Flotillin-1

Overview
NameFlotillin-1
Smed IDSMED30013015
Length (bp)1709
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Flotillin-1 (SMED30013015) t-SNE clustered cells

Violin plots show distribution of expression levels for Flotillin-1 (SMED30013015) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Flotillin-1 (SMED30013015) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Flotillin-1 (SMED30013015) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30013015

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30013015SMESG000064151.1 Contig5680GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30013015SMESG000004975.1 dd_Smed_v4_1637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30013015SMESG000004975.1 dd_Smed_v4_1637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30013015SMESG000004975.1 dd_Smed_v4_1637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30013015SMESG000004975.1 dd_Smed_v4_1637_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30013015SMESG000004975.1 OX_Smed_1.0.12578ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30013015SMESG000004975.1 dd_Smed_v4_1637_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 466.077 bits (1198), Expect = 1.977e-160
Identity = 247/417 (59.23%), Postives = 332/417 (79.62%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     +IA IA ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEAEA+RDAGI++AKA++ +V+++  +E ++A+AQRD++LKKA YD E+ T++AQ+ L+Y LQVA TKQQI+E+ +Q++VVER QQV +QE EI R++KELEARVRKPAEAE Y+L+++AEAEK ++I +AE E+ ++R+ GEA AFAI A A+AEAEQ+ KKAEA++ Y  AA+L+M L  LP++A E++ PL+S +KIT+VSSG+G +GA K+TGEV+ I+  LP  V+ +TG  I++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQ 418          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 466.077 bits (1198), Expect = 1.977e-160
Identity = 247/417 (59.23%), Postives = 332/417 (79.62%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     +IA IA ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEAEA+RDAGI++AKA++ +V+++  +E ++A+AQRD++LKKA YD E+ T++AQ+ L+Y LQVA TKQQI+E+ +Q++VVER QQV +QE EI R++KELEARVRKPAEAE Y+L+++AEAEK ++I +AE E+ ++R+ GEA AFAI A A+AEAEQ+ KKAEA++ Y  AA+L+M L  LP++A E++ PL+S +KIT+VSSG+G +GA K+TGEV+ I+  LP  V+ +TG  I++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQ 418          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 466.077 bits (1198), Expect = 1.977e-160
Identity = 247/417 (59.23%), Postives = 332/417 (79.62%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     +IA IA ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEAEA+RDAGI++AKA++ +V+++  +E ++A+AQRD++LKKA YD E+ T++AQ+ L+Y LQVA TKQQI+E+ +Q++VVER QQV +QE EI R++KELEARVRKPAEAE Y+L+++AEAEK ++I +AE E+ ++R+ GEA AFAI A A+AEAEQ+ KKAEA++ Y  AA+L+M L  LP++A E++ PL+S +KIT+VSSG+G +GA K+TGEV+ I+  LP  V+ +TG  I++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQ 418          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 466.077 bits (1198), Expect = 1.977e-160
Identity = 247/417 (59.23%), Postives = 332/417 (79.62%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     +IA IA ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEAEA+RDAGI++AKA++ +V+++  +E ++A+AQRD++LKKA YD E+ T++AQ+ L+Y LQVA TKQQI+E+ +Q++VVER QQV +QE EI R++KELEARVRKPAEAE Y+L+++AEAEK ++I +AE E+ ++R+ GEA AFAI A A+AEAEQ+ KKAEA++ Y  AA+L+M L  LP++A E++ PL+S +KIT+VSSG+G +GA K+TGEV+ I+  LP  V+ +TG  I++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQ 418          
BLAST of Flotillin-1 vs. Ensembl Human
Match: FLOT1 (flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757])

HSP 1 Score: 466.077 bits (1198), Expect = 1.977e-160
Identity = 247/417 (59.23%), Postives = 332/417 (79.62%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     +IA IA ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEAEA+RDAGI++AKA++ +V+++  +E ++A+AQRD++LKKA YD E+ T++AQ+ L+Y LQVA TKQQI+E+ +Q++VVER QQV +QE EI R++KELEARVRKPAEAE Y+L+++AEAEK ++I +AE E+ ++R+ GEA AFAI A A+AEAEQ+ KKAEA++ Y  AA+L+M L  LP++A E++ PL+S +KIT+VSSG+G +GA K+TGEV+ I+  LP  V+ +TG  I++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQ 418          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo1 (gene:FBgn0024754 transcript:FBtr0087351)

HSP 1 Score: 498.434 bits (1282), Expect = 1.623e-173
Identity = 260/419 (62.05%), Postives = 340/419 (81.15%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNM 1366
            F TCGPNE LVVSG  Y +PL++ GGR FV+P  Q++QR+SLN MT+ V SP +YT  G+P++ TG+AQVK+    E+ L TAC  +L     +I  IA  TLEGHQRAIMG+MTVEEIY DRKKFSK VFEVASSDL NMGI+VVSYT+KD+ D+EGYL+SLG+ARTA+VKRD RIGEAEA+ +A IK+A AEE ++A++  N+T IA+AQRDF+LKKA YD E++TKKA+++++Y LQ A TKQ+IKEE+MQ+KV+ER Q++ +QE EI R+++ELEA +R+PAEAE +R++K+AEA K R++ EAE E+E+IR+ GEA AFAI A AKAEAEQ+  KAEA+++Y  AA +EM L+TLPK+AAEVA+PLS   KITMVSSGTGD+GA K+TGEV+SI+  +P LVK +TG DIA+++
Sbjct:    5 FVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGYLRSLGMARTAEVKRDARIGEAEARAEAHIKEAIAEEQRMAARFLNDTDIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIKEEQMQVKVIERTQEIAVQEQEIMRRERELEATIRRPAEAEKFRMEKLAEANKQRVVMEAEAEAESIRIRGEAEAFAIAAKAKAEAEQMAMKAEAYREYREAAMVEMLLDTLPKVAAEVAAPLSQAKKITMVSSGTGDIGAAKLTGEVLSIVNKVPELVKNITGVDIARSV 423          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo1 (gene:FBgn0024754 transcript:FBtr0087352)

HSP 1 Score: 492.656 bits (1267), Expect = 3.838e-171
Identity = 260/423 (61.47%), Postives = 340/423 (80.38%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEG----YLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNM 1366
            F TCGPNE LVVSG  Y +PL++ GGR FV+P  Q++QR+SLN MT+ V SP +YT  G+P++ TG+AQVK+    E+ L TAC  +L     +I  IA  TLEGHQRAIMG+MTVEEIY DRKKFSK VFEVASSDL NMGI+VVSYT+KD+ D+EG    YL+SLG+ARTA+VKRD RIGEAEA+ +A IK+A AEE ++A++  N+T IA+AQRDF+LKKA YD E++TKKA+++++Y LQ A TKQ+IKEE+MQ+KV+ER Q++ +QE EI R+++ELEA +R+PAEAE +R++K+AEA K R++ EAE E+E+IR+ GEA AFAI A AKAEAEQ+  KAEA+++Y  AA +EM L+TLPK+AAEVA+PLS   KITMVSSGTGD+GA K+TGEV+SI+  +P LVK +TG DIA+++
Sbjct:    5 FVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGDSKGYLRSLGMARTAEVKRDARIGEAEARAEAHIKEAIAEEQRMAARFLNDTDIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIKEEQMQVKVIERTQEIAVQEQEIMRRERELEATIRRPAEAEKFRMEKLAEANKQRVVMEAEAEAESIRIRGEAEAFAIAAKAKAEAEQMAMKAEAYREYREAAMVEMLLDTLPKVAAEVAAPLSQAKKITMVSSGTGDIGAAKLTGEVLSIVNKVPELVKNITGVDIARSV 427          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0330217)

HSP 1 Score: 315.849 bits (808), Expect = 5.900e-102
Identity = 189/420 (45.00%), Postives = 278/420 (66.19%), Query Frame = 2
Query:  116 TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMT 1369
            T GPNE L+VSG   G  +   + GG  + +     +QRLSLN+MT+      + T  G+PLT TGVAQ KI+   +E L TA   +L    ++I     +TLEGH RAI+G +TVEE+Y DR +F+  V EVA+ D+  MGI ++S+T+KD++DD  YL SLG A+TA VKRD   G AEA RDAGI++A+ E++ +  K + +TKI    R ++L+KA +D+EI T KA+SQL+Y LQ A  +Q+I+ EE+QI+VVER +Q++++  E+QRKD+EL   V+ PAEAEA+RLQ +A+A++ + I+ A  E+E IR  G A A AIE + KAEAE++  KA  +K YG AA + + L +LPK+AAEVA+PL+   +I ++       G + IT +V  ++  LP  +  +TG D++K ++
Sbjct:    6 TTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIM-KADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG------GNDNITNDVTRLVAQLPPSINALTGVDLSKVLS 418          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0073952)

HSP 1 Score: 315.079 bits (806), Expect = 6.102e-102
Identity = 189/420 (45.00%), Postives = 278/420 (66.19%), Query Frame = 2
Query:  116 TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMT 1369
            T GPNE L+VSG   G  +   + GG  + +     +QRLSLN+MT+      + T  G+PLT TGVAQ KI+   +E L TA   +L    ++I     +TLEGH RAI+G +TVEE+Y DR +F+  V EVA+ D+  MGI ++S+T+KD++DD  YL SLG A+TA VKRD   G AEA RDAGI++A+ E++ +  K + +TKI    R ++L+KA +D+EI T KA+SQL+Y LQ A  +Q+I+ EE+QI+VVER +Q++++  E+QRKD+EL   V+ PAEAEA+RLQ +A+A++ + I+ A  E+E IR  G A A AIE + KAEAE++  KA  +K YG AA + + L +LPK+AAEVA+PL+   +I ++       G + IT +V  ++  LP  +  +TG D++K ++
Sbjct:    6 TTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIM-KADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG------GNDNITNDVTRLVAQLPPSINALTGVDLSKVLS 418          
BLAST of Flotillin-1 vs. Ensembl Fly
Match: Flo2 (gene:FBgn0264078 transcript:FBtr0073950)

HSP 1 Score: 315.079 bits (806), Expect = 6.102e-102
Identity = 189/420 (45.00%), Postives = 278/420 (66.19%), Query Frame = 2
Query:  116 TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMT 1369
            T GPNE L+VSG   G  +   + GG  + +     +QRLSLN+MT+      + T  G+PLT TGVAQ KI+   +E L TA   +L    ++I     +TLEGH RAI+G +TVEE+Y DR +F+  V EVA+ D+  MGI ++S+T+KD++DD  YL SLG A+TA VKRD   G AEA RDAGI++A+ E++ +  K + +TKI    R ++L+KA +D+EI T KA+SQL+Y LQ A  +Q+I+ EE+QI+VVER +Q++++  E+QRKD+EL   V+ PAEAEA+RLQ +A+A++ + I+ A  E+E IR  G A A AIE + KAEAE++  KA  +K YG AA + + L +LPK+AAEVA+PL+   +I ++       G + IT +V  ++  LP  +  +TG D++K ++
Sbjct:    6 TTGPNEALIVSGGCCGSTKKRTIVGGWAWAWWLVTDVQRLSLNVMTLNPMCENVETSQGVPLTVTGVAQCKIM-KADELLGTASEQFLGKSVKEIKQTILQTLEGHLRAILGTLTVEEVYKDRDQFAALVREVAAPDVGRMGIEILSFTIKDVYDDVQYLASLGKAQTAVVKRDADAGVAEANRDAGIREAECEKSAMDVKYSTDTKIEDNTRMYKLQKANFDQEINTAKAESQLAYELQAAKIRQRIRNEEIQIEVVERRKQIEIESQEVQRKDRELTGTVKLPAEAEAFRLQTLAQAKQCQTIEGARAEAERIRKIGSAEAHAIELVGKAEAERMRMKAHVYKQYGDAAIMNIVLESLPKIAAEVAAPLAKTDEIVLIG------GNDNITNDVTRLVAQLPPSINALTGVDLSKVLS 418          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot1b (flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2])

HSP 1 Score: 460.299 bits (1183), Expect = 1.787e-158
Identity = 245/422 (58.06%), Postives = 329/422 (77.96%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMTVR 1375
            F TCGPNE +VVSG G   PLM+ GGR FV P  Q+IQR++LN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC +++     +IA+IA ETLEGHQRAI+ ++TVEEIY DRKKFS+ VF+VASSDLVNMGI VVSYTLKD+HDD+ YL SLG ARTAQV+RD RIGEA+ +RDA I++A A + +V+++  NE ++A+AQRDF+LKKA YD E+ TKKA+S+++Y LQVA TKQ+I+EE+MQ++VVER QQ+ LQE EI R++KELEA++RKPAEAE YR++K+AEAE+L++I EAE E+E+IR+ GEA AFA+EA  +AEAEQ+ KKAEA+K Y   A ++M L  LP +A E++ PL +  K+TMVSSG  ++GA K+TGEV+ IM  LP  V+ +TG +I++    R
Sbjct:    2 FYTCGPNEAMVVSGCGRAPPLMIAGGRVFVIPCIQQIQRITLNTLTLNVKSDKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFMGKSEGEIANIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLSSLGKARTAQVQRDARIGEAQFKRDAVIREAHAMQEKVSAQYKNEIEMAKAQRDFELKKAAYDVEVNTKKAESEMAYQLQVAKTKQRIEEEKMQVQVVERTQQIMLQEQEITRREKELEAKIRKPAEAERYRIEKLAEAERLQLIMEAEAEAESIRMKGEAEAFALEAKGRAEAEQMAKKAEAFKGYKEGAMVDMLLEKLPLMAEEISKPLCAAQKVTMVSSGGSEVGAAKLTGEVLDIMTRLPGAVEKLTGVNISQAGLTR 423          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot1a (flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1])

HSP 1 Score: 457.988 bits (1177), Expect = 2.230e-157
Identity = 244/434 (56.22%), Postives = 337/434 (77.65%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMTVRAT*DFKQNFRFV 1411
            F TCGPNE +VVSG     P+M+ GGR FVFP  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQ+KI    ++ L  AC ++L     +IA IA ETLEGHQRAI+ ++TVEEIY DRKKFS+ VF+VASSDLVNMGISVVSYTLKD+HDD+ YL SLG ARTAQV++D RIGEA+ +RDA I++A A + +V+++  NE ++A+AQRD++LKKA YD E+ TKKA+S+++Y LQVA TKQ+I+EE+MQ+ VVER QQ+ LQE EI RK+KELEA+V+KPAEAE YRL+K+AEAE+L++I EAE E+E+IR+ GEA A+A+EA  +AEAEQ+ KKAEA++ Y   A ++M L  LP +A E++ PLS+ +K+TMVSSG  ++GA K+TGEV+ IM  LP  ++ +TG +I++ + ++ + +   +  FV
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVMISGGRVFVFPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFLGKSDSEIAHIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEAKNKRDAVIREAHAMQEKVSAQYMNEIEMAKAQRDYELKKAIYDIEVFTKKAESEMAYQLQVAKTKQRIEEEKMQVLVVERSQQITLQEQEISRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAYAVEAKGRAEAEQMAKKAEAFQHYKEGAMVDMLLEKLPMMADEISKPLSATNKVTMVSSGGSEIGAAKLTGEVLDIMTKLPETIEKLTGVNISQCIEIKTSREESCSLYFV 435          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot1a (flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1])

HSP 1 Score: 455.677 bits (1171), Expect = 1.350e-156
Identity = 242/417 (58.03%), Postives = 329/417 (78.90%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FVFP  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQ+KI    ++ L  AC ++L     +IA IA ETLEGHQRAI+ ++TVEEIY DRKKFS+ VF+VASSDLVNMGISVVSYTLKD+HDD+ YL SLG ARTAQV++D RIGEA+ +RDA I++A A + +V+++  NE ++A+AQRD++LKKA YD E+ TKKA+S+++Y LQVA TKQ+I+EE+MQ+ VVER QQ+ LQE EI RK+KELEA+V+KPAEAE YRL+K+AEAE+L++I EAE E+E+IR+ GEA A+A+EA  +AEAEQ+ KKAEA++ Y   A ++M L  LP +A E++ PLS+ +K+TMVSSG  ++GA K+TGEV+ IM  LP  ++ +TG +I++
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVMISGGRVFVFPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFLGKSDSEIAHIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEAKNKRDAVIREAHAMQEKVSAQYMNEIEMAKAQRDYELKKAIYDIEVFTKKAESEMAYQLQVAKTKQRIEEEKMQVLVVERSQQITLQEQEISRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAYAVEAKGRAEAEQMAKKAEAFQHYKEGAMVDMLLEKLPMMADEISKPLSATNKVTMVSSGGSEIGAAKLTGEVLDIMTKLPETIEKLTGVNISQ 418          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot2a (flotillin 2a [Source:NCBI gene;Acc:245698])

HSP 1 Score: 304.679 bits (779), Expect = 1.077e-97
Identity = 186/422 (44.08%), Postives = 289/422 (68.48%), Query Frame = 2
Query:  104 MPFC-TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            M  C T GPNE LVVSG   G D      GG  + +     IQ+++L +MT+      + T  G+ +T TGVAQVK++++  E L  AC  +L     +I  +  +TLEGH R+I+G +TVE+IY DR +F+K V EVA+ D+  MGI ++S+T+KD++D   YL SLG ++TA V+RD  IG AEA+RDAGI++A+ ++  +  K   +TK+A ++R+ +++KA +++E+ TKKA++QL+Y LQ A  +Q+I+ EE++I+VV+R +Q+ ++E EI R DKEL A VR+PAEAEA++++++AEA+K++ +  A+ E+E I+  GEA A +IEA+ KAEAE++  KAEA++ YG AAK  + L  LPK+A +VA+PL   ++I ++S   GD G  ++TGEV  ++  LP  V  +TG D++K
Sbjct:    1 MGNCYTVGPNEALVVSGGCCGSDGKTYTVGGWAWAWWLITDIQKITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVMTD-NELLGYACEQFLGKTVTEIKSVILQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKSQTAAVQRDADIGVAEAERDAGIREAECKKEMMDIKFQADTKMADSKRELEMQKAAFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEKEILRTDKELIATVRRPAEAEAFKMEQLAEAKKIKKVLTAQAEAEKIKRIGEAEAGSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLGRTNEIVILS---GDGG--RVTGEVNRLLAELPVSVNALTGVDLSK 416          
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Match: flot2b (flotillin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1368])

HSP 1 Score: 288.115 bits (736), Expect = 3.108e-91
Identity = 181/422 (42.89%), Postives = 289/422 (68.48%), Query Frame = 2
Query:  104 MPFC-TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            M  C T GPNE LVVSG   G D    + GG  + +      QR++L +MT+      + T  G+ +T TGVAQVK++++ ++ L  AC  +L     +I  +  +TLEGH R+I+G +TVE+IY DR +F++ V EVA+ D+  MGI ++S+T+KD++D   YL SLG  +TA V+RD  IG AEA+RDAGI++A+ ++  +  K   +TK+A ++R+ +L+KA +++E+ TKKA+SQL+Y LQ A  +Q+I+ EE++I+VV+R +Q+ ++E EI+R +KEL A V++PAEAEAY+++++AE  K++ +  A+ E+E IR  GEA A +I ++ KAEAE++  KAEA++ YG AAK  + L+ LPK+A +V++PL+  ++I ++S   GD   +++TGEV  ++  LP  V  +TG D++K
Sbjct:    1 MGCCLTVGPNEALVVSGACCGSDAKTYVVGGWAWAWWLISDTQRITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVMTD-KDLLAIACEQFLGKSVMEIKAVVLQTLEGHLRSILGTLTVEQIYQDRDQFARLVREVAAPDVGRMGIEILSFTIKDVYDKLDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELELQKAAFNQEVNTKKAESQLAYELQAAKEQQKIRLEEIEIEVVQRKKQISIEEREIERTEKELIATVKRPAEAEAYKMEQLAEGYKMQKVLTAQAEAEKIRKIGEAEAISISSVGKAEAERMRLKAEAYQQYGEAAKTALVLDALPKIAGKVSAPLARTNEIVILS---GD--GSRVTGEVNRLLAELPVSVNALTGVDLSK 416          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 424.861 bits (1091), Expect = 2.342e-144
Identity = 233/423 (55.08%), Postives = 326/423 (77.07%), Query Frame = 2
Query:   86 NFYIFNMPFCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDI 1354
            + Y  NMP      +   + SG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     ++A I+ ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEA A++DAGIK+A+A + +V+++  NE ++A+AQRDF+LKKA YD E+ T+KA+S L+Y LQVA TKQ+I+E+++Q++VVER QQ++LQ+ EI RK+KELEA+++KPAEAE YRL+K+AEAE++++I EAE E+E IR+ GEA A+A+E  A+A+AEQ+ KKAEA+++Y  AA ++M L  LP++A  ++ P++   KI M+SSG  ++GA+KITGEV+ I+  LP+ V+ +TG +I
Sbjct:    1 SVYKCNMPLLIHASS---LRSGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLTGINI 420          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 424.861 bits (1091), Expect = 2.762e-144
Identity = 233/423 (55.08%), Postives = 326/423 (77.07%), Query Frame = 2
Query:   86 NFYIFNMPFCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDI 1354
            + Y  NMP      +   + SG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     ++A I+ ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEA A++DAGIK+A+A + +V+++  NE ++A+AQRDF+LKKA YD E+ T+KA+S L+Y LQVA TKQ+I+E+++Q++VVER QQ++LQ+ EI RK+KELEA+++KPAEAE YRL+K+AEAE++++I EAE E+E IR+ GEA A+A+E  A+A+AEQ+ KKAEA+++Y  AA ++M L  LP++A  ++ P++   KI M+SSG  ++GA+KITGEV+ I+  LP+ V+ +TG +I
Sbjct:    1 SVYKCNMPLLIHASS---LRSGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLTGINI 420          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 424.091 bits (1089), Expect = 6.870e-144
Identity = 233/423 (55.08%), Postives = 326/423 (77.07%), Query Frame = 2
Query:   86 NFYIFNMPFCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDI 1354
            + Y  NMP      +   + SG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     ++A I+ ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEA A++DAGIK+A+A + +V+++  NE ++A+AQRDF+LKKA YD E+ T+KA+S L+Y LQVA TKQ+I+E+++Q++VVER QQ++LQ+ EI RK+KELEA+++KPAEAE YRL+K+AEAE++++I EAE E+E IR+ GEA A+A+E  A+A+AEQ+ KKAEA+++Y  AA ++M L  LP++A  ++ P++   KI M+SSG  ++GA+KITGEV+ I+  LP+ V+ +TG +I
Sbjct:    1 SVYKCNMPLLIHASS---LRSGFCRSPPVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLTGINI 420          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 421.394 bits (1082), Expect = 4.463e-143
Identity = 231/420 (55.00%), Postives = 324/420 (77.14%), Query Frame = 2
Query:   95 IFNMPFCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDI 1354
            +F++ FC   P             P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     ++A I+ ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEA A++DAGIK+A+A + +V+++  NE ++A+AQRDF+LKKA YD E+ T+KA+S L+Y LQVA TKQ+I+E+++Q++VVER QQ++LQ+ EI RK+KELEA+++KPAEAE YRL+K+AEAE++++I EAE E+E IR+ GEA A+A+E  A+A+AEQ+ KKAEA+++Y  AA ++M L  LP++A  ++ P++   KI M+SSG  ++GA+KITGEV+ I+  LP+ V+ +TG +I
Sbjct:    2 VFSLCFCR-SP-------------PVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLTGINI 407          
BLAST of Flotillin-1 vs. Ensembl Xenopus
Match: flot1 (flotillin 1 [Source:NCBI gene;Acc:733927])

HSP 1 Score: 420.239 bits (1079), Expect = 1.812e-142
Identity = 228/404 (56.44%), Postives = 320/404 (79.21%), Query Frame = 2
Query:  167 PLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMTVRA 1378
            P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     ++A I+ ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEA A++DAGIK+A+A + +V+++  NE ++A+AQRDF+LKKA YD E+ T+KA+S L+Y LQVA TKQ+I+E+++Q++VVER QQ++LQ+ EI RK+KELEA+++KPAEAE YRL+K+AEAE++++I EAE E+E IR+ GEA A+A+E  A+A+AEQ+ KKAEA+++Y  AA ++M L  LP++A  ++ P++   KI M+SSG  ++GA+KITGEV+ I+  LP+ V+ +TG +I +    R+
Sbjct:   11 PVMIAGGRVFVLPCVQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTENEVAQISLETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAVAKKDAGIKEAQAMQEKVSAQYVNEIEMAKAQRDFELKKAAYDLEVNTRKAESDLAYQLQVAKTKQKIEEQKVQVQVVERAQQIQLQDQEISRKEKELEAKIKKPAEAERYRLEKLAEAERMKLITEAEAEAEAIRVKGEALAYAVEVKARADAEQMAKKAEAFQEYQDAAIVDMLLEKLPEVAEAISKPMTEVKKIKMISSGGSEVGASKITGEVLDILNRLPDTVEKLTGININQVCHCRS 414          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 470.7 bits (1210), Expect = 1.752e-162
Identity = 249/417 (59.71%), Postives = 333/417 (79.86%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     +IA IA ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEAEA+RDAGI++AKA++ +V+++  +E ++A+AQRD++LKKA YD E+ T++AQ+ L+Y LQVA TKQQI+E+ +Q++VVER QQV +QE EI R++KELEARVRKPAEAE YRL+++AEAEK ++I +AE E+E++R+ GEA AFAI A A+AEAEQ+ KKAEA++ Y  AA+L+M L  LP++A E++ PL+S +KIT+VSSG+G +GA K+TGEV+ I+  LP  V+ +TG  I++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVSISQ 418          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot1 (flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500])

HSP 1 Score: 399.823 bits (1026), Expect = 2.624e-135
Identity = 221/417 (53.00%), Postives = 301/417 (72.18%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+A                                                +EIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEAEA+RDAGI++AKA++ +V+++  +E ++A+AQRD++LKKA YD E+ T++AQ+ L+Y LQVA TKQQI+E+ +Q++VVER QQV +QE EI R++KELEARVRKPAEAE YRL+++AEAEK ++I +AE E+E++R+ GEA AFAI A A+AEAEQ+ KKAEA++ Y  AA+L+M L  LP++A E++ PL+S +KIT+VSSG+G +GA K+TGEV+ I+  LP  V+ +TG  I++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIA------------------------------------------------QEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVSISQ 370          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 313.153 bits (801), Expect = 6.560e-101
Identity = 192/422 (45.50%), Postives = 287/422 (68.01%), Query Frame = 2
Query:  104 MPFC-TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            M  C T GPNE LVVSG   G D    + GG  + +      QRLSL +MTIL     I T  G+PL  TGVAQVKI++  +E L  AC  +L    + I ++  +TLEGH R+I+G +TVE+IY DR +F+K V EVA+ D+  MGI ++S+T+KD++D   YL SLG  +TA V+RD  IG AEA+RDAGI++A+ ++  +  K   +TKIA ++R F+L+K+ + +E+  K A++QL+Y LQ A  +Q+I++EE++I+VV+R +Q+ ++  EI R DKEL A VR+PAEAEA+R+Q++AE EK++ +  A+ E+E IR  GEA A  IEA+ KAEAE+++ KAEA++ YG AAK+ + L  LP++AA++++PL+   +I ++S   GD   +K+T EV  ++  LP  V  +TG D++K
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRLSLEVMTILCRCENIETSEGVPLFVTGVAQVKIMTE-KELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVLS---GD--NSKVTSEVNRLLAELPASVHALTGVDLSK 416          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 305.834 bits (782), Expect = 4.476e-98
Identity = 188/422 (44.55%), Postives = 286/422 (67.77%), Query Frame = 2
Query:  104 MPFC-TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            M  C T GPNE LVVSG   G D    + GG  + +      QR+SL +MT+      + T  G+ LT TGVAQVKI++  +E L  AC  +L    + I ++  +TLEGH R+I+G +TVE+IY DR +F+K V EVA+ D+  MGI ++S+T+KD++D   YL SLG  +TA V+RD  IG AEA+RDAGI++A+ ++  +  K   +TKIA ++R F+L+K+ + +E+  K A++QL+Y LQ A  +Q+I++EE++I+VV+R +Q+ ++  EI R DKEL A VR+PAEAEA+R+Q++AE EK++ +  A+ E+E IR  GEA A  IEA+ KAEAE+++ KAEA++ YG AAK+ + L  LP++AA++++PL+   +I ++S   GD   +K+T EV  ++  LP  V  +TG D++K
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVETAEGVALTVTGVAQVKIMTE-KELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVLS---GD--NSKVTSEVNRLLAELPASVHALTGVDLSK 416          
BLAST of Flotillin-1 vs. Ensembl Mouse
Match: Flot2 (flotillin 2 [Source:MGI Symbol;Acc:MGI:103309])

HSP 1 Score: 274.248 bits (700), Expect = 1.719e-86
Identity = 168/373 (45.04%), Postives = 261/373 (69.97%), Query Frame = 2
Query:  242 MTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            MT+      + T  G+ LT TGVAQVKI++  +E L  AC  +L    + I ++  +TLEGH R+I+G +TVE+IY DR +F+K V EVA+ D+  MGI ++S+T+KD++D   YL SLG  +TA V+RD  IG AEA+RDAGI++A+ ++  +  K   +TKIA ++R F+L+K+ + +E+  K A++QL+Y LQ A  +Q+I++EE++I+VV+R +Q+ ++  EI R DKEL A VR+PAEAEA+R+Q++AE EK++ +  A+ E+E IR  GEA A  IEA+ KAEAE+++ KAEA++ YG AAK+ + L  LP++AA++++PL+   +I ++S   GD   +K+T EV  ++  LP  V  +TG D++K
Sbjct:    1 MTLQPRCEDVETAEGVALTVTGVAQVKIMTE-KELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKISAPLTKVDEIVVLS---GD--NSKVTSEVNRLLAELPASVHALTGVDLSK 367          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|O61491|FLOT1_DROME (Flotillin-1 OS=Drosophila melanogaster OX=7227 GN=Flo1 PE=2 SV=1)

HSP 1 Score: 498.434 bits (1282), Expect = 1.627e-172
Identity = 260/419 (62.05%), Postives = 340/419 (81.15%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNM 1366
            F TCGPNE LVVSG  Y +PL++ GGR FV+P  Q++QR+SLN MT+ V SP +YT  G+P++ TG+AQVK+    E+ L TAC  +L     +I  IA  TLEGHQRAIMG+MTVEEIY DRKKFSK VFEVASSDL NMGI+VVSYT+KD+ D+EGYL+SLG+ARTA+VKRD RIGEAEA+ +A IK+A AEE ++A++  N+T IA+AQRDF+LKKA YD E++TKKA+++++Y LQ A TKQ+IKEE+MQ+KV+ER Q++ +QE EI R+++ELEA +R+PAEAE +R++K+AEA K R++ EAE E+E+IR+ GEA AFAI A AKAEAEQ+  KAEA+++Y  AA +EM L+TLPK+AAEVA+PLS   KITMVSSGTGD+GA K+TGEV+SI+  +P LVK +TG DIA+++
Sbjct:    5 FVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPVGQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQVKVQGQNEDMLLTACEQFLGKSEAEINHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGITVVSYTIKDLRDEEGYLRSLGMARTAEVKRDARIGEAEARAEAHIKEAIAEEQRMAARFLNDTDIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIKEEQMQVKVIERTQEIAVQEQEIMRRERELEATIRRPAEAEKFRMEKLAEANKQRVVMEAEAEAESIRIRGEAEAFAIAAKAKAEAEQMAMKAEAYREYREAAMVEMLLDTLPKVAAEVAAPLSQAKKITMVSSGTGDIGAAKLTGEVLSIVNKVPELVKNITGVDIARSV 423          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|Q9Z1E1|FLOT1_RAT (Flotillin-1 OS=Rattus norvegicus OX=10116 GN=Flot1 PE=2 SV=2)

HSP 1 Score: 471.085 bits (1211), Expect = 1.019e-161
Identity = 248/417 (59.47%), Postives = 333/417 (79.86%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     +IA IA ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEAEA+RDAGI++AKA++ +V+++  +E ++A+AQRD++LKKA YD E+ T++AQ+ L+Y LQVA TKQQI+E+ +Q++VVER QQV +QE EI R++KELEARVRKPAEAE YRL+++AEAEK ++I +AE E+E++R+ GEA AFA+ A A+AEAEQ+ KKAEA++ Y  AA+L+M L  LP++A E++ PL+S +KIT+VSSG+G +GA K+TGEV+ I+  LP  V+ +TG  I++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAVGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVSISQ 418          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|O08917|FLOT1_MOUSE (Flotillin-1 OS=Mus musculus OX=10090 GN=Flot1 PE=1 SV=1)

HSP 1 Score: 470.7 bits (1210), Expect = 1.226e-161
Identity = 249/417 (59.71%), Postives = 333/417 (79.86%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     +IA IA ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEAEA+RDAGI++AKA++ +V+++  +E ++A+AQRD++LKKA YD E+ T++AQ+ L+Y LQVA TKQQI+E+ +Q++VVER QQV +QE EI R++KELEARVRKPAEAE YRL+++AEAEK ++I +AE E+E++R+ GEA AFAI A A+AEAEQ+ KKAEA++ Y  AA+L+M L  LP++A E++ PL+S +KIT+VSSG+G +GA K+TGEV+ I+  LP  V+ +TG  I++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEAEKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVSISQ 418          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|Q7YR41|FLOT1_PANTR (Flotillin-1 OS=Pan troglodytes OX=9598 GN=FLOT1 PE=3 SV=1)

HSP 1 Score: 468.003 bits (1203), Expect = 1.543e-160
Identity = 248/417 (59.47%), Postives = 333/417 (79.86%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     +IA IA ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEAEA+RDAGI++AKA++ +V+++  +E ++A+AQRD++LKKA YD E+ T++AQ+ L+Y LQVA TKQQI+E+ +Q++VVER QQV +QE EI R++KELEARVRKPAEAE Y+L+++AEAEK ++I +AE E+E++R+ GEA AFAI A A+AEAEQ+ KKAEA++ Y  AA+L+M L  LP++A E++ PL+S +KIT+VSSG+G +GA K+TGEV+ I+  LP  V+ +TG  I++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQ 418          
BLAST of Flotillin-1 vs. UniProt/SwissProt
Match: sp|Q5TM70|FLOT1_MACMU (Flotillin-1 OS=Macaca mulatta OX=9544 GN=FLOT1 PE=3 SV=1)

HSP 1 Score: 468.003 bits (1203), Expect = 1.543e-160
Identity = 248/417 (59.47%), Postives = 333/417 (79.86%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L  AC ++L     +IA IA ETLEGHQRAIM +MTVEEIY DR+KFS+ VF+VASSDLVNMGISVVSYTLKDIHDD+ YL SLG ARTAQV++D RIGEAEA+RDAGI++AKA++ +V+++  +E ++A+AQRD++LKKA YD E+ T++AQ+ L+Y LQVA TKQQI+E+ +Q++VVER QQV +QE EI R++KELEARVRKPAEAE Y+L+++AEAEK ++I +AE E+E++R+ GEA AFAI A A+AEAEQ+ KKAEA++ Y  AA+L+M L  LP++A E++ PL+S +KIT+VSSG+G +GA K+TGEV+ I+  LP  V+ +TG  I++
Sbjct:    2 FFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQEAAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQ 418          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A1I8IEB6 (PHB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010672g1 PE=3 SV=1)

HSP 1 Score: 517.694 bits (1332), Expect = 1.385e-177
Identity = 278/425 (65.41%), Postives = 346/425 (81.41%), Query Frame = 2
Query:  104 MP--FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSG--TGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNM 1366
            MP  F TCGPNE LV+SG  + +P+ + GGRKFV P  Q+ QR+SLN MTI + SP IYT+LG+P+T TGVAQ++I    +E L +AC  +L     +I ++A+ETLEGHQRAIMGNMTVEEIY DRKKFSK VFEVASSDLVNMGISVVSYTLKDI DDEGYLK+LGL+RTAQVKRD RIGEAEAQ+++GIK+A AE+ ++A+K  N+ +IA++QRD++LKKA +D+E++ KKA+S L+Y LQ A TKQQIKEEEMQIKVVER QQ+ +QELEI RK+++L+A VRKPAEAE YRL+K+AEAE  +I+ EA+ E+ETI+L GEA A+AIEA AKA AEQ+ KKA+AWK+YG AAKL++ L TLPKLAAEVA PL+   KITMVS+G    +LGA KITGEV+ IME LPN+VK M G DI+K +
Sbjct:    1 MPCGFQTCGPNEALVISGCCHSKPMFIPGGRKFVLPCIQQAQRISLNTMTITIESPRIYTQLGVPITVTGVAQLRIKGQNQEMLASACEQFLGKSEHEITEVARETLEGHQRAIMGNMTVEEIYKDRKKFSKAVFEVASSDLVNMGISVVSYTLKDIKDDEGYLKALGLSRTAQVKRDARIGEAEAQKESGIKEAMAEQERMAAKYKNDIEIAKSQRDYELKKAAFDQEVQAKKAESDLAYELQAAKTKQQIKEEEMQIKVVERTQQINVQELEIVRKERQLDATVRKPAEAERYRLEKLAEAENQKIVLEAQAEAETIQLKGEAEAYAIEARAKATAEQMAKKADAWKEYGEAAKLDLVLKTLPKLAAEVAQPLAGASKITMVSNGGKGSELGAAKITGEVMDIMERLPNVVKSMAGVDISKTL 425          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A1I8HIB5 (PHB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013837g1 PE=3 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 1.014e-175
Identity = 277/425 (65.18%), Postives = 343/425 (80.71%), Query Frame = 2
Query:  104 MP--FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSG--TGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNM 1366
            MP  F TCGPNE LV+SG  + +P+ + GGRKFV P  Q++QRLSLN MTI + SP IYT+LG+P+T TGVAQ++I    +E L  A   +L     +I +I++ETLEGHQRAIMGNMTVEEIY DRKKFSK VFEVASSDLVNMGISVVSYTLKDI DDEGYLK+LGL+RTAQVKRD RIGEAEAQ+++GIK+A AE+ ++A+K  N+ +IA+AQRD++LKKA +D+E++ KKA+S L+Y LQ A T+QQIKEEEMQIKVVER QQ+ +QELEI RK++ L+A VRKPAEAE YRL+K+AEAE  +I+ EA+ E+E+I+L GEA A+AIEA AKA AEQ+ KKA+AWK+YG AAKL++ L TLPKLAAEVA PL+  +KITMVS+G    +LGA KITGEV+ IME LP +V  M G DIAK M
Sbjct:    1 MPWGFQTCGPNEALVISGCCHSKPMYIPGGRKFVLPGIQQVQRLSLNTMTITIESPRIYTQLGVPVTVTGVAQLRIKGQNQEMLAAAAEQFLGKSEHEITEISRETLEGHQRAIMGNMTVEEIYKDRKKFSKCVFEVASSDLVNMGISVVSYTLKDIKDDEGYLKALGLSRTAQVKRDARIGEAEAQKESGIKEAMAEQERMAAKYKNDIEIAKAQRDYELKKAAFDQEVQAKKAESDLAYELQAAKTRQQIKEEEMQIKVVERTQQINVQELEIVRKERHLDASVRKPAEAERYRLEKIAEAENQKIVLEAQAEAESIQLKGEAEAYAIEARAKATAEQMAKKADAWKEYGEAAKLDLVLKTLPKLAAEVAQPLAGANKITMVSNGGKGSELGAAKITGEVMDIMERLPRIVNSMAGVDIAKTM 425          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A1I8HKJ4 (PHB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028981g1 PE=3 SV=1)

HSP 1 Score: 513.072 bits (1320), Expect = 1.050e-175
Identity = 277/425 (65.18%), Postives = 343/425 (80.71%), Query Frame = 2
Query:  104 MP--FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSG--TGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNM 1366
            MP  F TCGPNE LV+SG  + +P+ + GGRKFV P  Q++QRLSLN MTI + SP IYT+LG+P+T TGVAQ++I    +E L  A   +L     +I +I++ETLEGHQRAIMGNMTVEEIY DRKKFSK VFEVASSDLVNMGISVVSYTLKDI DDEGYLK+LGL+RTAQVKRD RIGEAEAQ+++GIK+A AE+ ++A+K  N+ +IA+AQRD++LKKA +D+E++ KKA+S L+Y LQ A T+QQIKEEEMQIKVVER QQ+ +QELEI RK++ L+A VRKPAEAE YRL+K+AEAE  +I+ EA+ E+E+I+L GEA A+AIEA AKA AEQ+ KKA+AWK+YG AAKL++ L TLPKLAAEVA PL+  +KITMVS+G    +LGA KITGEV+ IME LP +V  M G DIAK M
Sbjct:    1 MPWGFQTCGPNEALVISGCCHSKPMYIPGGRKFVLPGIQQVQRLSLNTMTITIESPRIYTQLGVPVTVTGVAQLRIKGQNQEMLAAAAEQFLGKSEHEITEISRETLEGHQRAIMGNMTVEEIYKDRKKFSKCVFEVASSDLVNMGISVVSYTLKDIKDDEGYLKALGLSRTAQVKRDARIGEAEAQKESGIKEAMAEQERMAAKYKNDIEIAKAQRDYELKKAAFDQEVQAKKAESDLAYELQAAKTRQQIKEEEMQIKVVERTQQINVQELEIVRKERHLDASVRKPAEAERYRLEKIAEAENQKIVLEAQAEAESIQLKGEAEAYAIEARAKATAEQMAKKADAWKEYGEAAKLDLVLKTLPKLAAEVAQPLAGANKITMVSNGGKGSELGAAKITGEVMDIMERLPRIVNSMAGVDIAKTM 425          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A1B6G9M7 (PHB domain-containing protein OS=Cuerna arida OX=1464854 GN=g.32683 PE=3 SV=1)

HSP 1 Score: 512.301 bits (1318), Expect = 1.432e-175
Identity = 271/421 (64.37%), Postives = 343/421 (81.47%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMTV 1372
            F TCGPNE LVVSG  Y +PL++ GGR FV+P  Q +QR+SLN MT+ V SP +YT  G+P++ TG+AQVKI    EE L  AC  +L    ++I  IA  TLEGHQRAIMG+MTVEEIY DRKKFSK VFEVASSDLVNMGI+VVSYTLKDI D+EGYLKSLG+ARTA+VKRD RIGEAEA+RDA IK+A AEE ++AS+  N+T+IA+AQRDF+LKKA YD E++TKKA+++++Y LQ A TKQ+I EE+MQIKVVER Q++ +Q+ EIQRK++ELE+ VR+PAEAE YRL+K+AEA +LR++ EAE E+E++RL GEA AFA++A AKAEAEQ+ KKAEA+K+Y  AA +EM L+TLPK+AAEVA+PLS   KITMVSSG G++GA K+TGEV+ I+  +P +VK MTG DI K++ V
Sbjct:    5 FVTCGPNEALVVSGCCYTKPLLVPGGRAFVWPSIQCVQRISLNTMTLQVDSPTVYTSQGVPISVTGIAQVKIQGQNEEMLLAACEQFLGKSDDEIQHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLVNMGITVVSYTLKDIRDEEGYLKSLGMARTAEVKRDARIGEAEARRDAQIKEAMAEEERMASRFLNDTEIAKAQRDFELKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIMEEQMQIKVVERTQEIAVQDQEIQRKERELESMVRRPAEAEKYRLEKLAEANRLRVVLEAEAEAESLRLRGEAEAFAVQAKAKAEAEQMTKKAEAFKEYREAAMVEMLLDTLPKIAAEVAAPLSQAKKITMVSSGQGEIGAAKLTGEVLQIVTKVPEMVKNMTGVDIMKSVHV 425          
BLAST of Flotillin-1 vs. TrEMBL
Match: A0A1I8Q0W3 (PHB domain-containing protein OS=Stomoxys calcitrans OX=35570 GN=106084635 PE=3 SV=1)

HSP 1 Score: 509.22 bits (1310), Expect = 2.931e-174
Identity = 266/419 (63.48%), Postives = 341/419 (81.38%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNM 1366
            F TCGPNE LVVSG  Y +PL++ GGR FV+P  Q++QR+SLN MT+ V SP +YT  G+P++ TG+AQVKI    E+ L TAC  +L     +I  IA  TLEGHQRAIMG+MTVEEIY DRKKFSK VFEVASSDL NMGISVVSYT+KDI D+EGYLKSLG+ARTA+VKRD RIGEAEA+ DA IK+A AEE ++AS+  N+T+IA+AQRDF++KKA YD E++TKKA+++++Y LQ A TKQ+IKEE+MQ+KV+ER Q++ +Q+ EIQR++KELEA VR+PAEAE YRL+K+AEA K+RI+ EAE E+E+I++ GEA AFAI   AKAEAEQ+ +KAEAW++Y  AA +EM L+TLPK+AAEVA+PLS   KITMVSSG G++GA K+TGEV+ I+  +P LVK +TG DIA+++
Sbjct:    5 FVTCGPNEALVVSGCCYMKPLLVPGGRAFVWPTIQQVQRISLNTMTLQVESPCVYTSQGVPISVTGIAQVKIQGQNEDMLLTACEQFLGKPESEIRHIALVTLEGHQRAIMGSMTVEEIYKDRKKFSKQVFEVASSDLANMGISVVSYTIKDIRDEEGYLKSLGMARTAEVKRDARIGEAEARCDAQIKEAIAEEQRMASRFLNDTEIAKAQRDFEIKKAAYDVEVQTKKAEAEMAYELQAAKTKQRIKEEQMQVKVIERTQEIAVQQQEIQRREKELEATVRRPAEAEKYRLEKIAEANKMRIVMEAEAEAESIKIRGEAEAFAIATKAKAEAEQMAQKAEAWREYREAAMVEMLLDTLPKVAAEVAAPLSQAKKITMVSSGQGEIGAAKLTGEVLQIVNKVPELVKNITGVDIARSV 423          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot1b (flotillin-1-like [Source:NCBI gene;Acc:103034507])

HSP 1 Score: 465.692 bits (1197), Expect = 1.278e-160
Identity = 247/422 (58.53%), Postives = 331/422 (78.44%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMTVR 1375
            F TCGPNE +VVSG G   P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L TAC ++L     +I+ IA ETLEGHQRAI+ ++TVEEIY DRKKFS+ VF+VASSDLVNMGI VVSYTLKD+HDD+ YL+SLG ARTAQV+RD RIGEA+ +RD+ I++A A + +V+++  NE ++A+AQRD++LKKA YD EI TKKA+S+++Y LQVA TKQ+I+EE+MQ+ VVER QQ+ LQE EI RK+KELEA+V+KPAEAE YRL+K+AEAE+L++I EAE E+E+IR+ GEA AFA+EA  +AEAEQ+ KKAEA+K Y   A ++M L  LP +A E++ PLS+  K+TMVSSG  ++GA K+TGEV+ IM  LP  ++ +TG +I++  + R
Sbjct:    2 FYTCGPNEAMVVSGCGRSPPIMISGGRVFVLPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQVKIQGQNKEMLATACQMFLGKTETEISQIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLQSLGKARTAQVQRDARIGEAQYKRDSVIREAHAMQEKVSAQYVNEIEMAKAQRDYELKKAAYDIEINTKKAESEMAYQLQVAKTKQRIEEEKMQVMVVERTQQITLQEQEISRKEKELEAKVKKPAEAEKYRLEKLAEAERLQLIMEAEAEAESIRMKGEAEAFALEAKGRAEAEQMAKKAEAFKQYKEGAMVDMLLEKLPLMAEEISKPLSAAQKVTMVSSGGSEVGAAKLTGEVLDIMTRLPATIEKLTGINISQVSSTR 423          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:103027319])

HSP 1 Score: 455.677 bits (1171), Expect = 1.144e-156
Identity = 243/417 (58.27%), Postives = 327/417 (78.42%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            F TCGPNE +VVSG     P+M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQ+KI    ++ L  AC +++     +IA IA ETLEGHQRAI+ ++TVEEIY DRKKFS+ VF+VASSDLVNMGISVVSYTLKD+HDD+ YL SLG ARTAQV++D RIGEA  +RDA I++A A + +V+++  NE ++A+AQRDF+LKKA YD E+ TKKA+S+++Y LQVA TKQ+I+EE+MQ+KVVER QQ+ LQE EI RK+KELEA+V+KPAEAE YRL+K+AEAE+L++I EAE E+E+IR+ GEA AFA+EA  +AEAEQ+ KKAEA++ Y   A ++M L  LP +A E++ PLS+ +K+TMVSSG  ++GA K+TGEV+ IM  LP  ++ +TG  I++
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPVMISGGRVFVIPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEAEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHALQEKVSAQYMNEIQMAKAQRDFELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEEKMQVKVVERAQQITLQEQEITRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAFAVEAKGRAEAEQMAKKAEAFQQYKEGAMVDMLLEKLPLVAEEISKPLSAANKVTMVSSGGSEVGAAKLTGEVMDIMTRLPETIEKLTGVSISQ 418          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:103027319])

HSP 1 Score: 428.328 bits (1100), Expect = 2.372e-146
Identity = 231/396 (58.33%), Postives = 313/396 (79.04%), Query Frame = 2
Query:  173 MLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            M+ GGR FV P  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQ+KI    ++ L  AC +++     +IA IA ETLEGHQRAI+ ++TVEEIY DRKKFS+ VF+VASSDLVNMGISVVSYTLKD+HDD+ YL SLG ARTAQV++D RIGEA  +RDA I++A A + +V+++  NE ++A+AQRDF+LKKA YD E+ TKKA+S+++Y LQVA TKQ+I+EE+MQ+KVVER QQ+ LQE EI RK+KELEA+V+KPAEAE YRL+K+AEAE+L++I EAE E+E+IR+ GEA AFA+EA  +AEAEQ+ KKAEA++ Y   A ++M L  LP +A E++ PLS+ +K+TMVSSG  ++GA K+TGEV+ IM  LP  ++ +TG  I++
Sbjct:    1 MISGGRVFVIPCVQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEAEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHALQEKVSAQYMNEIQMAKAQRDFELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEEKMQVKVVERAQQITLQEQEITRKEKELEAKVKKPAEAERYRLEKLAEAERLQLIMEAEAEAESIRVRGEAEAFAVEAKGRAEAEQMAKKAEAFQQYKEGAMVDMLLEKLPLVAEEISKPLSAANKVTMVSSGGSEVGAAKLTGEVMDIMTRLPETIEKLTGVSISQ 396          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:103045282])

HSP 1 Score: 311.997 bits (798), Expect = 1.460e-100
Identity = 189/422 (44.79%), Postives = 287/422 (68.01%), Query Frame = 2
Query:  104 MPFC-TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            M  C T GPNE LVVSG   G D+     GG  + +     IQ+LSL +MTIL     I T  G+PL  TGVAQVK++++ +E L  AC  +L     +I  +  +TLEGH R+I+G +TVE+IY DR +F+  V EVA+ D+  MGI ++S+T+KD++D   YL SLG  +TA V+RD  IG AEA+RDAGI++A+ ++  +  K   +TK+A ++R+ +++KA +++E+  KKA++QL+Y LQ A  +Q+I+ EE++I+VV+R +Q+ ++E EI R DKEL A V++PAEAEAY++Q++AE +K++ +  A+ E+E I+  GEA A +IEA+ KAEAE++  KAEA+  YG AAK  + L  LPK+A +VA+PL+  ++I ++ SG G    +++TGEV  ++  LP  V  +TG D+ K
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDQKTYTVGGWAWAWCLLTDIQKLSLEVMTILCRCENIETSEGVPLDVTGVAQVKVMTD-KELLSLACEQFLGKSVIEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDQFASLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELEMQKASFNQEVNAKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIVRTDKELIATVKRPAEAEAYKMQQLAEGQKVKKVLTAQAEAEKIKRIGEAEAASIEAVGKAEAEKMRMKAEAYMQYGEAAKTALVLEALPKIAGKVAAPLARTNEIVIL-SGEG----SRVTGEVNRLLAELPVSVNALTGVDLTK 416          
BLAST of Flotillin-1 vs. Ensembl Cavefish
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:103045282])

HSP 1 Score: 302.753 bits (774), Expect = 5.077e-97
Identity = 184/422 (43.60%), Postives = 286/422 (67.77%), Query Frame = 2
Query:  104 MPFC-TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            M  C T GPNE LVVSG   G D+     GG  + +     IQ+++L +MT+      + T  G+ LT TGVAQVK++++ +E L  AC  +L     +I  +  +TLEGH R+I+G +TVE+IY DR +F+  V EVA+ D+  MGI ++S+T+KD++D   YL SLG  +TA V+RD  IG AEA+RDAGI++A+ ++  +  K   +TK+A ++R+ +++KA +++E+  KKA++QL+Y LQ A  +Q+I+ EE++I+VV+R +Q+ ++E EI R DKEL A V++PAEAEAY++Q++AE +K++ +  A+ E+E I+  GEA A +IEA+ KAEAE++  KAEA+  YG AAK  + L  LPK+A +VA+PL+  ++I ++ SG G    +++TGEV  ++  LP  V  +TG D+ K
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDQKTYTVGGWAWAWCLLTDIQKITLEIMTLQPKCEDVETAEGVALTVTGVAQVKVMTD-KELLSLACEQFLGKSVIEIKGVVLQTLEGHLRSILGTLTVEQIYQDRDQFASLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFLADTKMADSKRELEMQKASFNQEVNAKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIVRTDKELIATVKRPAEAEAYKMQQLAEGQKVKKVLTAQAEAEKIKRIGEAEAASIEAVGKAEAEKMRMKAEAYMQYGEAAKTALVLEALPKIAGKVAAPLARTNEIVIL-SGEG----SRVTGEVNRLLAELPVSVNALTGVDLTK 416          
BLAST of Flotillin-1 vs. Ensembl Sea Lamprey
Match: flot1b (flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2])

HSP 1 Score: 444.891 bits (1143), Expect = 3.189e-153
Identity = 245/414 (59.18%), Postives = 323/414 (78.02%), Query Frame = 2
Query:  149 GVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMTVRAT*DF 1390
            G G   P+ + GGR FV+P  Q++QR+SLN MT+ V S  +YT+ G+P++ TG+AQVKI    ++ L  AC ++L    E+I+ IA ETLEGHQRAIMGNMTVEEIY DRKKFS+ VF VASSDL+NMGISVVSYTLKD+ DDE YLKSLG ARTAQV+RD RIGEAE +RDAGIK+A A E +VA++  NE +IA+AQ +F+LK A YD E+ T+KAQ+ L+Y LQVA TKQ+I+EE+MQI VVER QQ+ +QE EI R++KEL+A+++KPAEAE YRL+K+AEA + R+I EAE E+E+I++ GEA A+AIEA AKAEAEQ+ +KA+A+KDY  AA +++ L TLPK+A EV+ PLS   K+TM+SSG G++GA+K+T EV+ IM  LP  V+ +TG  I++   VR+  +F
Sbjct:    6 GCGRSPPITITGGRVFVWPIIQQLQRISLNTMTLNVRSEKVYTRQGVPISVTGIAQVKIQGQNKDMLAAACQMFLGKGDEEISQIALETLEGHQRAIMGNMTVEEIYKDRKKFSQEVFRVASSDLLNMGISVVSYTLKDVRDDEDYLKSLGKARTAQVQRDARIGEAEMKRDAGIKEAMAVEQKVAAQYLNEIEIAKAQLEFELKTAAYDMEVNTQKAQADLAYQLQVAKTKQKIEEEKMQILVVERTQQILVQEQEILRREKELDAKIKKPAEAEKYRLEKLAEAGRARVIMEAEAEAESIKIKGEAEAYAIEAKAKAEAEQMLQKAQAFKDYEEAAMVDLLLETLPKIATEVSQPLSKARKVTMISSGGGEVGASKLTSEVLDIMSKLPESVERLTGVKISQ---VRSAPNF 416          
BLAST of Flotillin-1 vs. Ensembl Sea Lamprey
Match: flot2a (flotillin 2a [Source:NCBI gene;Acc:245698])

HSP 1 Score: 312.768 bits (800), Expect = 1.254e-101
Identity = 188/423 (44.44%), Postives = 292/423 (69.03%), Query Frame = 2
Query:  104 MPFC-TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKN 1363
            M  C T GPNE LVVSG   G DE   + GG  +V+    + QR+SL +MT+      + T  G+ LT TGVAQVK++++ ++ L  AC  +L    ++I  +  +TLEGH R+I+G +TVE +Y DR +F++ V EVAS D+  MGI ++S+T+KD++D   YL SLG  + A VKRD  IG A+A+RDAGI++A+ ++  +  K   +TKIA ++R+++++KA +++E +TKKA++QL+Y LQ A  +Q+I++EE QI+VV+R +Q+ ++E EIQR ++EL A VR PA+AEA+R+Q++AE +K++ +  A+ ++E I+  G+A A AIEA+ +AEAE++  KAEA+K YG AA + M L+ LPK+AAEVA+PL    +I ++ SG G    N+ T EV  ++  LP  V+ +TG D++K+
Sbjct:    1 MGNCETVGPNEALVVSGGWCGADEKKYVTGGWSWVWCLVSQAQRISLEIMTLNPRCEDVETSEGVALTVTGVAQVKVMTD-KDLLAVACEQFLGRTVDEIKSVVLQTLEGHLRSILGTLTVEAVYQDRDQFAQLVREVASPDVGRMGIEILSFTIKDVYDKVEYLASLGKTQAALVKRDAEIGVAQAERDAGIREAECKKNMMDVKFNADTKIANSKREYEMQKAFFNQESQTKKAEAQLAYELQAAKEQQKIRQEECQIEVVQRRKQIDVEEREIQRTERELIATVRCPAQAEAFRVQQIAEGDKIKRVLAAQADAERIKKIGDAEAAAIEAIGRAEAEEMRLKAEAYKQYGKAAIISMVLDALPKIAAEVAAPLQKIDEIVIL-SGEG----NRTTTEVTRLLAELPTTVQALTGVDLSKS 417          
BLAST of Flotillin-1 vs. Ensembl Nematostella
Match: EDO47182 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMZ4])

HSP 1 Score: 504.597 bits (1298), Expect = 2.733e-176
Identity = 267/421 (63.42%), Postives = 343/421 (81.47%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMTV 1372
            F TCGPNE +VVSG  +  P ++ GGR FV+P FQK+QR+SLN MT+ V SP +YT+ G+P++ TG+AQVKI    +E L  AC  +L    E+   IA ETLEGHQRAIMG MTVEEIY DRKKFSK VFEVASSDLVNMGIS+VSYT+KDI D+EGYL +LG++RTAQVKRD RIGEAEA+RD+GIK+A AEEA++ +K  N+T+IA+A+RDF+LKKA YD E++TK A SQ++YNLQ AVTKQ+IKEEEMQIKVVER QQ+K+QE EI R+++ELEA VR+PAEAE YRL+K+AEA + R+I EAE +SE I++ G+A AFAIEA AKAEAEQ+ KKA+AWK+Y  AA ++M L T+PK+AAE+A+PLS  +KITMVS+G G++GA+K+TGE++ I+  LP  V+ +TG DI+K M++
Sbjct:    4 FNTCGPNEAMVVSGCFHARPALVSGGRIFVWPVFQKLQRISLNTMTLNVESPRVYTRHGVPISVTGIAQVKIQGQNQEMLHAACQQFLGKSAEQTRHIALETLEGHQRAIMGTMTVEEIYRDRKKFSKSVFEVASSDLVNMGISIVSYTIKDIRDEEGYLHALGMSRTAQVKRDARIGEAEAKRDSGIKEAIAEEARLKAKYENDTQIAKAKRDFELKKAGYDIEVQTKNATSQMAYNLQAAVTKQKIKEEEMQIKVVERGQQIKVQEQEIARRERELEATVRQPAEAEKYRLEKLAEANRNRVILEAEAQSEAIKVKGDAEAFAIEAKAKAEAEQMAKKADAWKEYREAAIVDMVLETMPKIAAEIAAPLSQVNKITMVSNGKGEVGASKVTGEILDIVAKLPKAVEALTGIDISKAMSL 424          
BLAST of Flotillin-1 vs. Ensembl Nematostella
Match: EDO37688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF43])

HSP 1 Score: 306.22 bits (783), Expect = 8.928e-99
Identity = 187/421 (44.42%), Postives = 283/421 (67.22%), Query Frame = 2
Query:  104 MPFC-TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIA 1357
            M  C T GPNE LVVSG   G      + GG  F +     +Q +SL +MT+      + T  G+ +T TGVAQVK+++     LKTAC  +L     +I  +  +TLEGH RAI+G ++VEEIY DR+ F+  V EVAS D+  MGI ++S+T+KDI D   YL SLG  +TA+VKRD  IG AEA+RDAGI++A+ E+ ++      +T IA + R++Q++KA YD+E+ T+KA+++LSY LQ    KQ+I+ EE+QI+VVER +Q+++QE EIQRK+KEL A V++PAEAE+Y+++ +A+ ++ + +  A+ ++E I+L G + A AIEA+ KAEAE++ +KA A+K YG AA   + L  LPK+AAEVA+PL+   +I +++    D G N ++GE+  ++  LP  ++ +TG D++
Sbjct:    1 MGNCYTVGPNEALVVSGGCCGSAAKKTVIGGWAFAWACVTDVQSISLEVMTLNPTCEAVETAQGVAVTVTGVAQVKVMTE-PRLLKTACEQFLGKTTRQIESVVLQTLEGHLRAILGTLSVEEIYKDREAFAALVREVASPDVGRMGIEILSFTIKDIEDHVDYLNSLGKTQTAKVKRDADIGVAEAKRDAGIREAECEKQKMDVVYETQTNIADSSREYQMQKAAYDQEVNTRKAEAELSYELQGNKEKQKIRSEEIQIEVVERRKQIEVQEKEIQRKEKELIAEVKRPAEAESYKVETLAQGKRTQTVFLAQADAERIKLIGSSEASAIEAIGKAEAERMRQKAAAYKMYGDAAMTALILEALPKVAAEVAAPLAKTGEIVIIN----DDG-NSVSGELSKLLGQLPPAIQALTGTDLS 415          
BLAST of Flotillin-1 vs. Ensembl Nematostella
Match: EDO25979 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD74])

HSP 1 Score: 76.2554 bits (186), Expect = 1.877e-17
Identity = 39/68 (57.35%), Postives = 50/68 (73.53%), Query Frame = 2
Query:  473 DRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIK 676
            DR+ F+  V EVAS D+  MGI ++S+T+KDI D   YL SLG  +TA+VKRD  IG AEA+RDAGI+
Sbjct:    1 DREAFAALVREVASPDVGRMGIEILSFTIKDIEDHVDYLNSLGKTQTAKVKRDADIGVAEAKRDAGIR 68          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:101155616])

HSP 1 Score: 455.677 bits (1171), Expect = 9.784e-157
Identity = 240/416 (57.69%), Postives = 327/416 (78.61%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIA 1357
            F TCGPNE +VVSG     PLM+ GGR FVFP  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQ+KI    ++ L  AC +++     +IA IA ETLEGHQRAI+ ++TVEEIY DRKKFS+ VF+VASSDLVNMGISVVSYTLKD+HDD+ YL SLG ARTAQV++D RIGEA  +RDA I++A A + +++++  N+ ++A+AQRD++LKKA YD E+ TKKA+S+++Y LQVA TKQ+I+EE MQ++VVER QQ+ LQ+ EI RK+KELEA+V+KPAEAE YR +K+AEA++L++I EAE E+E+IR+ GEA A+AIEA+ +AEAEQ+ KKAEA++ Y   A ++M +  LP +A E++ PLS  HKITMVSSG G++GA K++GEV+ IM  LP  V+ +TG +I+
Sbjct:    2 FYTCGPNEAMVVSGFCRSPPLMIAGGRVFVFPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEHEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHAMQEKISAQYKNDIEMAKAQRDYELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEERMQVQVVERSQQIFLQDQEITRKEKELEAKVKKPAEAERYRQEKLAEAQRLKMIMEAEAEAESIRIKGEAEAYAIEAMGRAEAEQMAKKAEAFQQYKDGAMVDMLMEKLPLMAEEISKPLSQAHKITMVSSGAGEIGAAKLSGEVLDIMTRLPEAVEKLTGVNIS 417          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot1b (flotillin-1 [Source:NCBI gene;Acc:101157726])

HSP 1 Score: 453.751 bits (1166), Expect = 2.485e-155
Identity = 246/440 (55.91%), Postives = 335/440 (76.14%), Query Frame = 2
Query:   62 RNIDFVLQNFYIFNMP-FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMTVRA 1378
            R   ++L   +I  +  F TCGPNE +VVSG G   PLM+ GGR FVFP  QKIQR+SLN +T+ V S  +YT+ G+P++ TG+AQVKI    +E L TAC +++     +I++IA ETLEGHQRAI+ ++TVEEIY DRKKFS+ VF+VASSDLVNMGI VVSYTLKD+HDD+ YL SLG ARTAQV++D RIGEA+ +RD+ IK+A+A + +V+++  NE ++A+AQRD++LKKA YDKE+  KKA+S+++Y LQVA TKQ I+EE+MQ+ VVER QQ+ LQE EI RK+KELEA+V KPA+AE YRL+K+AEA++ ++I EAE E+E+I++ GEA AFA+EA  +AEAEQ+ KKAEA+K Y   A +++ L  LP +A  ++ PLS   KITMVSSG  ++GA K+ GEV+ IM  +P+ ++ +TG DI++    RA
Sbjct:   23 RRGTYLLPTLFISGIRMFYTCGPNEAMVVSGCGRAPPLMIAGGRVFVFPCIQKIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQVKIQGQNKEMLATACQMFMGKSEREISEIALETLEGHQRAIIAHLTVEEIYQDRKKFSEQVFKVASSDLVNMGIGVVSYTLKDVHDDQDYLNSLGKARTAQVQKDARIGEAQYKRDSVIKEARAMQEKVSAQYKNEIEMAKAQRDYELKKAAYDKEVNAKKAESEMAYQLQVAKTKQCIEEEKMQVLVVERTQQIMLQEQEIIRKEKELEAKVMKPADAERYRLEKLAEAQRAQLIMEAEAEAESIKMKGEAEAFAMEAKGRAEAEQMAKKAEAFKQYKEGAMVDLLLEKLPLMAEAISEPLSHAQKITMVSSGGSEVGAAKLAGEVLDIMTRVPSALEKLTGIDISQAAGKRA 462          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot1a (flotillin-1 [Source:NCBI gene;Acc:101155616])

HSP 1 Score: 426.402 bits (1095), Expect = 1.231e-145
Identity = 227/395 (57.47%), Postives = 313/395 (79.24%), Query Frame = 2
Query:  173 MLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIA 1357
            M+ GGR FVFP  Q+IQR+SLN +T+ V S  +YT+ G+P++ TG+AQ+KI    ++ L  AC +++     +IA IA ETLEGHQRAI+ ++TVEEIY DRKKFS+ VF+VASSDLVNMGISVVSYTLKD+HDD+ YL SLG ARTAQV++D RIGEA  +RDA I++A A + +++++  N+ ++A+AQRD++LKKA YD E+ TKKA+S+++Y LQVA TKQ+I+EE MQ++VVER QQ+ LQ+ EI RK+KELEA+V+KPAEAE YR +K+AEA++L++I EAE E+E+IR+ GEA A+AIEA+ +AEAEQ+ KKAEA++ Y   A ++M +  LP +A E++ PLS  HKITMVSSG G++GA K++GEV+ IM  LP  V+ +TG +I+
Sbjct:    1 MIAGGRVFVFPCIQQIQRISLNTLTLNVKSDKVYTRHGVPISVTGIAQMKIQGQNKQMLAAACQMFMGKSEHEIAQIALETLEGHQRAIIAHLTVEEIYKDRKKFSEQVFKVASSDLVNMGISVVSYTLKDVHDDQDYLHSLGKARTAQVQKDARIGEALNKRDAVIREAHAMQEKISAQYKNDIEMAKAQRDYELKKAAYDIEVNTKKAESEMAYQLQVAKTKQRIEEERMQVQVVERSQQIFLQDQEITRKEKELEAKVKKPAEAERYRQEKLAEAQRLKMIMEAEAEAESIRIKGEAEAYAIEAMGRAEAEQMAKKAEAFQQYKDGAMVDMLMEKLPLMAEEISKPLSQAHKITMVSSGAGEIGAAKLSGEVLDIMTRLPEAVEKLTGVNIS 395          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:101169802])

HSP 1 Score: 322.013 bits (824), Expect = 1.657e-104
Identity = 194/422 (45.97%), Postives = 288/422 (68.25%), Query Frame = 2
Query:  104 MPFC-TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            M  C T GPNE LVVSG   G DE   + GG  + +     IQR+SL +MTIL     I T  G+PL  TGVAQVK+++   E L  AC  +L     +I  +  +TLEGH RAI+G +TVE+IY DR KF+  V EVA+ D+  MGI ++S+T+KD++D   YL SLG  +TA V+RD  IG AEA+RDAGI++A+ ++  +  K   +TK+A ++R+ +++KA +++E+ TKKA++QL+Y LQ A  +Q+I+ EE++I+VV+R +Q+ ++E EI R +KEL A V++PAEAEAY++Q++AE +K++ +  A+ E+E IR  GEA A +IEA+ KAEAE++  KAEA++ YG AAK  + L  LPK+A +VA+PLS  ++I ++S   GD   +++TGEV  ++  LP  V  +TG D+ K
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDEKTYVVGGWAWAWWLISDIQRMSLEVMTILCRCENIETSEGVPLAVTGVAQVKVMTE-RELLGYACEQFLGKSVVEIKSVILQTLEGHLRAILGTLTVEQIYQDRDKFASLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFVADTKMADSKRELEMQKASFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIDRTEKELIATVKRPAEAEAYKMQQLAEGQKMKKVLTAQAEAEKIRCIGEAEATSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLSKTNEIVILS---GD--GSRVTGEVNRLLAELPVSVNALTGVDLMK 416          
BLAST of Flotillin-1 vs. Ensembl Medaka
Match: flot2a (flotillin 2 [Source:NCBI gene;Acc:101169802])

HSP 1 Score: 311.997 bits (798), Expect = 1.381e-100
Identity = 189/422 (44.79%), Postives = 287/422 (68.01%), Query Frame = 2
Query:  104 MPFC-TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            M  C T GPNE LVVSG   G DE   + GG  + +     IQR++L +MT+      + T  G+ +T TGVAQVK+++   E L  AC  +L     +I  +  +TLEGH RAI+G +TVE+IY DR KF+  V EVA+ D+  MGI ++S+T+KD++D   YL SLG  +TA V+RD  IG AEA+RDAGI++A+ ++  +  K   +TK+A ++R+ +++KA +++E+ TKKA++QL+Y LQ A  +Q+I+ EE++I+VV+R +Q+ ++E EI R +KEL A V++PAEAEAY++Q++AE +K++ +  A+ E+E IR  GEA A +IEA+ KAEAE++  KAEA++ YG AAK  + L  LPK+A +VA+PLS  ++I ++S   GD   +++TGEV  ++  LP  V  +TG D+ K
Sbjct:    1 MGNCHTVGPNEALVVSGGCCGSDEKTYVVGGWAWAWWLISDIQRITLEIMTLQPKCEDVETAEGVAITVTGVAQVKVMTE-RELLGYACEQFLGKSVVEIKSVILQTLEGHLRAILGTLTVEQIYQDRDKFASLVREVAAPDVGRMGIEILSFTIKDVYDKVEYLSSLGKTQTAAVQRDADIGVAEAERDAGIREAECKKEMMDVKFVADTKMADSKRELEMQKASFNQEVNTKKAEAQLAYELQAAKEQQKIRLEEIEIEVVQRKKQITIEEKEIDRTEKELIATVKRPAEAEAYKMQQLAEGQKMKKVLTAQAEAEKIRCIGEAEATSIEAVGKAEAEKMRLKAEAYQQYGEAAKTALVLEALPKIAGKVAAPLSKTNEIVILS---GD--GSRVTGEVNRLLAELPVSVNALTGVDLMK 416          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000004975.1 (SMESG000004975.1)

HSP 1 Score: 705.671 bits (1820), Expect = 0.000e+0
Identity = 377/424 (88.92%), Postives = 397/424 (93.63%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMTVRAT 1381
            F TCGPNE +V+SG+ Y +P ++ GGR FV P  Q++ R+SLN+MT+ + SP IYT+LG+P+T TGVAQVKI S+ +E L TAC  +L     +I D+AKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGEARAFAIEALAKAEAEQLEKKAEAWKDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMTVRAT
Sbjct:    5 FKTCGPNEAMVISGMFYGKPHLISGGRAFVLPLIQRVDRISLNIMTLKIESPRIYTQLGVPITVTGVAQVKIQSSNKEMLATACEQFLGRSVHQIMDVAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGEARAFAIEALAKAEAEQLEKKAEAWKDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMTVRAT 428          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000064151.1 (SMESG000064151.1)

HSP 1 Score: 587.415 bits (1513), Expect = 0.000e+0
Identity = 300/417 (71.94%), Postives = 361/417 (86.57%), Query Frame = 2
Query:  104 MPFCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDI 1354
            MPFCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMG MTVEEIY DRKKF+  VFEVAS DL  MG+ VVSYT+K++ D+EGYL SLG++RT+QVKRD RIGEAEA+RDA +KQA AE+ +  S+L N+TKIAQA+RDF +KKAEY+KEI+T++A+++L+Y LQ A T+QQI  EEMQIKVVER Q + +Q+LEIQR+++EL++ VRK  EAE Y+++K+A AEK+R ++EAE  +ET +L GEA AFAI   AKAEAEQ+ KKAE+WK+Y  AAKLE+FL+TLPK+AAEVA+PL+S  KITMVS+    +G  KI+ E++S+M+ +P LV+ MTG D+
Sbjct:    1 MPFCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGLMTVEEIYQDRKKFANAVFEVASRDLFQMGLQVVSYTIKELSDEEGYLNSLGMSRTSQVKRDARIGEAEARRDASVKQAAAEKLETISQLENKTKIAQAERDFSIKKAEYEKEIKTRQAETELAYRLQAAKTRQQIMLEEMQIKVVEREQMITVQDLEIQRRERELDSTVRKQVEAEKYKMEKIAYAEKIRAVREAEASAETTKLRGEAEAFAILEKAKAEAEQMAKKAESWKEYTEAAKLELFLSTLPKIAAEVANPLTSVSKITMVSNDNSPIGITKISDEILSVMDRIPKLVQNMTGLDL 417          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000062944.1 (SMESG000062944.1)

HSP 1 Score: 492.271 bits (1266), Expect = 3.898e-171
Identity = 247/421 (58.67%), Postives = 339/421 (80.52%), Query Frame = 2
Query:  110 FCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAKNMTV 1372
            F  CGPNE +VVSG  + +P+M+ GGRKFV+P   K+Q++SLN MT+++ SP IYT+LG+P+T TGVAQ+KI  + +  L TAC  +L    ++I DIAKETLE HQRAIMGNMTVEEIY DRKKFS  VFEVASSD++NMGISVVSYTLKDI DDEGYLK+LG ARTAQVKRD RIGEAEA++D+GIK+A AE+ + A++ +N+ +IA++ RD++LKKA ++KE++TK+A+S  SY++Q A T+Q IKEE MQIKV+ER+++++++ LEI R+DK LEA VRK A+AE YRL+K+ EAE  RI +EAE E+E I+L G A A AI   A+A+A Q+  KAEAW++Y  AA+L MFL+ LP+LAAEVA+P+S+C KI+M+ +G+G++GA+K+T E++ IME LP +++ +TGF+I ++M +
Sbjct:    5 FIVCGPNEAMVVSGCFFRKPVMISGGRKFVWPVIHKLQKISLNTMTLIITSPRIYTQLGVPVTVTGVAQIKINGSDKGMLATACEQFLGKTEDEIRDIAKETLEAHQRAIMGNMTVEEIYKDRKKFSSSVFEVASSDMINMGISVVSYTLKDIQDDEGYLKALGEARTAQVKRDARIGEAEAKKDSGIKEALAEQLKRAAQCSNDVEIAKSSRDYELKKANFEKEVQTKRAESDFSYDIQAAKTQQAIKEEAMQIKVIERMRKIEVERLEILRQDKYLEATVRKTADAEKYRLEKLGEAEMNRICREAEAEAEKIKLKGGAEARAILLRAEADAMQMNLKAEAWQEYQEAARLNMFLDMLPQLAAEVAAPMSNCDKISMICTGSGEIGASKLTTEILEIMEKLPGVIQSITGFNIKESMQI 425          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000063612.1 (SMESG000063612.1)

HSP 1 Score: 422.165 bits (1084), Expect = 9.848e-144
Identity = 239/413 (57.87%), Postives = 313/413 (75.79%), Query Frame = 2
Query:  104 MPFCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMT 1342
            MPF T GPNE+LVVSG    +PLM+ GG+KFV+   Q  Q+LSLN+ TI++ SP IYTKLG+ LT TGVAQ+KI       L  AC  +L  K + I+DI + TLE HQRAIMG MTVEEIY DRKKFS+ VF V+S+DL+ MGISVVSYT+KDI D++GYLK+LG  RTAQV RD RIGEAEA RDA IK+A+A++AQ+ +KLAN T IA+A RDFQL+KA +DKE+ T +A ++++Y LQ A T Q I EE   I V+ER  ++++QELE++R +++L+A ++  A AE Y++QK+AEA K +++ EAE ESETI+L GEA AFAIE + KA+A Q+  KAEAWK+Y  AAK+EM L+ LP LAAEVA PL++C KITMVS+G GD+G +K+TGEVI ++  L + V  M+
Sbjct:    1 MPFVTSGPNEVLVVSGCCLGKPLMIIGGKKFVWSGVQTYQKLSLNVKTIIIVSPKIYTKLGVALTVTGVAQIKIEGKNRHMLLAACEQFLGKKDDDISDIVRATLEAHQRAIMGIMTVEEIYQDRKKFSEEVFRVSSTDLMGMGISVVSYTIKDISDEQGYLKALGQTRTAQVIRDARIGEAEATRDAEIKKAQAQQAQMHAKLANNTAIAKADRDFQLQKAIFDKEVHTNEAIAEMAYKLQEAKTNQLIMEETKHIDVIERECRIQVQELEVKRLERQLQASIKNQALAEKYQMQKLAEAMKTKLVNEAEAESETIKLKGEAEAFAIEIVGKADAAQMTMKAEAWKEYEKAAKIEMVLSMLPSLAAEVAQPLTNCQKITMVSNGEGDIGVSKLTGEVIDVINNLSDAVNKMS 413          
BLAST of Flotillin-1 vs. Planmine SMEST
Match: SMESG000024114.1 (SMESG000024114.1)

HSP 1 Score: 313.538 bits (802), Expect = 2.424e-101
Identity = 181/417 (43.41%), Postives = 282/417 (67.63%), Query Frame = 2
Query:  116 TCGPNEILVVSG--VGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTILVHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADIAKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSYTLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQVASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQIKEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAEAEKLRIIKEAEGESETIRLNGXXXXXXXXXXXXXXXXXXXXXXXXXXDYGSAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVISIMETLPNLVKGMTGFDIAK 1360
            T GPNE L +SG   G      + GG  + +    ++Q++SL +MT+      + TK G+PLT TGVAQVK+++     L TAC  +L  +  +I +   +TL+GH RAI+G +TVE IY DR +F+  V EVA+ D+  MGI ++S+T+KD++D   YL SLG A+TA VKRD  IG AEA+RDAGI++A+ E+A++  +   +T+IA A R +QL+KA +D E+   +A+++L++ LQ A  KQ+I+ EE+QI+VVER + ++++E EI R +KELE  V+KPAEAEA++ + +A+A + + +  A+GE+E+IRL G A A ++ A+ KAEAE++  KA A+  YG AA L + L+ LPK+AAE+ +PL+  ++I ++ SG+     + +TGE+  ++  LP  V+ MTG DI++
Sbjct:    6 TVGPNEALAISGGCCGTGSMKTIIGGWGWAWWLVSQVQKISLEVMTLNPTCEHVETKEGVPLTVTGVAQVKVMTE-PSLLATACEQFLGRRRSEIEETILQTLDGHLRAILGTLTVEAIYQDRDQFAHQVREVAAPDVAKMGIEILSFTIKDVYDKVEYLNSLGRAQTAIVKRDADIGVAEAERDAGIREAECEKARMDIRYEADTEIANATRGYQLQKASFDAEVFKVRAEAELAFELQAAKEKQKIRSEEIQIEVVERKKLIEIEEKEILRNEKELEGTVKKPAEAEAFKTEVLADARRTKQVLLAQGEAESIRLKGHAEASSLSAIGKAEAERMRLKAAAYNKYGDAAILSLVLDALPKVAAEITAPLAKTNEIVILGSGSDS--KSDLTGEITRLLGNLPPAVQAMTGVDISQ 419          
The following BLAST results are available for this feature:
BLAST of Flotillin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FLOT11.977e-16059.23flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT11.977e-16059.23flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT11.977e-16059.23flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT11.977e-16059.23flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
FLOT11.977e-16059.23flotillin 1 [Source:HGNC Symbol;Acc:HGNC:3757][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flotillin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flo11.623e-17362.05gene:FBgn0024754 transcript:FBtr0087351[more]
Flo13.838e-17161.47gene:FBgn0024754 transcript:FBtr0087352[more]
Flo25.900e-10245.00gene:FBgn0264078 transcript:FBtr0330217[more]
Flo26.102e-10245.00gene:FBgn0264078 transcript:FBtr0073952[more]
Flo26.102e-10245.00gene:FBgn0264078 transcript:FBtr0073950[more]
back to top
BLAST of Flotillin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot1b1.787e-15858.06flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2][more]
flot1a2.230e-15756.22flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1][more]
flot1a1.350e-15658.03flotillin 1a [Source:ZFIN;Acc:ZDB-GENE-020430-1][more]
flot2a1.077e-9744.08flotillin 2a [Source:NCBI gene;Acc:245698][more]
flot2b3.108e-9142.89flotillin 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1368... [more]
back to top
BLAST of Flotillin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot12.342e-14455.08flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot12.762e-14455.08flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot16.870e-14455.08flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot14.463e-14355.00flotillin 1 [Source:NCBI gene;Acc:733927][more]
flot11.812e-14256.44flotillin 1 [Source:NCBI gene;Acc:733927][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Flot11.752e-16259.71flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
Flot12.624e-13553.00flotillin 1 [Source:MGI Symbol;Acc:MGI:1100500][more]
Flot26.560e-10145.50flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
Flot24.476e-9844.55flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
Flot21.719e-8645.04flotillin 2 [Source:MGI Symbol;Acc:MGI:103309][more]
back to top
BLAST of Flotillin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O61491|FLOT1_DROME1.627e-17262.05Flotillin-1 OS=Drosophila melanogaster OX=7227 GN=... [more]
sp|Q9Z1E1|FLOT1_RAT1.019e-16159.47Flotillin-1 OS=Rattus norvegicus OX=10116 GN=Flot1... [more]
sp|O08917|FLOT1_MOUSE1.226e-16159.71Flotillin-1 OS=Mus musculus OX=10090 GN=Flot1 PE=1... [more]
sp|Q7YR41|FLOT1_PANTR1.543e-16059.47Flotillin-1 OS=Pan troglodytes OX=9598 GN=FLOT1 PE... [more]
sp|Q5TM70|FLOT1_MACMU1.543e-16059.47Flotillin-1 OS=Macaca mulatta OX=9544 GN=FLOT1 PE=... [more]
back to top
BLAST of Flotillin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IEB61.385e-17765.41PHB domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HIB51.014e-17565.18PHB domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HKJ41.050e-17565.18PHB domain-containing protein OS=Macrostomum ligna... [more]
A0A1B6G9M71.432e-17564.37PHB domain-containing protein OS=Cuerna arida OX=1... [more]
A0A1I8Q0W32.931e-17463.48PHB domain-containing protein OS=Stomoxys calcitra... [more]
back to top
BLAST of Flotillin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot1b1.278e-16058.53flotillin-1-like [Source:NCBI gene;Acc:103034507][more]
flot1a1.144e-15658.27flotillin-1 [Source:NCBI gene;Acc:103027319][more]
flot1a2.372e-14658.33flotillin-1 [Source:NCBI gene;Acc:103027319][more]
flot2a1.460e-10044.79flotillin 2 [Source:NCBI gene;Acc:103045282][more]
flot2a5.077e-9743.60flotillin 2 [Source:NCBI gene;Acc:103045282][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
flot1b3.189e-15359.18flotillin 1b [Source:ZFIN;Acc:ZDB-GENE-020430-2][more]
flot2a1.254e-10144.44flotillin 2a [Source:NCBI gene;Acc:245698][more]
back to top
BLAST of Flotillin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Flotillin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO471822.733e-17663.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376888.928e-9944.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259791.877e-1757.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Flotillin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flot1a9.784e-15757.69flotillin-1 [Source:NCBI gene;Acc:101155616][more]
flot1b2.485e-15555.91flotillin-1 [Source:NCBI gene;Acc:101157726][more]
flot1a1.231e-14557.47flotillin-1 [Source:NCBI gene;Acc:101155616][more]
flot2a1.657e-10445.97flotillin 2 [Source:NCBI gene;Acc:101169802][more]
flot2a1.381e-10044.79flotillin 2 [Source:NCBI gene;Acc:101169802][more]
back to top
BLAST of Flotillin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004975.10.000e+088.92SMESG000004975.1[more]
SMESG000064151.10.000e+071.94SMESG000064151.1[more]
SMESG000062944.13.898e-17158.67SMESG000062944.1[more]
SMESG000063612.19.848e-14457.87SMESG000063612.1[more]
SMESG000024114.12.424e-10143.41SMESG000024114.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30013015 ID=SMED30013015|Name=Flotillin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1709bp
TAATTTTTAATTGTATTATTTAAATTAATTTTTCGAACAACTTTTCGTTT
TCTTAGTAGAACGAAATATAGACTTTGTTCTTCAAAATTTCTATATTTTC
AATATGCCATTTTGTACATGTGGTCCTAATGAAATTTTAGTTGTTTCTGG
TGTAGGCTATGATGAACCGCTAATGCTTAAAGGTGGAAGAAAATTTGTTT
TTCCTCCTTTTCAGAAAATTCAAAGATTAAGTCTTAATTTGATGACTATA
TTAGTCCATAGTCCTATAATATATACTAAACTTGGAATACCTTTGACTGC
AACTGGTGTTGCTCAGGTGAAAATTATTAGCAATATTGAGGAAAAACTAA
AAACGGCTTGTACTCTTTATCTGGAGATGAAACCAGAGAAAATTGCAGAT
ATTGCAAAAGAAACACTTGAAGGTCATCAAAGAGCAATTATGGGAAACAT
GACCGTTGAAGAGATATACATGGATAGAAAGAAATTTTCAAAGCACGTTT
TCGAAGTAGCTTCCTCAGATTTGGTTAACATGGGAATTAGTGTTGTCAGC
TACACATTGAAAGATATTCATGATGATGAAGGTTATTTAAAATCTTTGGG
CTTGGCCAGAACAGCTCAAGTCAAACGAGATGGAAGAATCGGAGAAGCTG
AGGCACAAAGAGATGCCGGAATTAAACAAGCTAAAGCCGAAGAAGCCCAA
GTGGCAAGTAAGTTAGCGAATGAAACTAAAATTGCCCAAGCACAAAGAGA
TTTCCAATTGAAAAAAGCTGAGTATGACAAAGAAATTGAAACGAAAAAAG
CTCAATCGCAATTATCGTACAATTTACAGGTTGCTGTCACCAAGCAACAA
ATAAAAGAAGAAGAAATGCAAATTAAAGTCGTGGAAAGAATTCAGCAAGT
AAAATTGCAAGAATTGGAAATTCAACGCAAGGATAAAGAATTAGAAGCCA
GAGTTCGAAAGCCTGCCGAAGCTGAAGCTTATCGATTGCAAAAAGTTGCG
GAAGCAGAAAAACTTAGAATAATAAAGGAAGCTGAAGGAGAGTCGGAAAC
AATTAGGTTAAATGGTGAAGCACGAGCTTTTGCGATAGAAGCCTTAGCTA
AGGCTGAAGCAGAGCAGTTGGAAAAGAAAGCCGAAGCTTGGAAAGATTAT
GGAAGTGCAGCAAAACTTGAAATGTTCCTCAACACTTTACCAAAACTAGC
TGCCGAAGTCGCTTCTCCGCTGTCCTCATGTCATAAGATTACAATGGTTT
CATCGGGTACAGGAGATTTGGGCGCCAATAAAATAACCGGAGAAGTAATT
AGCATAATGGAAACTTTACCGAATCTTGTTAAAGGAATGACTGGATTTGA
TATTGCCAAGAATATGACAGTCCGAGCTACTTAAGATTTCAAACAGAATT
TTCGATTTGTTTGACTAGATTATTATCGCAAATGTTGTTTTTCCCTGATC
TTCTAGTCAAAATGAGTATCTGAATAAATTTTATTATTAATTTTACTAAT
TTTTATATCGACTGTATTTTTATTAAATTCTTTAATATTTATTCATTTCG
TGATTTATTGAATCGTTTAGTTTTCACTCAATTCTTCACTGTTAATTATA
ATTTGTCGTTGTATGCAATTAACTGTTTTCTTATTTCAATGTAATTAACA
ATATATTTATCGAATTTTATACTATATCCTTTGTCATGAAATTATTATTA
AAAAAATTG
back to top

protein sequence of SMED30013015-orf-1

>SMED30013015-orf-1 ID=SMED30013015-orf-1|Name=SMED30013015-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=427bp
MPFCTCGPNEILVVSGVGYDEPLMLKGGRKFVFPPFQKIQRLSLNLMTIL
VHSPIIYTKLGIPLTATGVAQVKIISNIEEKLKTACTLYLEMKPEKIADI
AKETLEGHQRAIMGNMTVEEIYMDRKKFSKHVFEVASSDLVNMGISVVSY
TLKDIHDDEGYLKSLGLARTAQVKRDGRIGEAEAQRDAGIKQAKAEEAQV
ASKLANETKIAQAQRDFQLKKAEYDKEIETKKAQSQLSYNLQVAVTKQQI
KEEEMQIKVVERIQQVKLQELEIQRKDKELEARVRKPAEAEAYRLQKVAE
AEKLRIIKEAEGESETIRLNGEARAFAIEALAKAEAEQLEKKAEAWKDYG
SAAKLEMFLNTLPKLAAEVASPLSSCHKITMVSSGTGDLGANKITGEVIS
IMETLPNLVKGMTGFDIAKNMTVRAT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001765membrane raft assembly
GO:0001819positive regulation of cytokine production
GO:0001934positive regulation of protein phosphorylation
GO:0002090regulation of receptor internalization
GO:0007409axonogenesis
GO:0022617extracellular matrix disassembly
GO:0032092positive regulation of protein binding
GO:0032226positive regulation of synaptic transmission, dopaminergic
GO:0032728positive regulation of interferon-beta production
GO:0033227dsRNA transport
GO:0034116positive regulation of heterotypic cell-cell adhesion
GO:0034141positive regulation of toll-like receptor 3 signaling pathway
GO:0034976response to endoplasmic reticulum stress
GO:0035023regulation of Rho protein signal transduction
GO:0044854plasma membrane raft assembly
GO:0045807positive regulation of endocytosis
GO:0048643positive regulation of skeletal muscle tissue development
GO:0050821protein stabilization
GO:0051092positive regulation of NF-kappaB transcription factor activity
GO:0051580regulation of neurotransmitter uptake
GO:0060355positive regulation of cell adhesion molecule production
GO:0070528protein kinase C signaling
GO:0071360cellular response to exogenous dsRNA
GO:0072659protein localization to plasma membrane
GO:1901741positive regulation of myoblast fusion
GO:1901890positive regulation of cell junction assembly
GO:1903044protein localization to membrane raft
GO:2000049positive regulation of cell-cell adhesion mediated by cadherin
GO:0007275multicellular organism development
GO:0008150biological_process
Vocabulary: cellular component
TermDefinition
GO:0001931uropod
GO:0005768endosome
GO:0005769early endosome
GO:0005815microtubule organizing center
GO:0005911cell-cell junction
GO:0005912adherens junction
GO:0008180COP9 signalosome
GO:0009897external side of plasma membrane
GO:0016323basolateral plasma membrane
GO:0030027lamellipodium
GO:0030864cortical actin cytoskeleton
GO:0031410cytoplasmic vesicle
GO:0034451centriolar satellite
GO:0042383sarcolemma
GO:0042470melanosome
GO:0044291cell-cell contact zone
GO:0044853plasma membrane raft
GO:0045121membrane raft
GO:0098691dopaminergic synapse
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005901caveola
GO:0016020membrane
GO:0016600flotillin complex
Vocabulary: molecular function
TermDefinition
GO:0002020protease binding
GO:0005198structural molecule activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027705Flotillin_fam
IPR036013Band_7/SPFH_dom_sf
IPR001107Band_7
IPR031905Flotillin_C
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.479.30coord: 42..106
e-value: 1.5E-10
score: 43.3
NoneNo IPR availablePANTHERPTHR13806:SF16FLOTILLIN-1coord: 2..106
IPR027705Flotillin familyPANTHERPTHR13806FLOTILLIN-RELATEDcoord: 2..106
IPR036013Band 7/SPFH domain superfamilySUPERFAMILYSSF117892Band 7/SPFH domaincoord: 33..105