Cell division cycle 14Ab

Overview
NameCell division cycle 14Ab
Smed IDSMED30013019
Length (bp)1598
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell division cycle 14Ab (SMED30013019) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell division cycle 14Ab (SMED30013019) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013019

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30013019SMESG000056024.1 SMESG000056023.1 dd_Smed_v4_2931_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30013019SMESG000056023.1 Contig30221uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013019SMESG000056023.1 Contig30221newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013019SMESG000056023.1 Contig46276uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30013019SMESG000056023.1 Contig46276newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30013019SMESG000056023.1 PL04017A1A02ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30013019SMESG000056023.1 PL05013A2G03ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30013019SMESG000056024.1 SMESG000056023.1 dd_Smed_v4_2931_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testis primordiumSMED30013019SMESG000056023.1 PL05013A2G03_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell division cycle 14Ab vs. Ensembl Human
Match: CDC14A (cell division cycle 14A [Source:HGNC Symbol;Acc:HGNC:1718])

HSP 1 Score: 334.724 bits (857), Expect = 2.725e-110
Identity = 151/328 (46.04%), Postives = 218/328 (66.46%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIG 1062
            LI ACE +K ++YF +     +   +    ++D + +Y+ +Y DFGPLNL  VYR+C  +NKK K Y  + ++I+H T  + R++ N+AFL+G + + YLK TP+E ++ LLS +N  Y+ FRDA+ G  ++ L++++CL+G  + L         F++ EYEHY+ ++NGD NWI+P K LAF+GP  + ++  GY  H PE Y   F K  V+AVVRLN   Y+   FT  G +H+DL F DG  PS+ +VR+F +I +N  GA+AVHCKAGLGRTGTLI CY+MK Y+FT +E IAW R+CRPGS+IG QQ++L + QA  W  G
Sbjct:    8 LIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDAGFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQG 335          
BLAST of Cell division cycle 14Ab vs. Ensembl Human
Match: CDC14B (cell division cycle 14B [Source:HGNC Symbol;Acc:HGNC:1719])

HSP 1 Score: 336.265 bits (861), Expect = 8.596e-110
Identity = 163/392 (41.58%), Postives = 236/392 (60.20%), Query Frame = 1
Query:   97 EIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNVD------LLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQ 1254
            E+IK ++ F    +  +   ++   ++D +  Y+ +Y DFGPLNL  VYR+C  +NKK K      ++I+H T ++ R++ N+AFL+GC+++ YL  TP+E +++L      YI FRDAA G  +FY++L++C     +A+    +    FNL EYEHY+  +NGD+NWIIP + +AF GP  R +L  GY  H+PE YI  F    V+ ++RLN   YD   FT  G DH DL F DG  P++ +V++F  I +NA GA+AVHCKAGLGRTGTLI CY+MK Y+ TA+E+IAW R+CRPGSVIG QQ +L+  Q   W  G    + ++   + +     S L+S   VD      + N    E E  S D  +  + +GD L +LKS  Q
Sbjct:   13 EVIKDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLS--GVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQ 402          
BLAST of Cell division cycle 14Ab vs. Ensembl Human
Match: CDC14A (cell division cycle 14A [Source:HGNC Symbol;Acc:HGNC:1718])

HSP 1 Score: 339.347 bits (869), Expect = 2.699e-109
Identity = 171/404 (42.33%), Postives = 248/404 (61.39%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIV--RQSSSHKVTETKSSL--------ISK-QNVDLLNDKVDETELSSYDKNL-TVIPRGDVLNSLKSFNQ 1254
            LI ACE +K ++YF +     +   +    ++D + +Y+ +Y DFGPLNL  VYR+C  +NKK K Y  + ++I+H T  + R++ N+AFL+G + + YLK TP+E ++ LLS +N  Y+ FRDA+ G  ++ L++++CL+G  + L         F++ EYEHY+ ++NGD NWI+P K LAF+GP  + ++  GY  H PE Y   F K  V+AVVRLN   Y+   FT  G +H+DL F DG  PS+ +VR+F +I +N  GA+AVHCKAGLGRTGTLI CY+MK Y+FT +E IAW R+CRPGS+IG QQ++L + QA  W  G      +  R SS   + +  S L        +SK QN+    ++  E  L   D  +   I +GD L +LKS  Q
Sbjct:    8 LIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDAGFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNM----ERFGEDNLEDDDVEMKNGITQGDKLRALKSQRQ 407          
BLAST of Cell division cycle 14Ab vs. Ensembl Human
Match: CDC14A (cell division cycle 14A [Source:HGNC Symbol;Acc:HGNC:1718])

HSP 1 Score: 339.732 bits (870), Expect = 4.933e-109
Identity = 171/404 (42.33%), Postives = 248/404 (61.39%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIV--RQSSSHKVTETKSSL--------ISK-QNVDLLNDKVDETELSSYDKNL-TVIPRGDVLNSLKSFNQ 1254
            LI ACE +K ++YF +     +   +    ++D + +Y+ +Y DFGPLNL  VYR+C  +NKK K Y  + ++I+H T  + R++ N+AFL+G + + YLK TP+E ++ LLS +N  Y+ FRDA+ G  ++ L++++CL+G  + L         F++ EYEHY+ ++NGD NWI+P K LAF+GP  + ++  GY  H PE Y   F K  V+AVVRLN   Y+   FT  G +H+DL F DG  PS+ +VR+F +I +N  GA+AVHCKAGLGRTGTLI CY+MK Y+FT +E IAW R+CRPGS+IG QQ++L + QA  W  G      +  R SS   + +  S L        +SK QN+    ++  E  L   D  +   I +GD L +LKS  Q
Sbjct:    8 LIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDAGFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNM----ERFGEDNLEDDDVEMKNGITQGDKLRALKSQRQ 407          
BLAST of Cell division cycle 14Ab vs. Ensembl Human
Match: CDC14A (cell division cycle 14A [Source:HGNC Symbol;Acc:HGNC:1718])

HSP 1 Score: 338.576 bits (867), Expect = 7.484e-109
Identity = 171/404 (42.33%), Postives = 248/404 (61.39%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIV--RQSSSHKVTETKSSL--------ISK-QNVDLLNDKVDETELSSYDKNL-TVIPRGDVLNSLKSFNQ 1254
            LI ACE +K ++YF +     +   +    ++D + +Y+ +Y DFGPLNL  VYR+C  +NKK K Y  + ++I+H T  + R++ N+AFL+G + + YLK TP+E ++ LLS +N  Y+ FRDA+ G  ++ L++++CL+G  + L         F++ EYEHY+ ++NGD NWI+P K LAF+GP  + ++  GY  H PE Y   F K  V+AVVRLN   Y+   FT  G +H+DL F DG  PS+ +VR+F +I +N  GA+AVHCKAGLGRTGTLI CY+MK Y+FT +E IAW R+CRPGS+IG QQ++L + QA  W  G      +  R SS   + +  S L        +SK QN+    ++  E  L   D  +   I +GD L +LKS  Q
Sbjct:    8 LIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDAGFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNM----ERFGEDNLEDDDVEMKNGITQGDKLRALKSQRQ 407          
BLAST of Cell division cycle 14Ab vs. Ensembl Celegans
Match: cdc-14 (Tyrosine-protein phosphatase cdc-14 [Source:UniProtKB/Swiss-Prot;Acc:P81299])

HSP 1 Score: 287.73 bits (735), Expect = 5.979e-89
Identity = 142/345 (41.16%), Postives = 209/345 (60.58%), Query Frame = 1
Query:  166 LVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRII-----HVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETF-KLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETEL 1182
             +N++  + Y+ +Y DFGP NL  +YR C  + K  ++ +  SRR++       T    + +VN+A+++G +LI Y   +  + + K+ S    +++ FRDA++G   + L L + LRG ++AL    +    F+  EYE Y+ ++NGD NWIIP K+L+F GP    +   GY YH P++Y   F + +VS +VRLN   YD S FTK G DH DL F DG  PS++++ KF  +VDN  G VAVHCKAGLGRTGTLI C++MK+Y  TA E + W R+CRPGSVIG QQ +LI+ Q +CW +         QS+   +T+ K     K+NV  L ++VD+  L
Sbjct:   48 FININNKFHYEPFYEDFGPWNLSVLYRLCVQVGKLLEVEEKRSRRVVLFCQDDGTGQYDKIRVNTAYVLGAYLIIYQGFSADDAYLKVSSGETVKFVGFRDASMGSPQYLLHLHDVLRGIEKALKFGWLDFSDFDYEEYEFYERVENGDFNWIIPGKILSFCGPHNESREENGYPYHAPDVYFDYFRENKVSTIVRLNAKNYDASKFTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDNTKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIGPQQPYLIEKQKFCWSLS--------QSNGVHLTQNKE---EKRNVRRLVNQVDDINL 381          
BLAST of Cell division cycle 14Ab vs. Ensembl Celegans
Match: cdc-14 (Tyrosine-protein phosphatase cdc-14 [Source:UniProtKB/Swiss-Prot;Acc:P81299])

HSP 1 Score: 287.73 bits (735), Expect = 5.979e-89
Identity = 142/345 (41.16%), Postives = 209/345 (60.58%), Query Frame = 1
Query:  166 LVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRII-----HVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETF-KLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETEL 1182
             +N++  + Y+ +Y DFGP NL  +YR C  + K  ++ +  SRR++       T    + +VN+A+++G +LI Y   +  + + K+ S    +++ FRDA++G   + L L + LRG ++AL    +    F+  EYE Y+ ++NGD NWIIP K+L+F GP    +   GY YH P++Y   F + +VS +VRLN   YD S FTK G DH DL F DG  PS++++ KF  +VDN  G VAVHCKAGLGRTGTLI C++MK+Y  TA E + W R+CRPGSVIG QQ +LI+ Q +CW +         QS+   +T+ K     K+NV  L ++VD+  L
Sbjct:   48 FININNKFHYEPFYEDFGPWNLSVLYRLCVQVGKLLEVEEKRSRRVVLFCQDDGTGQYDKIRVNTAYVLGAYLIIYQGFSADDAYLKVSSGETVKFVGFRDASMGSPQYLLHLHDVLRGIEKALKFGWLDFSDFDYEEYEFYERVENGDFNWIIPGKILSFCGPHNESREENGYPYHAPDVYFDYFRENKVSTIVRLNAKNYDASKFTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDNTKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIGPQQPYLIEKQKFCWSLS--------QSNGVHLTQNKE---EKRNVRRLVNQVDDINL 381          
BLAST of Cell division cycle 14Ab vs. Ensembl Celegans
Match: cdc-14 (Tyrosine-protein phosphatase cdc-14 [Source:UniProtKB/Swiss-Prot;Acc:P81299])

HSP 1 Score: 288.115 bits (736), Expect = 6.539e-89
Identity = 142/345 (41.16%), Postives = 209/345 (60.58%), Query Frame = 1
Query:  166 LVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRII-----HVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETF-KLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETEL 1182
             +N++  + Y+ +Y DFGP NL  +YR C  + K  ++ +  SRR++       T    + +VN+A+++G +LI Y   +  + + K+ S    +++ FRDA++G   + L L + LRG ++AL    +    F+  EYE Y+ ++NGD NWIIP K+L+F GP    +   GY YH P++Y   F + +VS +VRLN   YD S FTK G DH DL F DG  PS++++ KF  +VDN  G VAVHCKAGLGRTGTLI C++MK+Y  TA E + W R+CRPGSVIG QQ +LI+ Q +CW +         QS+   +T+ K     K+NV  L ++VD+  L
Sbjct:   48 FININNKFHYEPFYEDFGPWNLSVLYRLCVQVGKLLEVEEKRSRRVVLFCQDDGTGQYDKIRVNTAYVLGAYLIIYQGFSADDAYLKVSSGETVKFVGFRDASMGSPQYLLHLHDVLRGIEKALKFGWLDFSDFDYEEYEFYERVENGDFNWIIPGKILSFCGPHNESREENGYPYHAPDVYFDYFRENKVSTIVRLNAKNYDASKFTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDNTKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIGPQQPYLIEKQKFCWSLS--------QSNGVHLTQNKE---EKRNVRRLVNQVDDINL 381          
BLAST of Cell division cycle 14Ab vs. Ensembl Celegans
Match: cdc-14 (Tyrosine-protein phosphatase cdc-14 [Source:UniProtKB/Swiss-Prot;Acc:P81299])

HSP 1 Score: 288.115 bits (736), Expect = 6.539e-89
Identity = 142/345 (41.16%), Postives = 209/345 (60.58%), Query Frame = 1
Query:  166 LVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRII-----HVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETF-KLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETEL 1182
             +N++  + Y+ +Y DFGP NL  +YR C  + K  ++ +  SRR++       T    + +VN+A+++G +LI Y   +  + + K+ S    +++ FRDA++G   + L L + LRG ++AL    +    F+  EYE Y+ ++NGD NWIIP K+L+F GP    +   GY YH P++Y   F + +VS +VRLN   YD S FTK G DH DL F DG  PS++++ KF  +VDN  G VAVHCKAGLGRTGTLI C++MK+Y  TA E + W R+CRPGSVIG QQ +LI+ Q +CW +         QS+   +T+ K     K+NV  L ++VD+  L
Sbjct:   48 FININNKFHYEPFYEDFGPWNLSVLYRLCVQVGKLLEVEEKRSRRVVLFCQDDGTGQYDKIRVNTAYVLGAYLIIYQGFSADDAYLKVSSGETVKFVGFRDASMGSPQYLLHLHDVLRGIEKALKFGWLDFSDFDYEEYEFYERVENGDFNWIIPGKILSFCGPHNESREENGYPYHAPDVYFDYFRENKVSTIVRLNAKNYDASKFTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDNTKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIGPQQPYLIEKQKFCWSLS--------QSNGVHLTQNKE---EKRNVRRLVNQVDDINL 381          
BLAST of Cell division cycle 14Ab vs. Ensembl Celegans
Match: cdc-14 (Tyrosine-protein phosphatase cdc-14 [Source:UniProtKB/Swiss-Prot;Acc:P81299])

HSP 1 Score: 288.5 bits (737), Expect = 6.628e-89
Identity = 142/345 (41.16%), Postives = 209/345 (60.58%), Query Frame = 1
Query:  166 LVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRII-----HVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETF-KLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETEL 1182
             +N++  + Y+ +Y DFGP NL  +YR C  + K  ++ +  SRR++       T    + +VN+A+++G +LI Y   +  + + K+ S    +++ FRDA++G   + L L + LRG ++AL    +    F+  EYE Y+ ++NGD NWIIP K+L+F GP    +   GY YH P++Y   F + +VS +VRLN   YD S FTK G DH DL F DG  PS++++ KF  +VDN  G VAVHCKAGLGRTGTLI C++MK+Y  TA E + W R+CRPGSVIG QQ +LI+ Q +CW +         QS+   +T+ K     K+NV  L ++VD+  L
Sbjct:   48 FININNKFHYEPFYEDFGPWNLSVLYRLCVQVGKLLEVEEKRSRRVVLFCQDDGTGQYDKIRVNTAYVLGAYLIIYQGFSADDAYLKVSSGETVKFVGFRDASMGSPQYLLHLHDVLRGIEKALKFGWLDFSDFDYEEYEFYERVENGDFNWIIPGKILSFCGPHNESREENGYPYHAPDVYFDYFRENKVSTIVRLNAKNYDASKFTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDNTKGGVAVHCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIGPQQPYLIEKQKFCWSLS--------QSNGVHLTQNKE---EKRNVRRLVNQVDDINL 381          
BLAST of Cell division cycle 14Ab vs. Ensembl Fly
Match: cdc14 (gene:FBgn0031952 transcript:FBtr0343424)

HSP 1 Score: 308.531 bits (789), Expect = 1.270e-96
Identity = 153/381 (40.16%), Postives = 232/381 (60.89%), Query Frame = 1
Query:   67 NSTTMLINACEIIKKKIYFLSTDTVVQEQPDLVL--VNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLL-QGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISR-----IVRQSSSHKVTETKSSLISK-----QNVDLLNDKV 1167
            +++ +L+ A E+ + ++YF++    ++ +  +     +VD ++IY+ +Y DFGPLN+  +YR+C  +N K     + +++I+H TS N  +++N+A+L+G + I YL  TPQE ++ L++     Y  F DA+ G S+F +SL++CL    + L         F+  EYE+++ ++NGD NWI+P+K +AF GP  + + L  GY  H PE Y S F    V+ V+RLN   Y  SSF   G DH DL F DG  PS+ +++KF  I +   GA+AVHCKAGLGRTG+LIG Y+MK Y FTA E+IAW R+CRPGSVIG+QQ W+ D Q+W W  G  + R     I++ +      E K  L S      ++VDLL  +V
Sbjct:    5 DNSDLLVCASEMQEDRLYFVAFKKNIKPKNTVNTHYFSVDEEFIYENFYNDFGPLNICMLYRYCMKLNTKLNAKCHANKKIVHYTSMNPAKRLNAAYLIGSYAIIYLNKTPQEAYRPLVAGEIPAYTRFCDASYGPSNFKISLLDCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNGYPCHAPERYFSYFRDNNVTTVIRLNAKVYHASSFENAGFDHKDLFFIDGSTPSDAIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQQWMEDKQSWLWSEGERMRRRTSLPILQHTYGINSLELKKKLASAAADSTEHVDLLLTRV 385          
BLAST of Cell division cycle 14Ab vs. Ensembl Fly
Match: cdc14 (gene:FBgn0031952 transcript:FBtr0301330)

HSP 1 Score: 308.531 bits (789), Expect = 1.408e-96
Identity = 153/381 (40.16%), Postives = 232/381 (60.89%), Query Frame = 1
Query:   67 NSTTMLINACEIIKKKIYFLSTDTVVQEQPDLVL--VNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLL-QGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISR-----IVRQSSSHKVTETKSSLISK-----QNVDLLNDKV 1167
            +++ +L+ A E+ + ++YF++    ++ +  +     +VD ++IY+ +Y DFGPLN+  +YR+C  +N K     + +++I+H TS N  +++N+A+L+G + I YL  TPQE ++ L++     Y  F DA+ G S+F +SL++CL    + L         F+  EYE+++ ++NGD NWI+P+K +AF GP  + + L  GY  H PE Y S F    V+ V+RLN   Y  SSF   G DH DL F DG  PS+ +++KF  I +   GA+AVHCKAGLGRTG+LIG Y+MK Y FTA E+IAW R+CRPGSVIG+QQ W+ D Q+W W  G  + R     I++ +      E K  L S      ++VDLL  +V
Sbjct:    5 DNSDLLVCASEMQEDRLYFVAFKKNIKPKNTVNTHYFSVDEEFIYENFYNDFGPLNICMLYRYCMKLNTKLNAKCHANKKIVHYTSMNPAKRLNAAYLIGSYAIIYLNKTPQEAYRPLVAGEIPAYTRFCDASYGPSNFKISLLDCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNGYPCHAPERYFSYFRDNNVTTVIRLNAKVYHASSFENAGFDHKDLFFIDGSTPSDAIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQQWMEDKQSWLWSEGERMRRRTSLPILQHTYGINSLELKKKLASAAADSTEHVDLLLTRV 385          
BLAST of Cell division cycle 14Ab vs. Ensembl Fly
Match: cdc14 (gene:FBgn0031952 transcript:FBtr0301331)

HSP 1 Score: 308.531 bits (789), Expect = 1.624e-96
Identity = 153/381 (40.16%), Postives = 232/381 (60.89%), Query Frame = 1
Query:   67 NSTTMLINACEIIKKKIYFLSTDTVVQEQPDLVL--VNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLL-QGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISR-----IVRQSSSHKVTETKSSLISK-----QNVDLLNDKV 1167
            +++ +L+ A E+ + ++YF++    ++ +  +     +VD ++IY+ +Y DFGPLN+  +YR+C  +N K     + +++I+H TS N  +++N+A+L+G + I YL  TPQE ++ L++     Y  F DA+ G S+F +SL++CL    + L         F+  EYE+++ ++NGD NWI+P+K +AF GP  + + L  GY  H PE Y S F    V+ V+RLN   Y  SSF   G DH DL F DG  PS+ +++KF  I +   GA+AVHCKAGLGRTG+LIG Y+MK Y FTA E+IAW R+CRPGSVIG+QQ W+ D Q+W W  G  + R     I++ +      E K  L S      ++VDLL  +V
Sbjct:    5 DNSDLLVCASEMQEDRLYFVAFKKNIKPKNTVNTHYFSVDEEFIYENFYNDFGPLNICMLYRYCMKLNTKLNAKCHANKKIVHYTSMNPAKRLNAAYLIGSYAIIYLNKTPQEAYRPLVAGEIPAYTRFCDASYGPSNFKISLLDCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNGYPCHAPERYFSYFRDNNVTTVIRLNAKVYHASSFENAGFDHKDLFFIDGSTPSDAIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQQWMEDKQSWLWSEGERMRRRTSLPILQHTYGINSLELKKKLASAAADSTEHVDLLLTRV 385          
BLAST of Cell division cycle 14Ab vs. Ensembl Fly
Match: cdc14 (gene:FBgn0031952 transcript:FBtr0343423)

HSP 1 Score: 308.145 bits (788), Expect = 1.195e-93
Identity = 153/381 (40.16%), Postives = 232/381 (60.89%), Query Frame = 1
Query:   67 NSTTMLINACEIIKKKIYFLSTDTVVQEQPDLVL--VNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLL-QGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISR-----IVRQSSSHKVTETKSSLISK-----QNVDLLNDKV 1167
            +++ +L+ A E+ + ++YF++    ++ +  +     +VD ++IY+ +Y DFGPLN+  +YR+C  +N K     + +++I+H TS N  +++N+A+L+G + I YL  TPQE ++ L++     Y  F DA+ G S+F +SL++CL    + L         F+  EYE+++ ++NGD NWI+P+K +AF GP  + + L  GY  H PE Y S F    V+ V+RLN   Y  SSF   G DH DL F DG  PS+ +++KF  I +   GA+AVHCKAGLGRTG+LIG Y+MK Y FTA E+IAW R+CRPGSVIG+QQ W+ D Q+W W  G  + R     I++ +      E K  L S      ++VDLL  +V
Sbjct:    5 DNSDLLVCASEMQEDRLYFVAFKKNIKPKNTVNTHYFSVDEEFIYENFYNDFGPLNICMLYRYCMKLNTKLNAKCHANKKIVHYTSMNPAKRLNAAYLIGSYAIIYLNKTPQEAYRPLVAGEIPAYTRFCDASYGPSNFKISLLDCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNGYPCHAPERYFSYFRDNNVTTVIRLNAKVYHASSFENAGFDHKDLFFIDGSTPSDAIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQQWMEDKQSWLWSEGERMRRRTSLPILQHTYGINSLELKKKLASAAADSTEHVDLLLTRV 385          
BLAST of Cell division cycle 14Ab vs. Ensembl Fly
Match: cdc14 (gene:FBgn0031952 transcript:FBtr0079492)

HSP 1 Score: 308.145 bits (788), Expect = 1.195e-93
Identity = 153/381 (40.16%), Postives = 232/381 (60.89%), Query Frame = 1
Query:   67 NSTTMLINACEIIKKKIYFLSTDTVVQEQPDLVL--VNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLL-QGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISR-----IVRQSSSHKVTETKSSLISK-----QNVDLLNDKV 1167
            +++ +L+ A E+ + ++YF++    ++ +  +     +VD ++IY+ +Y DFGPLN+  +YR+C  +N K     + +++I+H TS N  +++N+A+L+G + I YL  TPQE ++ L++     Y  F DA+ G S+F +SL++CL    + L         F+  EYE+++ ++NGD NWI+P+K +AF GP  + + L  GY  H PE Y S F    V+ V+RLN   Y  SSF   G DH DL F DG  PS+ +++KF  I +   GA+AVHCKAGLGRTG+LIG Y+MK Y FTA E+IAW R+CRPGSVIG+QQ W+ D Q+W W  G  + R     I++ +      E K  L S      ++VDLL  +V
Sbjct:    5 DNSDLLVCASEMQEDRLYFVAFKKNIKPKNTVNTHYFSVDEEFIYENFYNDFGPLNICMLYRYCMKLNTKLNAKCHANKKIVHYTSMNPAKRLNAAYLIGSYAIIYLNKTPQEAYRPLVAGEIPAYTRFCDASYGPSNFKISLLDCLNAVHKGLQAGFFNFNDFDAEEYEYFERVENGDFNWIVPQKFIAFCGPHQKSKTLPNGYPCHAPERYFSYFRDNNVTTVIRLNAKVYHASSFENAGFDHKDLFFIDGSTPSDAIMKKFLSICETTKGAIAVHCKAGLGRTGSLIGAYIMKHYGFTALEAIAWLRLCRPGSVIGHQQQWMEDKQSWLWSEGERMRRRTSLPILQHTYGINSLELKKKLASAAADSTEHVDLLLTRV 385          
BLAST of Cell division cycle 14Ab vs. Ensembl Zebrafish
Match: cdc14ab (cell division cycle 14Ab [Source:NCBI gene;Acc:565969])

HSP 1 Score: 359.762 bits (922), Expect = 2.063e-118
Identity = 169/394 (42.89%), Postives = 250/394 (63.45%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSL--ISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQ 1254
            L+ A E IK ++YF +  +  +   +    + D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TP+E ++ L+S +N  Y+ FRDA+ G  ++ L++++CL+G  +AL    +    F++ EYEHY+ ++NGD+NWI P KLLAF+GP  + ++  GY  H PE Y   F K  V+ +VRLN   YD   FT  G DH+DL F DG  PS+ + R+F HI ++ +GAVAVHCKAGLGRTGTLIGCYLMK Y+FT++E+IAW R+CRPGS+IG QQ++L + QA  W  G  +    RQ     V +  SS+  +S       +  +D  E + Y +N   + +GD L +LK   Q
Sbjct:   24 LLGASEFIKDRLYFATLRSKPKSTANTHYFSTDEEFVYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRANAAVLIGAYAVIYLKKTPEEAYRALISGSNASYLPFRDASFGNCTYNLTVLDCLQGIRKALQHGFLNFETFDVNEYEHYERVENGDLNWITPGKLLAFSGPHPKSKVENGYPLHAPEAYFPYFRKHNVTTIVRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPSDIITRRFLHICESTSGAVAVHCKAGLGRTGTLIGCYLMKHYRFTSAEAIAWIRICRPGSIIGPQQHYLEEKQASLWAHGDSLRSKQRQYQDRSVPQLISSMDNLSISTSIFKSHSLDRMEENDYAENDLGMTQGDKLRALKGRRQ 417          
BLAST of Cell division cycle 14Ab vs. Ensembl Zebrafish
Match: cdc14ab (cell division cycle 14Ab [Source:NCBI gene;Acc:565969])

HSP 1 Score: 360.147 bits (923), Expect = 1.587e-117
Identity = 169/394 (42.89%), Postives = 250/394 (63.45%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSL--ISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQ 1254
            L+ A E IK ++YF +  +  +   +    + D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TP+E ++ L+S +N  Y+ FRDA+ G  ++ L++++CL+G  +AL    +    F++ EYEHY+ ++NGD+NWI P KLLAF+GP  + ++  GY  H PE Y   F K  V+ +VRLN   YD   FT  G DH+DL F DG  PS+ + R+F HI ++ +GAVAVHCKAGLGRTGTLIGCYLMK Y+FT++E+IAW R+CRPGS+IG QQ++L + QA  W  G  +    RQ     V +  SS+  +S       +  +D  E + Y +N   + +GD L +LK   Q
Sbjct:   24 LLGASEFIKDRLYFATLRSKPKSTANTHYFSTDEEFVYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRANAAVLIGAYAVIYLKKTPEEAYRALISGSNASYLPFRDASFGNCTYNLTVLDCLQGIRKALQHGFLNFETFDVNEYEHYERVENGDLNWITPGKLLAFSGPHPKSKVENGYPLHAPEAYFPYFRKHNVTTIVRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPSDIITRRFLHICESTSGAVAVHCKAGLGRTGTLIGCYLMKHYRFTSAEAIAWIRICRPGSIIGPQQHYLEEKQASLWAHGDSLRSKQRQYQDRSVPQLISSMDNLSISTSIFKSHSLDRMEENDYAENDLGMTQGDKLRALKGRRQ 417          
BLAST of Cell division cycle 14Ab vs. Ensembl Zebrafish
Match: cdc14aa (cell division cycle 14Aa [Source:ZFIN;Acc:ZDB-GENE-040426-1214])

HSP 1 Score: 343.969 bits (881), Expect = 2.453e-111
Identity = 180/408 (44.12%), Postives = 250/408 (61.27%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGS-----------PISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKA 1269
            L +A E IK ++YF +  +  +   +      D +YIY+ +Y DFGPLNL  +YR+C  +NKK K +  + +RIIH TS + R++ N+AFL+G + + YLK TP+E ++ L+S  N  Y+ FRDAA G  ++ L++++CL+G  +AL         F++ EYEHY+ ++NGD NWI+P KLLAF+GP  + ++  GY  H PE Y S F +  V+ VVRLN   Y+   FT  G +H DL F DG  PS+ L R+F HI ++A GAVAVHCKAGLGRTGTLIGCYLMK Y+FTA E+IAWTR+CRPGSVIG QQ++L   Q   W  G              SR   ++ SH ++   +  +S  +  L    VDE E    D  LT   +GD L +LK   Q H ++
Sbjct:    6 LRDASEFIKDRLYFATLRSKPKSTANTHFFCTDDEYIYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLSRKRIIHYTSYDQRKRANAAFLIGAYAVIYLKRTPEEVYRALISGTNVSYLPFRDAAFGNCTYDLTILDCLQGIRKALQHGFFDFENFDVEEYEHYERVENGDFNWIVPGKLLAFSGPHPKSKIENGYPLHAPEAYFSYFRQHNVTDVVRLNKKIYEGRRFTDAGFEHHDLFFVDGTTPSDLLTRRFLHICESAKGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAPEAIAWTRICRPGSVIGPQQHFLEQKQHSMWVQGDLHRSKQKQQQLRQSRQQERNMSHLISSVDN--LSIDSSILKPPSVDENEFREEDMILT---QGDKLLALKG--QRHPRS 406          
BLAST of Cell division cycle 14Ab vs. Ensembl Zebrafish
Match: cdc14b (cell division cycle 14B [Source:ZFIN;Acc:ZDB-GENE-040426-820])

HSP 1 Score: 309.686 bits (792), Expect = 6.111e-100
Identity = 158/406 (38.92%), Postives = 234/406 (57.64%), Query Frame = 1
Query:   64 GNSTTMLINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPI-SRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETELSSYDKNLTV--------IPRGDVLNSLKSFNQ 1254
            G +  +  N  E IK ++YF      V+  PD     +D +  Y+ +Y DFGPLNL  +YRFC  + KK K   +  ++I+  T  + +++ N+A+L+G + + +L+ TP+E + LL   N  Y+ FRDA+ G   + L++++CLR   +AL    +    FN+ EYEHY+  +NGD NWI+P K LAF+ P  + ++  GY  H PE Y   F K  V+ ++RLN   YD   FT VG  H DL F DG  P++ +V +F HI +NA G +AVHCKAGLGRTGTLIGCYLMK ++ TA+E+IAW R+CRPGSVIG QQN++ + Q+  W  G     +I  Q +    T     L   +++ +       ++  +  +N T         + +GD L +LKS  Q
Sbjct:    5 GVTLDLQPNCIEFIKDQLYFALLHQKVRSTPDRHCFCIDEELSYENFYADFGPLNLAMLYRFCCKLKKKLKSCAHAKKKIVFYTYGDRKKQANAAYLIGSYAVMHLQKTPEEAYSLLVSQNAPYLPFRDASFGACMYNLNILDCLRAVHKALQFGWLDFTQFNVEEYEHYERAENGDFNWILPGKFLAFSSPHPKSKIENGYPLHAPEAYFPYFRKHNVTTIIRLNKKMYDSKRFTDVGFKHHDLFFVDGSTPNDSIVSRFLHICENADGVIAVHCKAGLGRTGTLIGCYLMKHFRLTAAEAIAWIRICRPGSVIGPQQNFVDEMQSSLWAEGELYRQKINEQENGSAKTAVAGILSGVEDISINGTNKSTSQRKTASQNHTEEEEEDCAGLTQGDKLRALKSKRQ 410          
BLAST of Cell division cycle 14Ab vs. Ensembl Zebrafish
Match: cdc14b (cell division cycle 14B [Source:ZFIN;Acc:ZDB-GENE-040426-820])

HSP 1 Score: 304.294 bits (778), Expect = 2.189e-97
Identity = 154/393 (39.19%), Postives = 228/393 (58.02%), Query Frame = 1
Query:  103 IKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPI-SRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETELSSYDKNLTV--------IPRGDVLNSLKSFNQ 1254
            I  ++YF      V+  PD     +D +  Y+ +Y DFGPLNL  +YRFC  + KK K   +  ++I+  T  + +++ N+A+L+G + + +L+ TP+E + LL   N  Y+ FRDA+ G   + L++++CLR   +AL    +    FN+ EYEHY+  +NGD NWI+P K LAF+ P  + ++  GY  H PE Y   F K  V+ ++RLN   YD   FT VG  H DL F DG  P++ +V +F HI +NA G +AVHCKAGLGRTGTLIGCYLMK ++ TA+E+IAW R+CRPGSVIG QQN++ + Q+  W  G     +I  Q +    T     L   +++ +       ++  +  +N T         + +GD L +LKS  Q
Sbjct:   29 ITDQLYFALLHQKVRSTPDRHCFCIDEELSYENFYADFGPLNLAMLYRFCCKLKKKLKSCAHAKKKIVFYTYGDRKKQANAAYLIGSYAVMHLQKTPEEAYSLLVSQNAPYLPFRDASFGACMYNLNILDCLRAVHKALQFGWLDFTQFNVEEYEHYERAENGDFNWILPGKFLAFSSPHPKSKIENGYPLHAPEAYFPYFRKHNVTTIIRLNKKMYDSKRFTDVGFKHHDLFFVDGSTPNDSIVSRFLHICENADGVIAVHCKAGLGRTGTLIGCYLMKHFRLTAAEAIAWIRICRPGSVIGPQQNFVDEMQSSLWAEGELYRQKINEQENGSAKTAVAGILSGVEDISINGTNKSTSQRKTASQNHTEEEEEDCAGLTQGDKLRALKSKRQ 421          
BLAST of Cell division cycle 14Ab vs. Ensembl Xenopus
Match: CDC14A (cell division cycle 14A [Source:NCBI gene;Acc:100490252])

HSP 1 Score: 334.724 bits (857), Expect = 8.019e-108
Identity = 164/408 (40.20%), Postives = 245/408 (60.05%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETK----------SSLISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAA 1272
            LI+A E+IK ++YF +     +   +      D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  + ++I+H TS   R++ N+ FL+  + I YLK +P+E ++ LLS  N +Y+ FRDA+ G  ++ L++++CL+G  +AL         F+  EYEHY+ ++NGD NWI+P K LAF+GP  + ++  GY  H PE Y   F K  + AV+RLN   YD   FT  G DH+DL F DG  PS+ +VR+F ++ +N  GA+AVHCKAGLGRTGTLI CY+MK Y+ T SE+IAW R+CRPGS+IG QQ++L + Q W W  G       +Q  S     T+          S   S  N+   + +++  +   +   LT   +GD L +LKS  + H ++A
Sbjct:    6 LISASELIKDRLYFATLRNKPKSTLNTHYFCTDEEFVYENFYADFGPLNLAQLYRYCCKLNKKLKSFSLSRKKIVHYTSFEQRKRANAGFLISAYAIIYLKKSPEEVYRALLSGTNAQYLPFRDASFGSCTYNLTILDCLQGIRKALYFGFFNFENFDADEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFRKHNIRAVIRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPSDGIVRRFLNLCENTDGAIAVHCKAGLGRTGTLIACYIMKHYRLTHSEAIAWIRICRPGSIIGPQQHFLEEKQTWLWLQGDLHRSNQKQIQSEDQAVTRILTDFGELSLSGKFSSNNIYERDREINSDDELDHSNGLT---QGDKLRALKS--RRHPRSA 408          
BLAST of Cell division cycle 14Ab vs. Ensembl Xenopus
Match: cdc14b (cell division cycle 14B [Source:NCBI gene;Acc:733733])

HSP 1 Score: 325.094 bits (832), Expect = 1.873e-105
Identity = 156/430 (36.28%), Postives = 246/430 (57.21%), Query Frame = 1
Query:   64 GNSTTMLINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGS---------------PISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEMKGSSFISNMI 1308
            GN      ++C  I  ++YF    +  +        ++D + +Y+ +Y DFGPLNL  +YR+C  +NKK K +  T ++I+H T  + +++ N+AFL+G F I YL   P E ++LL      Y+ FRDA+ G  +F+L+L++C     +AL       + F++ EY+HY+  +NGD NWIIP+K LAF+GP  + ++  GY +H PE Y   F K  ++ ++RLN   Y+   FT    +H+DL F DG  PS+ +VRKF +I +NA GA+AVHCKAGLGRTGTLIG Y+MK Y+ TA+E+IAW R+CRPGSVIG QQ ++++ Q   W  G                 ++ I+       +++ K     K+++ L ++  D+  +         + +GD L +LK      K+   + G++ +S+ I
Sbjct:   34 GNDFEQEADSCMPITDRLYFAILCSRPKTTSGTHYFSIDDELVYENFYADFGPLNLALLYRYCMKLNKKIKSFSLTKKKIVHYTCGDDKKQANAAFLVGSFAIIYLNKQPLELYRLLQTAKTNYLPFRDASFGTCTFHLTLLDCFFAVHKALQYNFFDFKTFDVEEYQHYERAENGDFNWIIPEKFLAFSGPHQKSKIESGYPHHAPEAYFPYFRKHNITTIIRLNKKMYEAKRFTDANFEHYDLFFVDGSTPSDAIVRKFLNICENAEGAIAVHCKAGLGRTGTLIGSYMMKHYRMTAAETIAWIRICRPGSVIGPQQQFMVEKQRSLWNEGDIYRKKLQEQENGNRCAVTFILSGVDDISISDDKGKACGKEDIGLYSEDDDDESIH--------VTQGDKLRALKC-----KRQTRVSGAAPLSHSI 450          
BLAST of Cell division cycle 14Ab vs. Ensembl Xenopus
Match: cdc14b (cell division cycle 14B [Source:NCBI gene;Acc:733733])

HSP 1 Score: 321.627 bits (823), Expect = 1.459e-104
Identity = 154/422 (36.49%), Postives = 244/422 (57.82%), Query Frame = 1
Query:   88 NACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGS---------------PISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEMKGSSFISNMI 1308
             A ++ K ++YF    +  +        ++D + +Y+ +Y DFGPLNL  +YR+C  +NKK K +  T ++I+H T  + +++ N+AFL+G F I YL   P E ++LL      Y+ FRDA+ G  +F+L+L++C     +AL       + F++ EY+HY+  +NGD NWIIP+K LAF+GP  + ++  GY +H PE Y   F K  ++ ++RLN   Y+   FT    +H+DL F DG  PS+ +VRKF +I +NA GA+AVHCKAGLGRTGTLIG Y+MK Y+ TA+E+IAW R+CRPGSVIG QQ ++++ Q   W  G                 ++ I+       +++ K     K+++ L ++  D+  +         + +GD L +LK      K+   + G++ +S+ I
Sbjct:   10 GAVQLSKDRLYFAILCSRPKTTSGTHYFSIDDELVYENFYADFGPLNLALLYRYCMKLNKKIKSFSLTKKKIVHYTCGDDKKQANAAFLVGSFAIIYLNKQPLELYRLLQTAKTNYLPFRDASFGTCTFHLTLLDCFFAVHKALQYNFFDFKTFDVEEYQHYERAENGDFNWIIPEKFLAFSGPHQKSKIESGYPHHAPEAYFPYFRKHNITTIIRLNKKMYEAKRFTDANFEHYDLFFVDGSTPSDAIVRKFLNICENAEGAIAVHCKAGLGRTGTLIGSYMMKHYRMTAAETIAWIRICRPGSVIGPQQQFMVEKQRSLWNEGDIYRKKLQEQENGNRCAVTFILSGVDDISISDDKGKACGKEDIGLYSEDDDDESIH--------VTQGDKLRALKC-----KRQTRVSGAAPLSHSI 418          
BLAST of Cell division cycle 14Ab vs. Ensembl Xenopus
Match: cdc14b (cell division cycle 14B [Source:NCBI gene;Acc:733733])

HSP 1 Score: 323.553 bits (828), Expect = 3.129e-104
Identity = 157/440 (35.68%), Postives = 249/440 (56.59%), Query Frame = 1
Query:   64 GNSTTMLINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGS---------------PISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEMKGSSFISNMIWDDENFPKFG 1338
            GN      ++C  I  ++YF    +  +        ++D + +Y+ +Y DFGPLNL  +YR+C  +NKK K +  T ++I+H T  + +++ N+AFL+G F I YL   P E ++LL      Y+ FRDA+ G  +F+L+L++C     +AL       + F++ EY+HY+  +NGD NWIIP+K LAF+GP  + ++  GY +H PE Y   F K  ++ ++RLN   Y+   FT    +H+DL F DG  PS+ +VRKF +I +NA GA+AVHCKAGLGRTGTLIG Y+MK Y+ TA+E+IAW R+CRPGSVIG QQ ++++ Q   W  G                 ++ I+       +++ K     K+++ L ++  D+  +         + +GD L +LK      K+   + G++ +S ++      P+ G
Sbjct:   34 GNDFEQEADSCMPITDRLYFAILCSRPKTTSGTHYFSIDDELVYENFYADFGPLNLALLYRYCMKLNKKIKSFSLTKKKIVHYTCGDDKKQANAAFLVGSFAIIYLNKQPLELYRLLQTAKTNYLPFRDASFGTCTFHLTLLDCFFAVHKALQYNFFDFKTFDVEEYQHYERAENGDFNWIIPEKFLAFSGPHQKSKIESGYPHHAPEAYFPYFRKHNITTIIRLNKKMYEAKRFTDANFEHYDLFFVDGSTPSDAIVRKFLNICENAEGAIAVHCKAGLGRTGTLIGSYMMKHYRMTAAETIAWIRICRPGSVIGPQQQFMVEKQRSLWNEGDIYRKKLQEQENGNRCAVTFILSGVDDISISDDKGKACGKEDIGLYSEDDDDESIH--------VTQGDKLRALKC-----KRQTRVSGAAPLSVILQSRLQPPQSG 460          
BLAST of Cell division cycle 14Ab vs. Ensembl Xenopus
Match: cdc14b (cell division cycle 14B [Source:NCBI gene;Acc:733733])

HSP 1 Score: 322.013 bits (824), Expect = 5.482e-104
Identity = 154/418 (36.84%), Postives = 238/418 (56.94%), Query Frame = 1
Query:   64 GNSTTMLINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGS---------------PISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAA 1272
            GN      ++C  I  ++YF    +  +        ++D + +Y+ +Y DFGPLNL  +YR+C  +NKK K +  T ++I+H T  + +++ N+AFL+G F I YL   P E ++LL      Y+ FRDA+ G  +F+L+L++C     +AL       + F++ EY+HY+  +NGD NWIIP+K LAF+GP  + ++  GY +H PE Y   F K  ++ ++RLN   Y+   FT    +H+DL F DG  PS+ +VRKF +I +NA GA+AVHCKAGLGRTGTLIG Y+MK Y+ TA+E+IAW R+CRPGSVIG QQ ++++ Q   W  G                 ++ I+       +++ K     K+++ L ++  D+  +         + +GD L +LK   Q     A
Sbjct:   34 GNDFEQEADSCMPITDRLYFAILCSRPKTTSGTHYFSIDDELVYENFYADFGPLNLALLYRYCMKLNKKIKSFSLTKKKIVHYTCGDDKKQANAAFLVGSFAIIYLNKQPLELYRLLQTAKTNYLPFRDASFGTCTFHLTLLDCFFAVHKALQYNFFDFKTFDVEEYQHYERAENGDFNWIIPEKFLAFSGPHQKSKIESGYPHHAPEAYFPYFRKHNITTIIRLNKKMYEAKRFTDANFEHYDLFFVDGSTPSDAIVRKFLNICENAEGAIAVHCKAGLGRTGTLIGSYMMKHYRMTAAETIAWIRICRPGSVIGPQQQFMVEKQRSLWNEGDIYRKKLQEQENGNRCAVTFILSGVDDISISDDKGKACGKEDIGLYSEDDDDESIH--------VTQGDKLRALKCKRQTRVSGA 443          
BLAST of Cell division cycle 14Ab vs. Ensembl Mouse
Match: Cdc14b (CDC14 cell division cycle 14B [Source:MGI Symbol;Acc:MGI:2441808])

HSP 1 Score: 342.813 bits (878), Expect = 1.191e-112
Identity = 174/415 (41.93%), Postives = 243/415 (58.55%), Query Frame = 1
Query:   97 EIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNV----DLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEMK------GSSFISNMIW 1311
            E+I+ ++ F    +  +   +    ++D +  Y+ +Y DFGPLNL  VYR+C  +NKK K      ++IIH T T+ R++ N+AFL+GC+++ YL  TP++ ++ L   +  YI FRDAA G  SFY++L++C     +A+         FNL EYEHY+  +NGD NWIIP++ LAF GP  R +L  GY  H+PE YI  F    V+ ++RLN   YD   FT  G DH DL FPDG  P+E +V++F  I +N  GA+AVHCKAGLGRTGTLIGCYLMK Y+ TA+ESIAW R+CRPGSVIG QQ +L+  Q+  W  G    + +R   +  + E  S  +S  +      L N    E E  S D  ++ + +GD L +LKS  Q    A  +        S+  S  IW
Sbjct:   13 EVIRDRLCFAILYSRPKSATNEHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIIHFTGTDQRKQANAAFLVGCYMVIYLGRTPEDAYRTLIFGDTAYIPFRDAAYGSCSFYITLLDCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGYHQHSPETYIPYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFPDGSTPAESIVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIGPQQQFLVMKQSSLWLEGDYFRQKLRGQENGPLREAFSKHLSDADDLSLNGLENQDNQEPEPYSDDDEVSGMTQGDRLRALKSRRQPKASAIPLTCPLAVLTSALCSVAIW 427          
BLAST of Cell division cycle 14Ab vs. Ensembl Mouse
Match: Cdc14b (CDC14 cell division cycle 14B [Source:MGI Symbol;Acc:MGI:2441808])

HSP 1 Score: 342.428 bits (877), Expect = 6.061e-112
Identity = 171/390 (43.85%), Postives = 233/390 (59.74%), Query Frame = 1
Query:  172 NVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNV----DLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEMK------GSSFISNMIW 1311
            ++D +  Y+ +Y DFGPLNL  VYR+C  +NKK K      ++IIH T T+ R++ N+AFL+GC+++ YL  TP++ ++ L   +  YI FRDAA G  SFY++L++C     +A+         FNL EYEHY+  +NGD NWIIP++ LAF GP  R +L  GY  H+PE YI  F    V+ ++RLN   YD   FT  G DH DL FPDG  P+E +V++F  I +N  GA+AVHCKAGLGRTGTLIGCYLMK Y+ TA+ESIAW R+CRPGSVIG QQ +L+  Q+  W  G    + +R   +  + E  S  +S  +      L N    E E  S D  ++ + +GD L +LKS  Q    A  +        S+  S  IW
Sbjct:   75 SIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIIHFTGTDQRKQANAAFLVGCYMVIYLGRTPEDAYRTLIFGDTAYIPFRDAAYGSCSFYITLLDCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGYHQHSPETYIPYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFPDGSTPAESIVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIGPQQQFLVMKQSSLWLEGDYFRQKLRGQENGPLREAFSKHLSDADDLSLNGLENQDNQEPEPYSDDDEVSGMTQGDRLRALKSRRQPKASAIPLTCPLAVLTSALCSVAIW 464          
BLAST of Cell division cycle 14Ab vs. Ensembl Mouse
Match: Cdc14b (CDC14 cell division cycle 14B [Source:MGI Symbol;Acc:MGI:2441808])

HSP 1 Score: 342.428 bits (877), Expect = 6.061e-112
Identity = 171/390 (43.85%), Postives = 233/390 (59.74%), Query Frame = 1
Query:  172 NVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNV----DLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEMK------GSSFISNMIW 1311
            ++D +  Y+ +Y DFGPLNL  VYR+C  +NKK K      ++IIH T T+ R++ N+AFL+GC+++ YL  TP++ ++ L   +  YI FRDAA G  SFY++L++C     +A+         FNL EYEHY+  +NGD NWIIP++ LAF GP  R +L  GY  H+PE YI  F    V+ ++RLN   YD   FT  G DH DL FPDG  P+E +V++F  I +N  GA+AVHCKAGLGRTGTLIGCYLMK Y+ TA+ESIAW R+CRPGSVIG QQ +L+  Q+  W  G    + +R   +  + E  S  +S  +      L N    E E  S D  ++ + +GD L +LKS  Q    A  +        S+  S  IW
Sbjct:   75 SIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIIHFTGTDQRKQANAAFLVGCYMVIYLGRTPEDAYRTLIFGDTAYIPFRDAAYGSCSFYITLLDCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGYHQHSPETYIPYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFPDGSTPAESIVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIGPQQQFLVMKQSSLWLEGDYFRQKLRGQENGPLREAFSKHLSDADDLSLNGLENQDNQEPEPYSDDDEVSGMTQGDRLRALKSRRQPKASAIPLTCPLAVLTSALCSVAIW 464          
BLAST of Cell division cycle 14Ab vs. Ensembl Mouse
Match: Cdc14b (CDC14 cell division cycle 14B [Source:MGI Symbol;Acc:MGI:2441808])

HSP 1 Score: 342.428 bits (877), Expect = 6.061e-112
Identity = 171/390 (43.85%), Postives = 233/390 (59.74%), Query Frame = 1
Query:  172 NVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNV----DLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEMK------GSSFISNMIW 1311
            ++D +  Y+ +Y DFGPLNL  VYR+C  +NKK K      ++IIH T T+ R++ N+AFL+GC+++ YL  TP++ ++ L   +  YI FRDAA G  SFY++L++C     +A+         FNL EYEHY+  +NGD NWIIP++ LAF GP  R +L  GY  H+PE YI  F    V+ ++RLN   YD   FT  G DH DL FPDG  P+E +V++F  I +N  GA+AVHCKAGLGRTGTLIGCYLMK Y+ TA+ESIAW R+CRPGSVIG QQ +L+  Q+  W  G    + +R   +  + E  S  +S  +      L N    E E  S D  ++ + +GD L +LKS  Q    A  +        S+  S  IW
Sbjct:   75 SIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIIHFTGTDQRKQANAAFLVGCYMVIYLGRTPEDAYRTLIFGDTAYIPFRDAAYGSCSFYITLLDCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGYHQHSPETYIPYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFPDGSTPAESIVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIGPQQQFLVMKQSSLWLEGDYFRQKLRGQENGPLREAFSKHLSDADDLSLNGLENQDNQEPEPYSDDDEVSGMTQGDRLRALKSRRQPKASAIPLTCPLAVLTSALCSVAIW 464          
BLAST of Cell division cycle 14Ab vs. Ensembl Mouse
Match: Cdc14b (CDC14 cell division cycle 14B [Source:MGI Symbol;Acc:MGI:2441808])

HSP 1 Score: 342.428 bits (877), Expect = 7.180e-112
Identity = 167/370 (45.14%), Postives = 227/370 (61.35%), Query Frame = 1
Query:  172 NVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNV----DLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKA 1269
            ++D +  Y+ +Y DFGPLNL  VYR+C  +NKK K      ++IIH T T+ R++ N+AFL+GC+++ YL  TP++ ++ L   +  YI FRDAA G  SFY++L++C     +A+         FNL EYEHY+  +NGD NWIIP++ LAF GP  R +L  GY  H+PE YI  F    V+ ++RLN   YD   FT  G DH DL FPDG  P+E +V++F  I +N  GA+AVHCKAGLGRTGTLIGCYLMK Y+ TA+ESIAW R+CRPGSVIG QQ +L+  Q+  W  G    + +R   +  + E  S  +S  +      L N    E E  S D  ++ + +GD L +LKS  Q    A
Sbjct:   75 SIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIIHFTGTDQRKQANAAFLVGCYMVIYLGRTPEDAYRTLIFGDTAYIPFRDAAYGSCSFYITLLDCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGYHQHSPETYIPYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFPDGSTPAESIVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIGPQQQFLVMKQSSLWLEGDYFRQKLRGQENGPLREAFSKHLSDADDLSLNGLENQDNQEPEPYSDDDEVSGMTQGDRLRALKSRRQPKASA 444          
BLAST of Cell division cycle 14Ab vs. UniProt/SwissProt
Match: sp|A0A0R4IVA4|CC14A_DANRE (Dual specificity protein phosphatase CDC14AB OS=Danio rerio OX=7955 GN=cdc14ab PE=3 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 1.734e-116
Identity = 169/394 (42.89%), Postives = 250/394 (63.45%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSL--ISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQ 1254
            L+ A E IK ++YF +  +  +   +    + D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TP+E ++ L+S +N  Y+ FRDA+ G  ++ L++++CL+G  +AL    +    F++ EYEHY+ ++NGD+NWI P KLLAF+GP  + ++  GY  H PE Y   F K  V+ +VRLN   YD   FT  G DH+DL F DG  PS+ + R+F HI ++ +GAVAVHCKAGLGRTGTLIGCYLMK Y+FT++E+IAW R+CRPGS+IG QQ++L + QA  W  G  +    RQ     V +  SS+  +S       +  +D  E + Y +N   + +GD L +LK   Q
Sbjct:   24 LLGASEFIKDRLYFATLRSKPKSTANTHYFSTDEEFVYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRANAAVLIGAYAVIYLKKTPEEAYRALISGSNASYLPFRDASFGNCTYNLTVLDCLQGIRKALQHGFLNFETFDVNEYEHYERVENGDLNWITPGKLLAFSGPHPKSKVENGYPLHAPEAYFPYFRKHNVTTIVRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPSDIITRRFLHICESTSGAVAVHCKAGLGRTGTLIGCYLMKHYRFTSAEAIAWIRICRPGSIIGPQQHYLEEKQASLWAHGDSLRSKQRQYQDRSVPQLISSMDNLSISTSIFKSHSLDRMEENDYAENDLGMTQGDKLRALKGRRQ 417          
BLAST of Cell division cycle 14Ab vs. UniProt/SwissProt
Match: sp|Q6PFY9|CC14B_MOUSE (Dual specificity protein phosphatase CDC14B OS=Mus musculus OX=10090 GN=Cdc14b PE=2 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 4.240e-111
Identity = 171/390 (43.85%), Postives = 233/390 (59.74%), Query Frame = 1
Query:  172 NVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNV----DLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEMK------GSSFISNMIW 1311
            ++D +  Y+ +Y DFGPLNL  VYR+C  +NKK K      ++IIH T T+ R++ N+AFL+GC+++ YL  TP++ ++ L   +  YI FRDAA G  SFY++L++C     +A+         FNL EYEHY+  +NGD NWIIP++ LAF GP  R +L  GY  H+PE YI  F    V+ ++RLN   YD   FT  G DH DL FPDG  P+E +V++F  I +N  GA+AVHCKAGLGRTGTLIGCYLMK Y+ TA+ESIAW R+CRPGSVIG QQ +L+  Q+  W  G    + +R   +  + E  S  +S  +      L N    E E  S D  ++ + +GD L +LKS  Q    A  +        S+  S  IW
Sbjct:   75 SIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIIHFTGTDQRKQANAAFLVGCYMVIYLGRTPEDAYRTLIFGDTAYIPFRDAAYGSCSFYITLLDCFHAVKKAMQYGFFNFNSFNLDEYEHYEKAENGDFNWIIPERFLAFCGPHSRSRLESGYHQHSPETYIPYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFPDGSTPAESIVQEFLDICENVKGAIAVHCKAGLGRTGTLIGCYLMKHYRMTAAESIAWLRICRPGSVIGPQQQFLVMKQSSLWLEGDYFRQKLRGQENGPLREAFSKHLSDADDLSLNGLENQDNQEPEPYSDDDEVSGMTQGDRLRALKSRRQPKASAIPLTCPLAVLTSALCSVAIW 464          
BLAST of Cell division cycle 14Ab vs. UniProt/SwissProt
Match: sp|Q6GQT0|CC14A_MOUSE (Dual specificity protein phosphatase CDC14A OS=Mus musculus OX=10090 GN=Cdc14a PE=1 SV=2)

HSP 1 Score: 343.199 bits (879), Expect = 6.535e-110
Identity = 171/409 (41.81%), Postives = 254/409 (62.10%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIV--RQSSSHKVTETKSSL--------ISK-QNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAA 1272
            LI ACE +K ++YF +     +   ++   ++D + +Y+ +Y DFGPLNL  VYR+C  +NKK K Y  + ++I+H TS + R++ N+AFL+G + + YLK TP+E ++ LLS +N  Y+ FRDA+ G  ++ L++++CL+G  + L         F+  EYEHY+ ++NGD NWI+P K LAF+GP  + ++  GY  H PE Y   F K  V+ +VRLN   Y+   FT  G +H+DL F DG  PS+ +VR+F +I +N  GA+AVHCKAGLGRTGTLI CY+MK Y+FT +E IAW R+CRPGS+IG QQ++L + QA  W  G      +  R SS   +T+  S+L        +SK Q+ + + +   E E      N+T   +GD L +LKS  Q H +++
Sbjct:    8 LIGACEFMKDRLYFATLRNRPKSTINIHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTSFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTVLDCLQGIRKGLQHGFFDFETFDAEEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKNNVTTIVRLNKKIYEAKRFTDAGFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIGPQQHFLKEKQASLWVQGDIFRSKLKNRPSSEGSITKIISTLDDMSIGANLSKLQSTERIGENNFEDEDMEIKNNVT---QGDKLRALKS--QRHPRSS 411          
BLAST of Cell division cycle 14Ab vs. UniProt/SwissProt
Match: sp|Q9UNH5|CC14A_HUMAN (Dual specificity protein phosphatase CDC14A OS=Homo sapiens OX=9606 GN=CDC14A PE=1 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 1.296e-108
Identity = 171/404 (42.33%), Postives = 248/404 (61.39%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIV--RQSSSHKVTETKSSL--------ISK-QNVDLLNDKVDETELSSYDKNL-TVIPRGDVLNSLKSFNQ 1254
            LI ACE +K ++YF +     +   +    ++D + +Y+ +Y DFGPLNL  VYR+C  +NKK K Y  + ++I+H T  + R++ N+AFL+G + + YLK TP+E ++ LLS +N  Y+ FRDA+ G  ++ L++++CL+G  + L         F++ EYEHY+ ++NGD NWI+P K LAF+GP  + ++  GY  H PE Y   F K  V+AVVRLN   Y+   FT  G +H+DL F DG  PS+ +VR+F +I +N  GA+AVHCKAGLGRTGTLI CY+MK Y+FT +E IAW R+CRPGS+IG QQ++L + QA  W  G      +  R SS   + +  S L        +SK QN+    ++  E  L   D  +   I +GD L +LKS  Q
Sbjct:    8 LIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYERVENGDFNWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKHNVTAVVRLNKKIYEAKRFTDAGFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFTHAEIIAWIRICRPGSIIGPQQHFLEEKQASLWVQGDIFRSKLKNRPSSEGSINKILSGLDDMSIGGNLSKTQNM----ERFGEDNLEDDDVEMKNGITQGDKLRALKSQRQ 407          
BLAST of Cell division cycle 14Ab vs. UniProt/SwissProt
Match: sp|O60729|CC14B_HUMAN (Dual specificity protein phosphatase CDC14B OS=Homo sapiens OX=9606 GN=CDC14B PE=1 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 3.527e-107
Identity = 159/367 (43.32%), Postives = 225/367 (61.31%), Query Frame = 1
Query:  172 NVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNVD------LLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQ 1254
            ++D +  Y+ +Y DFGPLNL  VYR+C  +NKK K      ++I+H T ++ R++ N+AFL+GC+++ YL  TP+E +++L      YI FRDAA G  +FY++L++C     +A+    +    FNL EYEHY+  +NGD+NWIIP + +AF GP  R +L  GY  H+PE YI  F    V+ ++RLN   YD   FT  G DH DL F DG  P++ +V++F  I +NA GA+AVHCKAGLGRTGTLI CY+MK Y+ TA+E+IAW R+CRPGSVIG QQ +L+  Q   W  G    + ++   + +     S L+S   VD      + N    E E  S D  +  + +GD L +LKS  Q
Sbjct:   75 SIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLS--GVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQ 439          
BLAST of Cell division cycle 14Ab vs. TrEMBL
Match: A5PMX2 (Dual-specificity protein phosphatase CDC14AB OS=Danio rerio OX=7955 GN=cdc14ab PE=4 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 4.616e-115
Identity = 169/394 (42.89%), Postives = 250/394 (63.45%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSL--ISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQ 1254
            L+ A E IK ++YF +  +  +   +    + D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TP+E ++ L+S +N  Y+ FRDA+ G  ++ L++++CL+G  +AL    +    F++ EYEHY+ ++NGD+NWI P KLLAF+GP  + ++  GY  H PE Y   F K  V+ +VRLN   YD   FT  G DH+DL F DG  PS+ + R+F HI ++ +GAVAVHCKAGLGRTGTLIGCYLMK Y+FT++E+IAW R+CRPGS+IG QQ++L + QA  W  G  +    RQ     V +  SS+  +S       +  +D  E + Y +N   + +GD L +LK   Q
Sbjct:   24 LLGASEFIKDRLYFATLRSKPKSTANTHYFSTDEEFVYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRANAAVLIGAYAVIYLKKTPEEAYRALISGSNASYLPFRDASFGNCTYNLTVLDCLQGIRKALQHGFLNFETFDVNEYEHYERVENGDLNWITPGKLLAFSGPHPKSKVENGYPLHAPEAYFPYFRKHNVTTIVRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPSDIITRRFLHICESTSGAVAVHCKAGLGRTGTLIGCYLMKHYRFTSAEAIAWIRICRPGSIIGPQQHYLEEKQASLWAHGDSLRSKQRQYQDRSVPQLISSMDNLSISTSIFKSHSLDRMEENDYAENDLGMTQGDKLRALKGRRQ 417          
BLAST of Cell division cycle 14Ab vs. TrEMBL
Match: A0A2U3TW85 (Dual-specificity protein phosphatase CDC14AB OS=Danio rerio OX=7955 GN=cdc14ab PE=4 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 3.551e-114
Identity = 169/394 (42.89%), Postives = 250/394 (63.45%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSL--ISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQ 1254
            L+ A E IK ++YF +  +  +   +    + D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TP+E ++ L+S +N  Y+ FRDA+ G  ++ L++++CL+G  +AL    +    F++ EYEHY+ ++NGD+NWI P KLLAF+GP  + ++  GY  H PE Y   F K  V+ +VRLN   YD   FT  G DH+DL F DG  PS+ + R+F HI ++ +GAVAVHCKAGLGRTGTLIGCYLMK Y+FT++E+IAW R+CRPGS+IG QQ++L + QA  W  G  +    RQ     V +  SS+  +S       +  +D  E + Y +N   + +GD L +LK   Q
Sbjct:   24 LLGASEFIKDRLYFATLRSKPKSTANTHYFSTDEEFVYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRANAAVLIGAYAVIYLKKTPEEAYRALISGSNASYLPFRDASFGNCTYNLTVLDCLQGIRKALQHGFLNFETFDVNEYEHYERVENGDLNWITPGKLLAFSGPHPKSKVENGYPLHAPEAYFPYFRKHNVTTIVRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPSDIITRRFLHICESTSGAVAVHCKAGLGRTGTLIGCYLMKHYRFTSAEAIAWIRICRPGSIIGPQQHYLEEKQASLWAHGDSLRSKQRQYQDRSVPQLISSMDNLSISTSIFKSHSLDRMEENDYAENDLGMTQGDKLRALKGRRQ 417          
BLAST of Cell division cycle 14Ab vs. TrEMBL
Match: A0A2T7NNN8 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_16029 PE=4 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.607e-113
Identity = 177/421 (42.04%), Postives = 261/421 (62.00%), Query Frame = 1
Query:   61 VGNSTTMLINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRI-------VRQSSSHKVTETKSSLISKQNVDLLNDKVD-ETELSSYD--------KNLTVIPRGDVLNSLKSFNQIHKKAA 1272
            + +   ++ +A E IK+++YF +  T  +        + D + +Y+ +Y DFGPLNL  +YR+C  +NKK K +    +RI+H TS ++R++ N+AFL+  + I YLK TP+E +K L++ +N  ++ FRDA+ G  S+ L+L++CL G  +AL         F++ EYEHY+ ++NGD NWI+P K LAF GP  + ++  GY  H PE Y   F K +V+A+VRLN   YD   F   G DH+DL F DG VP++ +VR+F  + +N+ GAVAVHCKAGLGRTGTLIGCY+MK YKFTA+E+IAW R+CRPGS+IG QQN+L + QAW W  G  + R         RQ   H    + S+L+S  +   ++D ++ +   SSYD        ++  V  +GD LN LK   + H ++A
Sbjct:    1 MADDHDVIGSASEFIKERLYFATLRTRPKSTAHTHYFSTDDELVYENFYADFGPLNLANLYRYCCKVNKKLKSFSLAKKRIVHYTSFDARKRANAAFLIASYAIIYLKKTPEEAYKPLVAGSNPPFLPFRDASFGPCSYNLTLLDCLHGLSKALSNGFFNFETFDVDEYEHYEKVENGDFNWIVPGKFLAFCGPHPKSKIENGYPLHAPEAYFPYFRKHKVAAIVRLNKKIYDARRFKDAGFDHYDLFFVDGSVPTDVIVRQFLELAENSDGAVAVHCKAGLGRTGTLIGCYIMKHYKFTAAEAIAWCRICRPGSIIGPQQNFLEEKQAWLWMQGD-LYRAKHKADFKERQRERH---HSVSNLLSSVDDMRIHDAIENDNRFSSYDNIYDPPITRSSDVETQGDKLNQLKLLRK-HPRSA 416          
BLAST of Cell division cycle 14Ab vs. TrEMBL
Match: M3ZTI7 (Cell division cycle 14Ab OS=Xiphophorus maculatus OX=8083 PE=4 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 5.425e-113
Identity = 173/394 (43.91%), Postives = 253/394 (64.21%), Query Frame = 1
Query:   88 NACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSP--ISRIVRQSSSHKVTETKS-SLISKQNVDLLN----DKVDETELSSYDKNLTVIPRGDVLNSLKS 1245
             A E+IK ++YF +  +  +   +      D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TP+E F+ LLS +N  Y+ FRDA+ G  ++ L++++CL+G  +AL         F++ EYEHY+ ++NGD+NWI+P K LAF+GP  + ++  GY  H PE Y   F K+ V+ ++RLN   YD   FT  G DH+DL F DG  P++ +VR+F H+ +NA GAVAVHCKAGLGRTGTLIGCYLMK Y+FTA+E+IAWTR+CRPGSVIG QQN+L D QA  W + SP  +       ++H +      SL S  N + L     D + E +++    + + + +GD L +LKS
Sbjct:    9 GAAEMIKDRLYFATLRSKPKSTVNTHYFCTDDEFVYENFYTDFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRANAAVLIGGYAVIYLKKTPEEAFRALLSGSNAAYLPFRDASFGNCTYNLTVLDCLQGIRKALQHGFFDFETFDVDEYEHYERVENGDLNWIVPGKFLAFSGPHPKSRIENGYPLHAPEAYFPYFRKYGVTTIIRLNKKIYDGKRFTNAGFDHYDLFFVDGSTPNDAIVRRFLHVCENAQGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAAEAIAWTRICRPGSVIGPQQNFLEDKQASLW-LQSPHTLKGRTEDQTAHLINGLDELSLSSAHNANFLRSASADHLQEGDIT----DGSGLTQGDKLRALKS 397          
BLAST of Cell division cycle 14Ab vs. TrEMBL
Match: A0A3B5QFL9 (Cell division cycle 14Ab OS=Xiphophorus maculatus OX=8083 PE=4 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 1.338e-112
Identity = 173/394 (43.91%), Postives = 253/394 (64.21%), Query Frame = 1
Query:   88 NACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSP--ISRIVRQSSSHKVTETKS-SLISKQNVDLLN----DKVDETELSSYDKNLTVIPRGDVLNSLKS 1245
             A E+IK ++YF +  +  +   +      D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TP+E F+ LLS +N  Y+ FRDA+ G  ++ L++++CL+G  +AL         F++ EYEHY+ ++NGD+NWI+P K LAF+GP  + ++  GY  H PE Y   F K+ V+ ++RLN   YD   FT  G DH+DL F DG  P++ +VR+F H+ +NA GAVAVHCKAGLGRTGTLIGCYLMK Y+FTA+E+IAWTR+CRPGSVIG QQN+L D QA  W + SP  +       ++H +      SL S  N + L     D + E +++    + + + +GD L +LKS
Sbjct:    9 GAAEMIKDRLYFATLRSKPKSTVNTHYFCTDDEFVYENFYTDFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRANAAVLIGGYAVIYLKKTPEEAFRALLSGSNAAYLPFRDASFGNCTYNLTVLDCLQGIRKALQHGFFDFETFDVDEYEHYERVENGDLNWIVPGKFLAFSGPHPKSRIENGYPLHAPEAYFPYFRKYGVTTIIRLNKKIYDGKRFTNAGFDHYDLFFVDGSTPNDAIVRRFLHVCENAQGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAAEAIAWTRICRPGSVIGPQQNFLEDKQASLW-LQSPHTLKGRTEDQTAHLINGLDELSLSSAHNANFLRSASADHLQEGDIT----DGSGLTQGDKLRALKS 397          
BLAST of Cell division cycle 14Ab vs. Ensembl Cavefish
Match: cdc14ab (cell division cycle 14A [Source:NCBI gene;Acc:103025254])

HSP 1 Score: 338.576 bits (867), Expect = 1.192e-108
Identity = 165/399 (41.35%), Postives = 247/399 (61.90%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKS----SLISKQNVDLLNDKVDET-------ELSSYDKNLTVIPRGDVLNSLK 1242
            L+ A E +K ++YF +  +  +   +      D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TP+E ++ L+S +N  Y+ FRDA+ G   + L++++CL+G  +A     +    F++ EYEHY+ ++NGD NWI+  K LAF+GP  + ++  GY  H PE Y   F K  V+ ++RLN   YD   FT  G DH+DL F DG  PS+ + R+F HI ++  GAVAVHCKAGLGRTGTLIGCYLMK Y+FTA+E+IAW R+CRPGS+IG QQ++L + Q   W  G  + R  +Q    +V E +S     LIS  +   ++  + +T       E + Y +N   + +GD L +LK
Sbjct:   24 LLGASEFMKDRLYFATLRSKPKSTANTHYFCTDDEFVYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRANAAVLIGAYAVIYLKKTPEEAYRALISGSNASYLPFRDASFGNCMYNLTILDCLQGIRKAQQHGFLNFETFDVTEYEHYERVENGDFNWIVRGKFLAFSGPHPKSKVENGYPLHAPEAYFPYFRKHNVTTIIRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPSDVITRRFLHICESTDGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAAEAIAWIRVCRPGSIIGPQQHFLEEKQVSLWAQGE-VCRAQQQKL--RVYEERSVGVPHLISSMDDLTISTSILKTSSLDRVEENNDYSENGLAMTQGDKLRALK 419          
BLAST of Cell division cycle 14Ab vs. Ensembl Cavefish
Match: cdc14ab (cell division cycle 14A [Source:NCBI gene;Acc:103025254])

HSP 1 Score: 338.961 bits (868), Expect = 1.252e-108
Identity = 167/401 (41.65%), Postives = 248/401 (61.85%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKS----SLISKQN-----VDLLN----DKVDETELSSYDKNLTVIPRGDVLNSLK 1242
            L+ A E +K ++YF +  +  +   +      D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TP+E ++ L+S +N  Y+ FRDA+ G   + L++++CL+G  +A     +    F++ EYEHY+ ++NGD NWI+  K LAF+GP  + ++  GY  H PE Y   F K  V+ ++RLN   YD   FT  G DH+DL F DG  PS+ + R+F HI ++  GAVAVHCKAGLGRTGTLIGCYLMK Y+FTA+E+IAW R+CRPGS+IG QQ++L + Q   W  G  + R  +Q    +V E +S     LIS  +       +L     D+V+E   + Y +N   + +GD L +LK
Sbjct:   24 LLGASEFMKDRLYFATLRSKPKSTANTHYFCTDDEFVYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRANAAVLIGAYAVIYLKKTPEEAYRALISGSNASYLPFRDASFGNCMYNLTILDCLQGIRKAQQHGFLNFETFDVTEYEHYERVENGDFNWIVRGKFLAFSGPHPKSKVENGYPLHAPEAYFPYFRKHNVTTIIRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPSDVITRRFLHICESTDGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAAEAIAWIRVCRPGSIIGPQQHFLEEKQVSLWAQGE-VCRAQQQKL--RVYEERSVGVPHLISSMDDLTISTSILKTSSLDRVEEN--NDYSENGLAMTQGDKLRALK 419          
BLAST of Cell division cycle 14Ab vs. Ensembl Cavefish
Match: cdc14ab (cell division cycle 14A [Source:NCBI gene;Acc:103025254])

HSP 1 Score: 332.028 bits (850), Expect = 5.595e-106
Identity = 162/393 (41.22%), Postives = 243/393 (61.83%), Query Frame = 1
Query:  100 IIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKS----SLISKQNVDLLNDKVDET-------ELSSYDKNLTVIPRGDVLNSLK 1242
            +I  ++YF +  +  +   +      D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TP+E ++ L+S +N  Y+ FRDA+ G   + L++++CL+G  +A     +    F++ EYEHY+ ++NGD NWI+  K LAF+GP  + ++  GY  H PE Y   F K  V+ ++RLN   YD   FT  G DH+DL F DG  PS+ + R+F HI ++  GAVAVHCKAGLGRTGTLIGCYLMK Y+FTA+E+IAW R+CRPGS+IG QQ++L + Q   W  G  + R  +Q    +V E +S     LIS  +   ++  + +T       E + Y +N   + +GD L +LK
Sbjct:   29 LIADRLYFATLRSKPKSTANTHYFCTDDEFVYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRANAAVLIGAYAVIYLKKTPEEAYRALISGSNASYLPFRDASFGNCMYNLTILDCLQGIRKAQQHGFLNFETFDVTEYEHYERVENGDFNWIVRGKFLAFSGPHPKSKVENGYPLHAPEAYFPYFRKHNVTTIIRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPSDVITRRFLHICESTDGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAAEAIAWIRVCRPGSIIGPQQHFLEEKQVSLWAQGE-VCRAQQQKL--RVYEERSVGVPHLISSMDDLTISTSILKTSSLDRVEENNDYSENGLAMTQGDKLRALK 418          
BLAST of Cell division cycle 14Ab vs. Ensembl Cavefish
Match: cdc14ab (cell division cycle 14A [Source:NCBI gene;Acc:103025254])

HSP 1 Score: 330.487 bits (846), Expect = 2.331e-105
Identity = 166/415 (40.00%), Postives = 248/415 (59.76%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKL----------------YQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKS----SLISKQNVDLLNDKVDET-------ELSSYDKNLTVIPRGDVLNSLK 1242
            L+ A E +K ++YF +  +  +   +      D +++Y+ +Y DFGPLNL  +YR+C  +NKK KL                +  T +RI+H TS + R++ N+A L+G + + YLK TP+E ++ L+S +N  Y+ FRDA+ G   + L++++CL+G  +A     +    F++ EYEHY+ ++NGD NWI+  K LAF+GP  + ++  GY  H PE Y   F K  V+ ++RLN   YD   FT  G DH+DL F DG  PS+ + R+F HI ++  GAVAVHCKAGLGRTGTLIGCYLMK Y+FTA+E+IAW R+CRPGS+IG QQ++L + Q   W  G  + R  +Q    +V E +S     LIS  +   ++  + +T       E + Y +N   + +GD L +LK
Sbjct:   24 LLGASEFMKDRLYFATLRSKPKSTANTHYFCTDDEFVYENFYADFGPLNLAMLYRYCCKLNKKLKLARCSYLMCSCLGMLKSFTLTRKRIVHYTSFDQRKRANAAVLIGAYAVIYLKKTPEEAYRALISGSNASYLPFRDASFGNCMYNLTILDCLQGIRKAQQHGFLNFETFDVTEYEHYERVENGDFNWIVRGKFLAFSGPHPKSKVENGYPLHAPEAYFPYFRKHNVTTIIRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPSDVITRRFLHICESTDGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAAEAIAWIRVCRPGSIIGPQQHFLEEKQVSLWAQGE-VCRAQQQKL--RVYEERSVGVPHLISSMDDLTISTSILKTSSLDRVEENNDYSENGLAMTQGDKLRALK 435          
BLAST of Cell division cycle 14Ab vs. Ensembl Cavefish
Match: cdc14ab (cell division cycle 14A [Source:NCBI gene;Acc:103025254])

HSP 1 Score: 330.102 bits (845), Expect = 3.654e-105
Identity = 166/415 (40.00%), Postives = 248/415 (59.76%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKL----------------YQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKS----SLISKQNVDLLNDKVDET-------ELSSYDKNLTVIPRGDVLNSLK 1242
            L+ A E +K ++YF +  +  +   +      D +++Y+ +Y DFGPLNL  +YR+C  +NKK KL                +  T +RI+H TS + R++ N+A L+G + + YLK TP+E ++ L+S +N  Y+ FRDA+ G   + L++++CL+G  +A     +    F++ EYEHY+ ++NGD NWI+  K LAF+GP  + ++  GY  H PE Y   F K  V+ ++RLN   YD   FT  G DH+DL F DG  PS+ + R+F HI ++  GAVAVHCKAGLGRTGTLIGCYLMK Y+FTA+E+IAW R+CRPGS+IG QQ++L + Q   W  G  + R  +Q    +V E +S     LIS  +   ++  + +T       E + Y +N   + +GD L +LK
Sbjct:   24 LLGASEFMKDRLYFATLRSKPKSTANTHYFCTDDEFVYENFYADFGPLNLAMLYRYCCKLNKKLKLARCSYLMCSCLGMLKSFTLTRKRIVHYTSFDQRKRANAAVLIGAYAVIYLKKTPEEAYRALISGSNASYLPFRDASFGNCMYNLTILDCLQGIRKAQQHGFLNFETFDVTEYEHYERVENGDFNWIVRGKFLAFSGPHPKSKVENGYPLHAPEAYFPYFRKHNVTTIIRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPSDVITRRFLHICESTDGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAAEAIAWIRVCRPGSIIGPQQHFLEEKQVSLWAQGE-VCRAQQQKL--RVYEERSVGVPHLISSMDDLTISTSILKTSSLDRVEENNDYSENGLAMTQGDKLRALK 435          
BLAST of Cell division cycle 14Ab vs. Ensembl Sea Lamprey
Match: cdc14ab (cell division cycle 14Ab [Source:NCBI gene;Acc:565969])

HSP 1 Score: 193.356 bits (490), Expect = 2.027e-58
Identity = 87/163 (53.37%), Postives = 115/163 (70.55%), Query Frame = 1
Query:  577 NIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLID-HQAWCWKIG 1062
            +++NGD NWI+P++ LAF+GP  + ++  GY  H+PE YI  F K  V+ V+RLN   YD   FT  G+ H DL FPDG  PS  +VRKF  I +   GAVAVHCKAGLGRTGTLI CYLMK ++ TA+E++AW R+CRPGS+IG QQ++L++  Q+  W  G
Sbjct:    2 HVENGDFNWIVPERFLAFSGPHPKSKVENGYPLHSPESYIPYFRKNGVTTVIRLNKKIYDARRFTDAGLAHHDLFFPDGSSPSPDIVRKFCEICEGTRGAVAVHCKAGLGRTGTLIACYLMKHHRLTAAEAVAWIRICRPGSIIGPQQHFLLEWRQSGLWAQG 164          
BLAST of Cell division cycle 14Ab vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009327.1 (pep scaffold:Pmarinus_7.0:GL486696:158815:164749:-1 gene:ENSPMAG00000008438.1 transcript:ENSPMAT00000009327.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 1.741e-20
Identity = 39/113 (34.51%), Postives = 69/113 (61.06%), Query Frame = 1
Query:  112 KIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFR 447
            ++YF +  +  +   +    + D + +Y+ +Y DFGPLNL  +YRFC  +NKK K +    +RI++ T  + R++ N+AFL+G + + YLK T +E ++ L++ N   Y+ FR
Sbjct:    1 RLYFSTLRSKPRSTANTHYFSTDDELVYENFYADFGPLNLAMLYRFCCKLNKKLKSFSLARKRIVYYTGPDQRKRANAAFLIGSYAVIYLKRTAEEAYRPLVAGNTPPYLPFR 113          
BLAST of Cell division cycle 14Ab vs. Ensembl Sea Lamprey
Match: ptp4a1 (protein tyrosine phosphatase 4A1 [Source:ZFIN;Acc:ZDB-GENE-041121-11])

HSP 1 Score: 60.8474 bits (146), Expect = 3.826e-11
Identity = 37/118 (31.36%), Postives = 57/118 (48.31%), Query Frame = 1
Query:  691 YISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIV-----DNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWL 1029
            +I    K+ V+ VVR+    YDKS   + GI  FD  F DG  PS K+V  + ++      D     + VHC AGLGR   L+   L+ +      +++ + R  R G++   Q  +L
Sbjct:   36 FIEELKKYNVTTVVRVCEVTYDKSPVEQQGISVFDWSFDDGAPPSNKIVDDWLNLCKTKFRDEPDCCIGVHCVAGLGRAPVLVALALI-ESGMKYEDAVQFIRQKRRGAINSKQLLYL 152          
BLAST of Cell division cycle 14Ab vs. Ensembl Sea Lamprey
Match: dusp23b (dual specificity phosphatase 23b [Source:ZFIN;Acc:ZDB-GENE-040718-163])

HSP 1 Score: 55.8398 bits (133), Expect = 1.157e-9
Identity = 26/70 (37.14%), Postives = 41/70 (58.57%), Query Frame = 1
Query:  820 PSEKLVRKFFHIVDNATG---AVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQ 1020
            P  + + +F  IV +A     AVAVHC  G GRTGT++ C+L++    +  +++A  R  RPGS+   +Q
Sbjct:   70 PLPEQIERFLDIVSDAGAKGEAVAVHCMHGHGRTGTMLACFLVRHRALSGVDAVAEIRRLRPGSIETREQ 139          
BLAST of Cell division cycle 14Ab vs. Ensembl Yeast
Match: CDC14 (Protein phosphatase required for mitotic exit; required for rDNA segregation, cytokinesis, meiosis I spindle disassembly, environmental stress response; held in nucleolus by Cdc55p in early meiosis, liberated by FEAR and Mitotic Exit Network in anaphase, enabling it to effect a decrease in CDK/B-cyclin activity and mitotic exit; sequestered in metaphase II, released upon entry into anaphase II; human homolog CDC14A can complement thermosensitivity of yeast cdc14-1 mutant [Source:SGD;Acc:S000001924])

HSP 1 Score: 204.912 bits (520), Expect = 9.731e-60
Identity = 113/330 (34.24%), Postives = 181/330 (54.85%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLY----HTPEMYISI---FHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNAT---GAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQ 1041
            L N  E ++ ++Y  + D   ++  +LV   V+    Y  ++ DFGP+N+G +YRF    ++     +N ++ ++  +S ++R++ N+A ++ C++I     TP +  + L+Q +  ++ FRDA    + F +++ + + G  RA    ++ L  FNL  YE Y++++ GD N + P   +AF  P  +    +GYL     H  + + S+   F    V  VVRLN   Y+K  F  +GI H DLIF DG  P   +V+ F    +      G +AVHCKAGLGRTG LIG +L+  Y FTA+E I + R  RPG V+G QQ+WL  HQ
Sbjct:    7 LDNTIEFLRGRVYLGAYDYTPEDTDELVFFTVEDAIFYNSFHLDFGPMNIGHLYRFAVIFHEILNDPENANKAVVFYSSASTRQRANAACMLCCYMILVQAWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTP-DFIAFASP--QEDHPKGYLATKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSIVKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMVVGPQQHWLYLHQ 333          
BLAST of Cell division cycle 14Ab vs. Ensembl Nematostella
Match: EDO38271 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ9])

HSP 1 Score: 312.383 bits (799), Expect = 5.580e-103
Identity = 147/318 (46.23%), Postives = 207/318 (65.09%), Query Frame = 1
Query:  112 KIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQN-NYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIG 1062
            ++YF +          +   ++D + IY+ +Y DFGPLNL  +YR+   +NKK K +    ++I+H TST+SR++ N+A L+G + + YLK +  E ++ L+   N  Y+ FRDA+ G  S+ LS+++ L G  +AL      L  F++ EYE+Y+ ++NGD NWI+P K LAF+GP  + ++  GY  H PE YI  F K  +S VVRLN   YD   FT  GI+H+DL F DG VPS+ +VR+F  I +NA G +A+HCKAGLGRTGTLI CYLMK Y+FTA+ESI W R+CRPGS+IG QQN+  + QA  W  G
Sbjct:    2 RLYFATFRHKPHSTSHIHYFSIDDELIYENFYADFGPLNLAMLYRYSCKLNKKLKSFSLGKKKIVHFTSTDSRKRANAACLIGSYAVIYLKKSADEIYQTLNTGCNPPYLPFRDASFGACSYNLSILDVLSGLQKALQNDFFNLDTFDVHEYEYYERVENGDFNWIVPGKFLAFSGPHNKSRIKDGYPLHAPEAYIPYFKKHNISTVVRLNKKLYDAQRFTDHGIEHYDLFFIDGSVPSDMIVRRFLTIAENAKGGIAIHCKAGLGRTGTLIACYLMKHYRFTAAESIGWLRVCRPGSIIGPQQNFCEEKQASLWIQG 319          
BLAST of Cell division cycle 14Ab vs. Ensembl Nematostella
Match: EDO38043 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE41])

HSP 1 Score: 203.371 bits (516), Expect = 2.189e-60
Identity = 111/337 (32.94%), Postives = 184/337 (54.60%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGY----YGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTN----SRRKVNSAFLMGCFLIAYLKMTPQETFKLLS-QNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPE--------YDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQ 1041
            ++++CE+++ +++F++     +  P      VD D+   G        FGP NL  +YRFC  +N K  +   + + +++ T+ +    ++++  + FL G F +  L M+ +E ++ +  Q     + F     G  S  L++++CL+GF++A+         F+L  YE  ++ +  D NWI+P K+LA + P  R ++         +     F +  V  VVRLN  +        YD   FT  G  H D  F DGG+P++ +V++F  I+D+  GAVA+HC+AGLGRTGTLI CYL+KQYKF+A+E++ W R+CRPGSV   Q  +L   Q
Sbjct:    6 VMSSCELVEDRLFFVTVACKPRNSPSFHYFGVDHDWTLDGCKLFDTPYFGPSNLAGIYRFCCLVNTKLHMVPASKKIVMYTTAEDDLESTKKRTRAIFLCGAFAVCQLNMSAEEAYQAMERQFRPNSVMFYCDINGNKSHDLNILDCLKGFEKAISRGFFSFEDFDLNRYE--EDEKAFDSNWIVPGKILAMSDPQRRNEVKASRFAKLRKH----FRQNGVKTVVRLNRDDNMIKYGLVYDARCFTANGFAHSDQYFEDGGIPTKAIVKRFTRILDHCEGAVAIHCRAGLGRTGTLIACYLIKQYKFSAAEAVGWLRICRPGSVSSLQHCFLEHKQ 336          
BLAST of Cell division cycle 14Ab vs. Ensembl Nematostella
Match: EDO37167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGK4])

HSP 1 Score: 58.151 bits (139), Expect = 3.926e-10
Identity = 36/122 (29.51%), Postives = 58/122 (47.54%), Query Frame = 1
Query:  679 TPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIV-----DNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWL 1029
            T   YI    K+    VVR+  P Y+  + +K GI   D  F DG  P ++LV  +  ++     +     VAVHC AGLGR   L+   L++       +++ + R  R G++   Q ++L
Sbjct:   13 TLPQYIQDLKKYDAHTVVRVCEPTYNTETLSKEGIIVLDWPFDDGAAPPKQLVEDWLKLLKGKFKERPGSCVAVHCVAGLGRAPVLVALALIES-GMKYEDAVEFIRRKRRGAINAKQLSYL 133          
BLAST of Cell division cycle 14Ab vs. Ensembl Nematostella
Match: EDO33331 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSG5])

HSP 1 Score: 53.1434 bits (126), Expect = 8.618e-9
Identity = 30/76 (39.47%), Postives = 41/76 (53.95%), Query Frame = 1
Query:  751 YDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNA--TGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESI 972
            YD  +F +V I  ++  + D GV S + +     ++  A   G  AVHC AGLGRTG LI CY +   + TA E I
Sbjct:   28 YDPEAFMQVEIFFYNFGWNDYGVRSLESILDMVKVMSFALQEGKTAVHCHAGLGRTGVLICCYFIYSDRLTAEEVI 103          
BLAST of Cell division cycle 14Ab vs. Ensembl Nematostella
Match: EDO40641 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M3])

HSP 1 Score: 47.7506 bits (112), Expect = 1.725e-6
Identity = 32/92 (34.78%), Postives = 45/92 (48.91%), Query Frame = 1
Query:  778 GIDHFDLIFPD-GGVPS-EKLVR--KFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQ 1041
            G+    L   D G  PS  +L+   KF   + +   +V VHCKAG GR+ TL+ CYLMK       E+  + +  RP   +  QQ W+   Q
Sbjct:   75 GVTQLRLATVDFGNAPSFAQLLEGVKFIEDMRSKGDSVYVHCKAGRGRSTTLVACYLMKNKNLNPEEAHLFIKSKRPQIRLASQQ-WIALQQ 165          
BLAST of Cell division cycle 14Ab vs. Ensembl Medaka
Match: cdc14ab (cell division cycle 14A [Source:NCBI gene;Acc:101173621])

HSP 1 Score: 343.584 bits (880), Expect = 6.734e-111
Identity = 155/328 (47.26%), Postives = 217/328 (66.16%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLL-SQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIG 1062
            L  A E IK ++YF +  +  +   +      D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TPQE ++ L S +N  Y+ FRDA+ G  ++ L+++ CL+G  +AL         FN+ EYEHY+ ++NGD+NWI+P+K LAF+GP  + ++  GY  H PE Y   F K  V+ ++RLN   YD   FT  G DH+DL F DG  P++ +VR+F HI ++  GAVAVHCKAGLGRTGTLIGCYLMK Y+FTA E+IAW R+CRPGSVIG QQN+L + Q   W  G
Sbjct:   25 LEGASEFIKDRLYFATLRSKPKSTANTHYFCTDDEFLYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRSNAAVLIGGYAVIYLKKTPQEAYRALTSGSNASYLPFRDASFGNCTYDLTVLQCLQGIKKALQHGFFDFETFNVTEYEHYERVENGDLNWIVPEKFLAFSGPHPKTKIENGYPLHAPEAYFPYFRKHNVTTIIRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPNDIIVRRFLHICESTQGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAGEAIAWIRICRPGSVIGPQQNFLEEKQGALWSQG 352          
BLAST of Cell division cycle 14Ab vs. Ensembl Medaka
Match: cdc14ab (cell division cycle 14A [Source:NCBI gene;Acc:101173621])

HSP 1 Score: 343.199 bits (879), Expect = 2.424e-110
Identity = 155/328 (47.26%), Postives = 217/328 (66.16%), Query Frame = 1
Query:   82 LINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLL-SQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIG 1062
            L  A E IK ++YF +  +  +   +      D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TPQE ++ L S +N  Y+ FRDA+ G  ++ L+++ CL+G  +AL         FN+ EYEHY+ ++NGD+NWI+P+K LAF+GP  + ++  GY  H PE Y   F K  V+ ++RLN   YD   FT  G DH+DL F DG  P++ +VR+F HI ++  GAVAVHCKAGLGRTGTLIGCYLMK Y+FTA E+IAW R+CRPGSVIG QQN+L + Q   W  G
Sbjct:   61 LEGASEFIKDRLYFATLRSKPKSTANTHYFCTDDEFLYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRSNAAVLIGGYAVIYLKKTPQEAYRALTSGSNASYLPFRDASFGNCTYDLTVLQCLQGIKKALQHGFFDFETFNVTEYEHYERVENGDLNWIVPEKFLAFSGPHPKTKIENGYPLHAPEAYFPYFRKHNVTTIIRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPNDIIVRRFLHICESTQGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAGEAIAWIRICRPGSVIGPQQNFLEEKQGALWSQG 388          
BLAST of Cell division cycle 14Ab vs. Ensembl Medaka
Match: cdc14ab (cell division cycle 14A [Source:NCBI gene;Acc:101173621])

HSP 1 Score: 337.035 bits (863), Expect = 2.417e-108
Identity = 151/322 (46.89%), Postives = 214/322 (66.46%), Query Frame = 1
Query:  100 IIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLL-SQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIG 1062
            +I  ++YF +  +  +   +      D +++Y+ +Y DFGPLNL  +YR+C  +NKK K +  T +RI+H TS + R++ N+A L+G + + YLK TPQE ++ L S +N  Y+ FRDA+ G  ++ L+++ CL+G  +AL         FN+ EYEHY+ ++NGD+NWI+P+K LAF+GP  + ++  GY  H PE Y   F K  V+ ++RLN   YD   FT  G DH+DL F DG  P++ +VR+F HI ++  GAVAVHCKAGLGRTGTLIGCYLMK Y+FTA E+IAW R+CRPGSVIG QQN+L + Q   W  G
Sbjct:   30 LIADRLYFATLRSKPKSTANTHYFCTDDEFLYENFYADFGPLNLAMLYRYCCKLNKKLKSFTLTRKRIVHYTSFDQRKRSNAAVLIGGYAVIYLKKTPQEAYRALTSGSNASYLPFRDASFGNCTYDLTVLQCLQGIKKALQHGFFDFETFNVTEYEHYERVENGDLNWIVPEKFLAFSGPHPKTKIENGYPLHAPEAYFPYFRKHNVTTIIRLNKKIYDAKRFTDAGFDHYDLFFVDGSTPNDIIVRRFLHICESTQGAVAVHCKAGLGRTGTLIGCYLMKHYRFTAGEAIAWIRICRPGSVIGPQQNFLEEKQGALWSQG 351          
BLAST of Cell division cycle 14Ab vs. Ensembl Medaka
Match: ENSORLT00000004920.3 (dual specificity protein phosphatase CDC14A [Source:NCBI gene;Acc:101163582])

HSP 1 Score: 323.553 bits (828), Expect = 3.361e-104
Identity = 163/410 (39.76%), Postives = 240/410 (58.54%), Query Frame = 1
Query:   70 STTMLINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIV---RQSSSHKVTETKSSL----ISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEM 1278
            S  +L    E  K ++YF      ++   D     +D +  Y+ +Y DFGPLNL   YRFC  + KK K    ++++II  T  + +++ N+A+L+G + + YLKMTP+E   LL   N  YI FRDA+ G   + L++++CLRG  +AL    +    F++ EYEHY+  +NGD+NWIIP K LAF+GP  + ++  GY  H PE YI  F K+ ++ ++RLN   YD   FT  G +H D+ F DG  P++ +VRKF +I ++A GA+AVHCKAGLGRTGTLIGCY+MK Y  TA+E+IAW R+CRPGS+IG QQN++ + Q   W  G      +   R++    VT   S +    I+  N +    K +E E  + ++      +GD L +LKS  Q    +  +
Sbjct:    3 SDDVLSRCIEFKKDQLYFAMLQQKMKSTSDRHCFCIDEELAYENFYADFGPLNLAMFYRFCCKLTKKLKSITLSNKKIIFYTCGDQKKQANAAYLIGSYAVMYLKMTPEEAHSLLVSRNLTYIPFRDASFGTCMYNLNILDCLRGVHKALQYGWLDFSSFDVEEYEHYERAENGDLNWIIPGKFLAFSGPHPKSKIENGYPLHAPEAYIPYFRKYNITTIIRLNKKMYDARRFTDSGFEHHDMFFVDGSTPNDSIVRKFLNICESAEGAIAVHCKAGLGRTGTLIGCYMMKHYCLTAAEAIAWIRICRPGSIIGPQQNFVEEKQNSLWAEGDVFREKMLKDRENEKKAVTRILSGVDEITINGSNNNRTARK-EEVESYNDEEERNGFTQGDKLRALKSKRQAKASSGSL 411          
BLAST of Cell division cycle 14Ab vs. Ensembl Medaka
Match: ENSORLT00000031467.1 (dual specificity protein phosphatase CDC14A [Source:NCBI gene;Acc:101163582])

HSP 1 Score: 320.857 bits (821), Expect = 3.195e-103
Identity = 160/399 (40.10%), Postives = 236/399 (59.15%), Query Frame = 1
Query:  103 IKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIV---RQSSSHKVTETKSSL----ISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEM 1278
            I  ++YF      ++   D     +D +  Y+ +Y DFGPLNL   YRFC  + KK K    ++++II  T  + +++ N+A+L+G + + YLKMTP+E   LL   N  YI FRDA+ G   + L++++CLRG  +AL    +    F++ EYEHY+  +NGD+NWIIP K LAF+GP  + ++  GY  H PE YI  F K+ ++ ++RLN   YD   FT  G +H D+ F DG  P++ +VRKF +I ++A GA+AVHCKAGLGRTGTLIGCY+MK Y  TA+E+IAW R+CRPGS+IG QQN++ + Q   W  G      +   R++    VT   S +    I+  N +    K +E E  + ++      +GD L +LKS  Q    +  +
Sbjct:   35 ITDQLYFAMLQQKMKSTSDRHCFCIDEELAYENFYADFGPLNLAMFYRFCCKLTKKLKSITLSNKKIIFYTCGDQKKQANAAYLIGSYAVMYLKMTPEEAHSLLVSRNLTYIPFRDASFGTCMYNLNILDCLRGVHKALQYGWLDFSSFDVEEYEHYERAENGDLNWIIPGKFLAFSGPHPKSKIENGYPLHAPEAYIPYFRKYNITTIIRLNKKMYDARRFTDSGFEHHDMFFVDGSTPNDSIVRKFLNICESAEGAIAVHCKAGLGRTGTLIGCYMMKHYCLTAAEAIAWIRICRPGSIIGPQQNFVEEKQNSLWAEGDVFREKMLKDRENEKKAVTRILSGVDEITINGSNNNRTARK-EEVESYNDEEERNGFTQGDKLRALKSKRQAKASSGSL 432          
BLAST of Cell division cycle 14Ab vs. Planmine SMEST
Match: SMESG000056023.1 (SMESG000056023.1)

HSP 1 Score: 1035.4 bits (2676), Expect = 0.000e+0
Identity = 495/495 (100.00%), Postives = 495/495 (100.00%), Query Frame = 1
Query:   79 MLINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEMKGSSFISNMIWDDENFPKFGRNKWFLNQNRPINDFEDKRFQLKEKFETSNEYSADVNKDNSYRFQLEDFNNSTIIPDFDIRQHTSRFLTTKFREH 1563
            MLINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEMKGSSFISNMIWDDENFPKFGRNKWFLNQNRPINDFEDKRFQLKEKFETSNEYSADVNKDNSYRFQLEDFNNSTIIPDFDIRQHTSRFLTTKFREH
Sbjct:    1 MLINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSLISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEMKGSSFISNMIWDDENFPKFGRNKWFLNQNRPINDFEDKRFQLKEKFETSNEYSADVNKDNSYRFQLEDFNNSTIIPDFDIRQHTSRFLTTKFREH 495          
BLAST of Cell division cycle 14Ab vs. Planmine SMEST
Match: SMESG000057887.1 (SMESG000057887.1)

HSP 1 Score: 351.673 bits (901), Expect = 1.478e-113
Identity = 157/325 (48.31%), Postives = 219/325 (67.38%), Query Frame = 1
Query:   91 ACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIG 1062
            A EIIK ++YF S  T  +   +    +VD + +Y+ +Y DFGPLNL  +YR+C  +NKK K +  + +RI+HVT+ + +++ N+AFL+G + I YLK TP E+++ L+S NN  Y+ FRDA+ G S++ L+L +CL   ++AL         F++ EYEHY+ ++NGD NWI+P K LAF GP  + ++  G+  H PE Y   F K  V  ++RLN   YD   FT+ G  H +L F DG VP++ +VR+F  I + ++GA+AVHCKAGLGRTGTLIGCYLMK YKFTA+E I W R+CRPGSVIG QQNWL + Q+WCW  G
Sbjct:   12 ASEIIKDRLYFASVRTKPKSTQNTHFFSVDDELVYENFYADFGPLNLAQLYRYCFKLNKKLKSFSLSKKRIVHVTNIDVKKRSNAAFLIGAYQILYLKRTPDESYQPLISGNNPPYLPFRDASFGPSTYNLTLFDCLLSINKALINGFFNFENFDVEEYEHYEKVENGDFNWIVPGKFLAFCGPFHQSKIENGFPLHAPEAYFPYFRKNNVQTIIRLNKKIYDSRRFTEAGFKHHELFFVDGSVPTDSIVRQFLEICETSSGAIAVHCKAGLGRTGTLIGCYLMKHYKFTAAEVIGWIRICRPGSVIGPQQNWLEEKQSWCWLQG 336          
BLAST of Cell division cycle 14Ab vs. Planmine SMEST
Match: SMESG000057887.1 (SMESG000057887.1)

HSP 1 Score: 351.673 bits (901), Expect = 1.976e-113
Identity = 157/325 (48.31%), Postives = 219/325 (67.38%), Query Frame = 1
Query:   91 ACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIG 1062
            A EIIK ++YF S  T  +   +    +VD + +Y+ +Y DFGPLNL  +YR+C  +NKK K +  + +RI+HVT+ + +++ N+AFL+G + I YLK TP E+++ L+S NN  Y+ FRDA+ G S++ L+L +CL   ++AL         F++ EYEHY+ ++NGD NWI+P K LAF GP  + ++  G+  H PE Y   F K  V  ++RLN   YD   FT+ G  H +L F DG VP++ +VR+F  I + ++GA+AVHCKAGLGRTGTLIGCYLMK YKFTA+E I W R+CRPGSVIG QQNWL + Q+WCW  G
Sbjct:   21 ASEIIKDRLYFASVRTKPKSTQNTHFFSVDDELVYENFYADFGPLNLAQLYRYCFKLNKKLKSFSLSKKRIVHVTNIDVKKRSNAAFLIGAYQILYLKRTPDESYQPLISGNNPPYLPFRDASFGPSTYNLTLFDCLLSINKALINGFFNFENFDVEEYEHYEKVENGDFNWIVPGKFLAFCGPFHQSKIENGFPLHAPEAYFPYFRKNNVQTIIRLNKKIYDSRRFTEAGFKHHELFFVDGSVPTDSIVRQFLEICETSSGAIAVHCKAGLGRTGTLIGCYLMKHYKFTAAEVIGWIRICRPGSVIGPQQNWLEEKQSWCWLQG 345          
BLAST of Cell division cycle 14Ab vs. Planmine SMEST
Match: SMESG000057887.1 (SMESG000057887.1)

HSP 1 Score: 351.673 bits (901), Expect = 2.152e-113
Identity = 157/325 (48.31%), Postives = 219/325 (67.38%), Query Frame = 1
Query:   91 ACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIG 1062
            A EIIK ++YF S  T  +   +    +VD + +Y+ +Y DFGPLNL  +YR+C  +NKK K +  + +RI+HVT+ + +++ N+AFL+G + I YLK TP E+++ L+S NN  Y+ FRDA+ G S++ L+L +CL   ++AL         F++ EYEHY+ ++NGD NWI+P K LAF GP  + ++  G+  H PE Y   F K  V  ++RLN   YD   FT+ G  H +L F DG VP++ +VR+F  I + ++GA+AVHCKAGLGRTGTLIGCYLMK YKFTA+E I W R+CRPGSVIG QQNWL + Q+WCW  G
Sbjct:   12 ASEIIKDRLYFASVRTKPKSTQNTHFFSVDDELVYENFYADFGPLNLAQLYRYCFKLNKKLKSFSLSKKRIVHVTNIDVKKRSNAAFLIGAYQILYLKRTPDESYQPLISGNNPPYLPFRDASFGPSTYNLTLFDCLLSINKALINGFFNFENFDVEEYEHYEKVENGDFNWIVPGKFLAFCGPFHQSKIENGFPLHAPEAYFPYFRKNNVQTIIRLNKKIYDSRRFTEAGFKHHELFFVDGSVPTDSIVRQFLEICETSSGAIAVHCKAGLGRTGTLIGCYLMKHYKFTAAEVIGWIRICRPGSVIGPQQNWLEEKQSWCWLQG 336          
BLAST of Cell division cycle 14Ab vs. Planmine SMEST
Match: SMESG000057887.1 (SMESG000057887.1)

HSP 1 Score: 352.058 bits (902), Expect = 2.246e-113
Identity = 157/325 (48.31%), Postives = 219/325 (67.38%), Query Frame = 1
Query:   91 ACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLNLGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAYLKMTPQETFK-LLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTKIMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYHTPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSEKLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAWTRMCRPGSVIGYQQNWLIDHQAWCWKIG 1062
            A EIIK ++YF S  T  +   +    +VD + +Y+ +Y DFGPLNL  +YR+C  +NKK K +  + +RI+HVT+ + +++ N+AFL+G + I YLK TP E+++ L+S NN  Y+ FRDA+ G S++ L+L +CL   ++AL         F++ EYEHY+ ++NGD NWI+P K LAF GP  + ++  G+  H PE Y   F K  V  ++RLN   YD   FT+ G  H +L F DG VP++ +VR+F  I + ++GA+AVHCKAGLGRTGTLIGCYLMK YKFTA+E I W R+CRPGSVIG QQNWL + Q+WCW  G
Sbjct:   21 ASEIIKDRLYFASVRTKPKSTQNTHFFSVDDELVYENFYADFGPLNLAQLYRYCFKLNKKLKSFSLSKKRIVHVTNIDVKKRSNAAFLIGAYQILYLKRTPDESYQPLISGNNPPYLPFRDASFGPSTYNLTLFDCLLSINKALINGFFNFENFDVEEYEHYEKVENGDFNWIVPGKFLAFCGPFHQSKIENGFPLHAPEAYFPYFRKNNVQTIIRLNKKIYDSRRFTEAGFKHHELFFVDGSVPTDSIVRQFLEICETSSGAIAVHCKAGLGRTGTLIGCYLMKHYKFTAAEVIGWIRICRPGSVIGPQQNWLEEKQSWCWLQG 345          
The following BLAST results are available for this feature:
BLAST of Cell division cycle 14Ab vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDC14A2.725e-11046.04cell division cycle 14A [Source:HGNC Symbol;Acc:HG... [more]
CDC14B8.596e-11041.58cell division cycle 14B [Source:HGNC Symbol;Acc:HG... [more]
CDC14A2.699e-10942.33cell division cycle 14A [Source:HGNC Symbol;Acc:HG... [more]
CDC14A4.933e-10942.33cell division cycle 14A [Source:HGNC Symbol;Acc:HG... [more]
CDC14A7.484e-10942.33cell division cycle 14A [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Cell division cycle 14Ab vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc-145.979e-8941.16Tyrosine-protein phosphatase cdc-14 [Source:UniPr... [more]
cdc-145.979e-8941.16Tyrosine-protein phosphatase cdc-14 [Source:UniPr... [more]
cdc-146.539e-8941.16Tyrosine-protein phosphatase cdc-14 [Source:UniPr... [more]
cdc-146.539e-8941.16Tyrosine-protein phosphatase cdc-14 [Source:UniPr... [more]
cdc-146.628e-8941.16Tyrosine-protein phosphatase cdc-14 [Source:UniPr... [more]
back to top
BLAST of Cell division cycle 14Ab vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc141.270e-9640.16gene:FBgn0031952 transcript:FBtr0343424[more]
cdc141.408e-9640.16gene:FBgn0031952 transcript:FBtr0301330[more]
cdc141.624e-9640.16gene:FBgn0031952 transcript:FBtr0301331[more]
cdc141.195e-9340.16gene:FBgn0031952 transcript:FBtr0343423[more]
cdc141.195e-9340.16gene:FBgn0031952 transcript:FBtr0079492[more]
back to top
BLAST of Cell division cycle 14Ab vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc14ab2.063e-11842.89cell division cycle 14Ab [Source:NCBI gene;Acc:565... [more]
cdc14ab1.587e-11742.89cell division cycle 14Ab [Source:NCBI gene;Acc:565... [more]
cdc14aa2.453e-11144.12cell division cycle 14Aa [Source:ZFIN;Acc:ZDB-GENE... [more]
cdc14b6.111e-10038.92cell division cycle 14B [Source:ZFIN;Acc:ZDB-GENE-... [more]
cdc14b2.189e-9739.19cell division cycle 14B [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Cell division cycle 14Ab vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDC14A8.019e-10840.20cell division cycle 14A [Source:NCBI gene;Acc:1004... [more]
cdc14b1.873e-10536.28cell division cycle 14B [Source:NCBI gene;Acc:7337... [more]
cdc14b1.459e-10436.49cell division cycle 14B [Source:NCBI gene;Acc:7337... [more]
cdc14b3.129e-10435.68cell division cycle 14B [Source:NCBI gene;Acc:7337... [more]
cdc14b5.482e-10436.84cell division cycle 14B [Source:NCBI gene;Acc:7337... [more]
back to top
BLAST of Cell division cycle 14Ab vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdc14b1.191e-11241.93CDC14 cell division cycle 14B [Source:MGI Symbol;A... [more]
Cdc14b6.061e-11243.85CDC14 cell division cycle 14B [Source:MGI Symbol;A... [more]
Cdc14b6.061e-11243.85CDC14 cell division cycle 14B [Source:MGI Symbol;A... [more]
Cdc14b6.061e-11243.85CDC14 cell division cycle 14B [Source:MGI Symbol;A... [more]
Cdc14b7.180e-11245.14CDC14 cell division cycle 14B [Source:MGI Symbol;A... [more]
back to top
BLAST of Cell division cycle 14Ab vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0A0R4IVA4|CC14A_DANRE1.734e-11642.89Dual specificity protein phosphatase CDC14AB OS=Da... [more]
sp|Q6PFY9|CC14B_MOUSE4.240e-11143.85Dual specificity protein phosphatase CDC14B OS=Mus... [more]
sp|Q6GQT0|CC14A_MOUSE6.535e-11041.81Dual specificity protein phosphatase CDC14A OS=Mus... [more]
sp|Q9UNH5|CC14A_HUMAN1.296e-10842.33Dual specificity protein phosphatase CDC14A OS=Hom... [more]
sp|O60729|CC14B_HUMAN3.527e-10743.32Dual specificity protein phosphatase CDC14B OS=Hom... [more]
back to top
BLAST of Cell division cycle 14Ab vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A5PMX24.616e-11542.89Dual-specificity protein phosphatase CDC14AB OS=Da... [more]
A0A2U3TW853.551e-11442.89Dual-specificity protein phosphatase CDC14AB OS=Da... [more]
A0A2T7NNN81.607e-11342.04Uncharacterized protein OS=Pomacea canaliculata OX... [more]
M3ZTI75.425e-11343.91Cell division cycle 14Ab OS=Xiphophorus maculatus ... [more]
A0A3B5QFL91.338e-11243.91Cell division cycle 14Ab OS=Xiphophorus maculatus ... [more]
back to top
BLAST of Cell division cycle 14Ab vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc14ab1.192e-10841.35cell division cycle 14A [Source:NCBI gene;Acc:1030... [more]
cdc14ab1.252e-10841.65cell division cycle 14A [Source:NCBI gene;Acc:1030... [more]
cdc14ab5.595e-10641.22cell division cycle 14A [Source:NCBI gene;Acc:1030... [more]
cdc14ab2.331e-10540.00cell division cycle 14A [Source:NCBI gene;Acc:1030... [more]
cdc14ab3.654e-10540.00cell division cycle 14A [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Cell division cycle 14Ab vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cdc14ab2.027e-5853.37cell division cycle 14Ab [Source:NCBI gene;Acc:565... [more]
ENSPMAT00000009327.11.741e-2034.51pep scaffold:Pmarinus_7.0:GL486696:158815:164749:-... [more]
ptp4a13.826e-1131.36protein tyrosine phosphatase 4A1 [Source:ZFIN;Acc:... [more]
dusp23b1.157e-937.14dual specificity phosphatase 23b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Cell division cycle 14Ab vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CDC149.731e-6034.24Protein phosphatase required for mitotic exit; req... [more]
back to top
BLAST of Cell division cycle 14Ab vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO382715.580e-10346.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380432.189e-6032.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371673.926e-1029.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333318.618e-939.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406411.725e-634.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cell division cycle 14Ab vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc14ab6.734e-11147.26cell division cycle 14A [Source:NCBI gene;Acc:1011... [more]
cdc14ab2.424e-11047.26cell division cycle 14A [Source:NCBI gene;Acc:1011... [more]
cdc14ab2.417e-10846.89cell division cycle 14A [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000004920.33.361e-10439.76dual specificity protein phosphatase CDC14A [Sourc... [more]
ENSORLT00000031467.13.195e-10340.10dual specificity protein phosphatase CDC14A [Sourc... [more]
back to top
BLAST of Cell division cycle 14Ab vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056023.10.000e+0100.00SMESG000056023.1[more]
SMESG000057887.11.478e-11348.31SMESG000057887.1[more]
SMESG000057887.11.976e-11348.31SMESG000057887.1[more]
SMESG000057887.12.152e-11348.31SMESG000057887.1[more]
SMESG000057887.12.246e-11348.31SMESG000057887.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013019 ID=SMED30013019|Name=Cell division cycle 14Ab|organism=Schmidtea mediterranea sexual|type=transcript|length=1598bp
GTTTTAAACGATTGTTAGATTGACATATTTTCATGATCGTTTTTTAATTA
ATCTCCGTATGTTGGTAATTCAACAACAATGTTAATAAATGCCTGTGAAA
TAATCAAAAAGAAAATATATTTTCTGTCAACTGATACCGTAGTGCAAGAG
CAACCGGATTTAGTGCTGGTAAATGTTGATTTTGACTACATTTACAAAGG
TTATTATGGAGACTTCGGCCCACTTAATCTCGGTTGCGTTTATAGATTTT
GCCAAAATATGAACAAGAAATTTAAGTTATACCAAAACACTTCTCGGAGA
ATTATTCACGTTACTTCAACCAATTCAAGGAGAAAGGTCAACTCAGCTTT
TTTAATGGGTTGCTTTTTAATCGCATATTTAAAAATGACTCCTCAAGAAA
CATTTAAACTATTATCGCAGAACAATTATCGATATATTTCATTTAGAGAT
GCTGCCATTGGAAGATCATCATTTTATTTATCATTAATAAATTGCTTACG
AGGATTTGATAGAGCTTTATGTACCAAAATAATGAAACTGAGGCTGTTTA
ATCTTGTTGAATATGAACATTATGATAATATACAAAATGGAGACATTAAT
TGGATAATTCCGAAAAAACTGTTGGCTTTCACAGGTCCTTGCCTCAGAAT
GCAACTTCTTCAAGGTTATTTGTATCATACCCCAGAAATGTATATTTCGA
TATTTCACAAATGGAGAGTTTCTGCTGTTGTAAGACTCAACCCTCCGGAA
TATGATAAGTCATCCTTTACAAAAGTTGGCATTGATCACTTTGATTTAAT
ATTCCCCGACGGTGGAGTACCTTCTGAAAAATTGGTACGAAAATTCTTTC
ATATAGTTGATAATGCTACTGGAGCAGTTGCTGTCCATTGTAAAGCTGGA
CTCGGCAGAACCGGAACTCTAATAGGATGCTATTTAATGAAACAATATAA
ATTTACCGCAAGTGAATCCATTGCTTGGACTCGAATGTGTAGACCTGGTT
CTGTGATCGGATATCAGCAAAATTGGTTAATAGACCACCAAGCCTGGTGC
TGGAAAATTGGTTCTCCTATTTCTCGTATTGTTCGTCAAAGTTCATCACA
CAAAGTTACAGAAACAAAGTCTTCATTAATTTCCAAACAAAATGTAGATC
TTTTAAATGACAAGGTTGACGAAACCGAGTTGTCGTCTTATGATAAGAAT
TTGACAGTTATTCCTCGAGGTGACGTATTGAACAGTTTAAAGTCGTTCAA
CCAAATCCATAAAAAGGCTGCTGAAATGAAAGGTTCTAGCTTCATTTCGA
ATATGATATGGGATGATGAAAATTTTCCAAAATTCGGAAGAAATAAATGG
TTTCTTAATCAAAATAGACCAATAAACGATTTTGAAGATAAGAGATTTCA
ATTGAAAGAAAAATTCGAAACTTCAAATGAATATTCGGCAGATGTGAATA
AAGATAATTCTTACAGATTTCAGTTGGAAGATTTCAATAACTCAACAATA
ATACCGGATTTTGATATCAGGCAGCACACTTCAAGATTTTTGACAACAAA
ATTTCGTGAACATTAAGCGCAATATTCTGATTTCATAACAAATAAAAC
back to top

protein sequence of SMED30013019-orf-1

>SMED30013019-orf-1 ID=SMED30013019-orf-1|Name=SMED30013019-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=496bp
MLINACEIIKKKIYFLSTDTVVQEQPDLVLVNVDFDYIYKGYYGDFGPLN
LGCVYRFCQNMNKKFKLYQNTSRRIIHVTSTNSRRKVNSAFLMGCFLIAY
LKMTPQETFKLLSQNNYRYISFRDAAIGRSSFYLSLINCLRGFDRALCTK
IMKLRLFNLVEYEHYDNIQNGDINWIIPKKLLAFTGPCLRMQLLQGYLYH
TPEMYISIFHKWRVSAVVRLNPPEYDKSSFTKVGIDHFDLIFPDGGVPSE
KLVRKFFHIVDNATGAVAVHCKAGLGRTGTLIGCYLMKQYKFTASESIAW
TRMCRPGSVIGYQQNWLIDHQAWCWKIGSPISRIVRQSSSHKVTETKSSL
ISKQNVDLLNDKVDETELSSYDKNLTVIPRGDVLNSLKSFNQIHKKAAEM
KGSSFISNMIWDDENFPKFGRNKWFLNQNRPINDFEDKRFQLKEKFETSN
EYSADVNKDNSYRFQLEDFNNSTIIPDFDIRQHTSRFLTTKFREH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000208testis
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR026070CDC14
IPR020422TYR_PHOSPHATASE_DUAL_dom
IPR003595Tyr_Pase_cat
IPR029021Prot-tyrosine_phosphatase-like
IPR000340Dual-sp_phosphatase_cat-dom
IPR029260DSPn
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: molecular function
TermDefinition
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0004725protein tyrosine phosphatase activity
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0004722protein serine/threonine phosphatase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0007049cell cycle
GO:0007096regulation of exit from mitosis
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0051256mitotic spindle midzone assembly
GO:0051301cell division
GO:0060271cilium morphogenesis
GO:0071850mitotic cell cycle arrest
Vocabulary: cellular component
TermDefinition
GO:0000922spindle pole
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005819spindle
GO:0005829cytosol
GO:0005856cytoskeleton
GO:0016604nuclear body
GO:0042995cell projection
GO:0060091kinocilium
GO:0072686mitotic spindle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020422Dual specificity protein phosphatase domainSMARTSM00195dsp_5coord: 187..323
e-value: 0.004
score: 4.4
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 233..323
e-value: 0.003
score: 17.7
IPR029260Dual specificity/tyrosine protein phosphatase, N-terminalPFAMPF14671DSPncoord: 7..146
e-value: 7.6E-42
score: 143.1
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 251..317
e-value: 3.1E-12
score: 46.4
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 3..147
e-value: 9.2E-45
score: 154.4
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 168..334
e-value: 9.7E-53
score: 180.5
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 3..149
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 162..327
NoneNo IPR availablePANTHERPTHR23339TYROSINE SPECIFIC PROTEIN PHOSPHATASE AND DUAL SPECIFICITY PROTEIN PHOSPHATASEcoord: 7..363
NoneNo IPR availableCDDcd17657CDC14_Ncoord: 4..147
e-value: 3.51639E-56
score: 181.929
NoneNo IPR availableCDDcd14499CDC14_Ccoord: 157..328
e-value: 5.7892E-111
score: 324.021
IPR026070Tyrosine-protein phosphatase CDC14PANTHERPTHR23339:SF27CELL DIVISION CYCLE 14, ISOFORM Acoord: 7..363
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 269..279
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 254..316
score: 15.594