   NK+   + +  +F GY++S + + I+L +F YF+ L+C R  IH NL +SY++   TW  +L I+ + T      +   I  +I+ F   S+Y W F EG YL  ++V  +     K+ +  +  GWGFP +L+   A      E   + W   SK + + +    IP +I++IAN+ ++ VI+  +  KL     PV R          ++RK  +A  +L P+LGI + LF   S+        + + A++ S QG  ++ I CF N EV+  +     + R +    S +R++   S G
Sbjct:   26 CPPIFDDLYLCWNFTKGGSKTYQNCPDI---PGFSKEAMASKKCEINGTWYIDQALNRTWTNFDPCI---NKVPNINAVYIYFAGYSLSVLCMAISLFIFFYFKKLQCERVFIHKNLFISYVLNAITWMTFLAIISKPTVMVHNPSYCQIIYVIVTFFNVSSYFWTFSEGLYLATVLVMAFQDGSKKLLYLCVFFGWGFPLILTIFYASLRYQLEQPEKCWTMKSKMQNILI----IPNIIALIANLVIVIVILKILLTKLWH---PVNREQK-------QWRKTARAIFILFPVLGIQNILFFMSSEDRNVSLIQEFIAAVIISFQGTVMSFILCFCNNEVKVAILHNTAATRRFQTVRSTSRRSFTKSDG 377          
BLAST of Corticotropin-releasing factor receptor 1 vs. Planmine SMEST
Match: SMESG000023013.1 (SMESG000023013.1)

HSP 1 Score: 128.257 bits (321), Expect = 4.333e-32
Identity = 109/373 (29.22%), Postives = 176/373 (47.18%), Query Frame = 3
Query:  282 WTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKK-------SNYDRCIMMPNKIEYHVIATWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTW---YLIIVPQITTTDWPXXXXXXXXXXXLFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTXXXXXXXXXXXXTENFNESWFNSSKAKPLKLYXXXXX-XXXXXXANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVL--KAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFR 1361
            W YT +  +A   CP     P +N     ++ C  NG W          SNY +C+   NK    ++  +F GY++S + L I+L +F  F+ LRC R  +H NL + +++    W   Y++I         PI    +  I   FS  + Y WMF EG YL +I++ T+    + +    + GWG P +L+SI  IS  L E   + W      +P K+Y+I     ++++ AN+ +L  I+ T+  KL     P  R         T++ K  KA  +LIPLLG+ + +F     + + +      TA+L+S QG  V+ I CF N EVR ++  +A   S    L +  R   T + ++   +R +   R
Sbjct:   34 WNYTKAGEIAFAPCPKL---PGFNWNAEASKKCEINGTWYFSIEENNYWSNYSKCLQ--NKPNVSLVYVFFAGYSLSVLCLSISLFIFFVFKQLRCDRVTLHKNLFMCHLINAIIWINFYVVISNGDVMQRNPIHCQILFVIATYFSVGT-YFWMFSEGIYLAVILILTFHKGPILLTICIVTGWGLPLILTSIYVISRYLMEKPEKCW-----TEPSKMYLILAIPNVVALGANLLILLFILKTLVTKLSH---PTNREE-------TQWSKTAKAVFILIPLLGLQNIIFFIYPDNQEVRLIQDYSTAVLSSFQGVLVSFILCFFNHEVRTIIRRRACQHSLLQPLKTTRRGTYTTELASNSQQRRSIGMR 385          
The following BLAST results are available for this feature:
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRHR16.201e-4530.81corticotropin releasing hormone receptor 1 [Source... [more]
CRHR16.201e-4530.81corticotropin releasing hormone receptor 1 [Source... [more]
CRHR16.201e-4530.81corticotropin releasing hormone receptor 1 [Source... [more]
CRHR11.787e-4432.09corticotropin releasing hormone receptor 1 [Source... [more]
CRHR11.787e-4432.09corticotropin releasing hormone receptor 1 [Source... [more]
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdfr-11.605e-2124.69Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-11.605e-2124.69Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-12.031e-2124.69Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-12.031e-2124.69Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-13.200e-2023.79Calcitonin receptor-like protein 1 [Source:UniPro... [more]
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dh44-R25.883e-4831.88gene:FBgn0033744 transcript:FBtr0087936[more]
Dh44-R26.438e-4831.88gene:FBgn0033744 transcript:FBtr0113075[more]
Dh44-R14.844e-4533.08gene:FBgn0033932 transcript:FBtr0087485[more]
hec5.798e-2527.32gene:FBgn0030437 transcript:FBtr0343652[more]
hec5.798e-2527.32gene:FBgn0030437 transcript:FBtr0073753[more]
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crhr18.653e-5033.58corticotropin releasing hormone receptor 1 [Source... [more]
CRHR21.145e-4034.30corticotropin-releasing factor receptor 2 [Source:... [more]
calcrla5.395e-3128.88calcitonin receptor-like a [Source:NCBI gene;Acc:4... [more]
pth1r7.321e-2929.12parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth1r7.419e-2928.87parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc17a94.643e-4530.85solute carrier family 17 member 9 [Source:Xenbase;... [more]
slc17a94.955e-4530.81solute carrier family 17 member 9 [Source:Xenbase;... [more]
yif1b9.797e-4530.92Yip1 interacting factor homolog B, membrane traffi... [more]
yif1b1.358e-4431.89Yip1 interacting factor homolog B, membrane traffi... [more]
slc17a91.737e-4431.27solute carrier family 17 member 9 [Source:Xenbase;... [more]
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Crhr14.503e-4630.81corticotropin releasing hormone receptor 1 [Source... [more]
Crhr25.073e-4130.73corticotropin releasing hormone receptor 2 [Source... [more]
Crhr29.022e-4130.73corticotropin releasing hormone receptor 2 [Source... [more]
Crhr21.323e-4030.65corticotropin releasing hormone receptor 2 [Source... [more]
Crhr22.639e-4030.65corticotropin releasing hormone receptor 2 [Source... [more]
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35353|CRFR1_RAT2.706e-4531.55Corticotropin-releasing factor receptor 1 OS=Rattu... [more]
sp|P35347|CRFR1_MOUSE3.150e-4530.81Corticotropin-releasing factor receptor 1 OS=Mus m... [more]
sp|Q76LL8|CRFR1_MACMU2.719e-4430.81Corticotropin-releasing factor receptor 1 OS=Macac... [more]
sp|O42603|CRFR2_XENLA1.849e-4331.54Corticotropin-releasing factor receptor 2 OS=Xenop... [more]
sp|O42602|CRFR1_XENLA2.914e-4330.92Corticotropin-releasing factor receptor 1 OS=Xenop... [more]
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3INA91.920e-5432.03corticotropin-releasing factor receptor 1 isoform ... [more]
A0A1S3IKV96.158e-5432.71corticotropin-releasing factor receptor 1-like OS=... [more]
K1Q4J66.574e-5437.27Corticotropin-releasing factor receptor 1 OS=Crass... [more]
A0A1S3ILD21.291e-5332.71corticotropin-releasing factor receptor 2 isoform ... [more]
A0A2C9L3F18.474e-5335.16Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crhr19.156e-4632.54corticotropin-releasing factor receptor 1-like [So... [more]
ENSAMXT00000037591.12.249e-4530.89corticotropin releasing hormone receptor 1 [Source... [more]
ENSAMXT00000058121.19.895e-4330.62corticotropin-releasing factor receptor 2-like [So... [more]
ENSAMXT00000034852.19.895e-4330.62corticotropin-releasing factor receptor 2-like [So... [more]
ENSAMXT00000045916.11.494e-4129.98corticotropin-releasing factor receptor 2-like [So... [more]
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004899.18.544e-4431.57pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-... [more]
ENSPMAT00000009958.16.470e-4331.15pep scaffold:Pmarinus_7.0:GL477206:37870:64312:-1 ... [more]
pth1r1.266e-2928.84parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000000542.11.594e-2828.57pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1... [more]
ENSPMAT00000003797.11.445e-2333.02pep scaffold:Pmarinus_7.0:GL477934:1164:14009:-1 g... [more]
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO345372.187e-1326.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324673.628e-926.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328536.754e-926.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491991.967e-827.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391961.301e-726.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRHR26.820e-4231.10corticotropin-releasing factor receptor 2 [Source:... [more]
calcrla1.227e-3230.93calcitonin receptor like receptor [Source:NCBI gen... [more]
calcrla1.458e-3230.45calcitonin receptor like receptor [Source:NCBI gen... [more]
crhr14.857e-2935.53corticotropin releasing hormone receptor 1 [Source... [more]
vipr1a7.378e-2929.53vasoactive intestinal polypeptide receptor-like [S... [more]
back to top
BLAST of Corticotropin-releasing factor receptor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051050.10.000e+099.77SMESG000051050.1[more]
SMESG000064388.13.074e-4937.42SMESG000064388.1[more]
SMESG000049048.13.102e-4932.04SMESG000049048.1[more]
SMESG000006966.11.976e-3328.49SMESG000006966.1[more]
SMESG000023013.14.333e-3229.22SMESG000023013.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013025 ID=SMED30013025|Name=Corticotropin-releasing factor receptor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1744bp
TATATAAATCTTATATGGTTGGTTTGTTAACTGTGTGATAAAAGATTGCT
TTTTTGGAATTGGATTATTTTCTTTTCTCATTATCACCTTAGAAAATTCA
CAACACAGAAGAATTGAAAATTTTAATTGGATATACAGTTTAATTGTCAA
ACGGATATTTAGAAATGTCGAATATTTCGATCATAGAGCTTGATGATCTT
TGTCGCGCTCTATATGAATTAGTTGGTAAAAATACTACTAATGCATTATG
CTGCCCGCCATCCTATGACGGTTTTAGAAATTGGACATACACCATATCAA
ATACAGTGGCAACACAAAAATGCCCTGGAAAATCATTGAAGCCTTATTAT
AATGACAAAGAAAATATAACCAGAATGTGTTTGGCTAATGGCGTATGGGC
AAAGAAATCTAATTATGATCGGTGTATTATGATGCCAAATAAGATTGAAT
ATCACGTAATAGCCACCTGGTTTGTTGGGTACACGATTTCAACAATTGCT
TTGTGGATTGCTCTCATTTTATTCCGTTATTTTCGATCATTACGATGCAT
CCGAAATGATATACATTGCAATTTAATAGTATCCTACATTGTTCGGGTAT
TCACTTGGTATCTTATTATTGTTCCACAAATAACTACGACGGATTGGCCA
ATTACTATTGTAAACATTACAACAATAATTATCTTGTTCTCTCAAGCTTC
AAATTATCTCTGGATGTTCGTTGAAGGGTTTTATTTATTAATAATTATTG
TGTGGACCTATGGAATAGATAAATTAAAAATGTGGCATTACAGTCTCATT
GGATGGGGTTTCCCGACATTGCTATCAAGTATCTTAGCTATTTCAATTGC
ACTAACCGAAAATTTTAACGAAAGTTGGTTCAATAGTTCCAAAGCCAAAC
CTTTGAAGTTGTATATTATTCATATTCCCATTCTTATATCGATTATTGCA
AATGTATTCGTTCTGGCTGTAATTATCTATACGGTTTTCAAGAAGTTGAA
ACAGACAAAAATACCGGTTACCAGGCGCTCTAGTAAACTCTCTCTTTTTT
CAACAGAATATCGAAAAGCTATTAAAGCTGCTGCTGTTCTGATTCCCCTG
TTAGGAATAGCACATTGTCTTTTTATGTTTGAATCCAAAAGTTTAAAGTA
TCAAGACGCATACAAAATATTAACTGCTATTTTAACATCGACACAGGGAT
TTTTTGTGGCTCTGATTTATTGTTTCCTAAATCGTGAAGTTAGATTTGTC
TTAAAAGCAAAATATCGCAGTTTCCGAGGGTATTTGCCAAGTGCTAGTCG
GACAAGACAAACTATTGATGATTCGACTGGTCCGGTTCGAAGGGGAAATT
CAGCATTTAGACCTCTCAAACAAGATTATGACAATAATGTTTTTAAATGT
CGATCCTATCGCTCACAGCACAATAATAATGGAAACAATGCTAAACCGGT
TACTCCAATGAATAATGAATCTGATGTTGAAAATCAACAAACATAGTGAT
CATAAAGTTTAATCTTGTTTTAATCGACTGTCTCAGTGTAATTCACATGT
CCGTTTTGCAGCTTCAGATCGGAAATTTATGTTAATGTTTTGTCAATTCA
TTTGTCCATTTTATTATGTATATAGGCATTCACCATCATATGTTTTGTTT
GTATTTGTCAACAAATATGAGGAATAAAATGCAATTTTATTTTTGATACA
GAAAATAACTGGACTTCATTTTATTTTGAAATGTAAATAAACTC
back to top

protein sequence of SMED30013025-orf-1

>SMED30013025-orf-1 ID=SMED30013025-orf-1|Name=SMED30013025-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=444bp
MSNISIIELDDLCRALYELVGKNTTNALCCPPSYDGFRNWTYTISNTVAT
QKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPNKIEYHVIA
TWFVGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYL
IIVPQITTTDWPITIVNITTIIILFSQASNYLWMFVEGFYLLIIIVWTYG
IDKLKMWHYSLIGWGFPTLLSSILAISIALTENFNESWFNSSKAKPLKLY
IIHIPILISIIANVFVLAVIIYTVFKKLKQTKIPVTRRSSKLSLFSTEYR
KAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVAL
IYCFLNREVRFVLKAKYRSFRGYLPSASRTRQTIDDSTGPVRRGNSAFRP
LKQDYDNNVFKCRSYRSQHNNNGNNAKPVTPMNNESDVENQQT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000478pharynx musculature
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036445GPCR_2_extracell_dom_sf
IPR000832GPCR_2_secretin-like
IPR001879GPCR_2_extracellular_dom
IPR017983GPCR_2_secretin-like_CS
IPR017981GPCR_2-like
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004888transmembrane signaling receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000832GPCR, family 2, secretin-likePRINTSPR00249GPCRSECRETINcoord: 206..231
score: 31.1
coord: 132..156
score: 26.31
coord: 334..355
score: 47.69
coord: 168..191
score: 36.79
coord: 100..124
score: 34.31
coord: 302..322
score: 43.18
coord: 250..275
score: 30.25
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 101..348
e-value: 3.2E-44
score: 151.1
IPR001879GPCR, family 2, extracellular hormone receptor domainSMARTSM00008HormR_1coord: 26..96
e-value: 6.5E-6
score: 35.6
IPR001879GPCR, family 2, extracellular hormone receptor domainPFAMPF02793HRMcoord: 29..88
e-value: 2.6E-9
score: 37.2
IPR001879GPCR, family 2, extracellular hormone receptor domainPROSITEPS50227G_PROTEIN_RECEP_F2_3coord: 12..87
score: 12.485
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilyGENE3DG3DSA:4.10.1240.10coord: 2..95
e-value: 3.3E-13
score: 51.7
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilySUPERFAMILYSSF111418Hormone receptor domaincoord: 11..106
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 96..386
e-value: 1.6E-55
score: 190.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 420..443
NoneNo IPR availablePANTHERPTHR45620FAMILY NOT NAMEDcoord: 22..430
NoneNo IPR availablePANTHERPTHR45620:SF15DIURETIC HORMONE 44 RECEPTOR 2, ISOFORM Bcoord: 22..430
NoneNo IPR availableCDDcd152647tmB1_CRF-Rcoord: 96..367
e-value: 1.02655E-65
score: 209.581
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 85..377
NoneNo IPR availableTMHMMTMhelixcoord: 250..272
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 179..201
NoneNo IPR availableTMHMMTMhelixcoord: 334..356
NoneNo IPR availableTMHMMTMhelixcoord: 305..324
NoneNo IPR availableTMHMMTMhelixcoord: 208..230
NoneNo IPR availableTMHMMTMhelixcoord: 137..159
IPR017983GPCR, family 2, secretin-like, conserved sitePROSITEPS00650G_PROTEIN_RECEP_F2_2coord: 344..359
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 98..356
score: 31.647