endoglycoceramidase

Overview
Nameendoglycoceramidase
Smed IDSMED30012991
Length (bp)1776
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of endoglycoceramidase (SMED30012991) t-SNE clustered cells

Violin plots show distribution of expression levels for endoglycoceramidase (SMED30012991) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of endoglycoceramidase (SMED30012991) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for endoglycoceramidase (SMED30012991) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012991

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30012991SMESG000030369.1 SMESG000030357.1 SMESG000030353.1 dd_Smed_v4_1570_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30012991SMESG000030369.1 SMESG000030357.1 SMESG000030353.1 dd_Smed_v4_1570_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30012991SMESG000030369.1 SMESG000030357.1 SMESG000030353.1 dd_Smed_v4_1570_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012991SMESG000030369.1 SMESG000030357.1 SMESG000030353.1 dd_Smed_v4_1570_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012991SMESG000030369.1 SMESG000030357.1 SMESG000030353.1 dd_Smed_v4_1570_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of endoglycoceramidase vs. UniProt/SwissProt
Match: sp|Q9GV16|EGCSE_CYANO (Endoglycoceramidase OS=Cyanea nozakii OX=135523 PE=1 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 3.594e-70
Identity = 158/475 (33.26%), Postives = 240/475 (50.53%), Query Frame = 3
Query:  300 SSFRIAVN-QKGQFIDNYNRILKFHGFNSVQKSYPW------YDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVN-----QFPEPEGNN-------KFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAI-NHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYW----------------DSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEIDLTI-SAPTEIFIPVTVHYVHGFVNETFP 1613
            +S  I+VN +  Q +D+  R   FHG N V K  P+      YD+   ++  +K+ ++ G N +RLG M  G  PT G +N+TY++I+Q IV K  +YG+++ +DMHQDVMS+K+   +G P W VN      FP P  +         +P+P D    ++W  YY T AA+  FQN Y N   + + W+ FWK  AQ F +  +V+GYELINEP+ G+ Y +  L++PG A   NL P YD++  AIRTVD    IF+E VT   +         GF++VPG    R++SVLSYHYY       +P             DF  K  FE   +++     G  L+E  L + D    + +  +   + +  +Q+ QS+  W                DS+  D  G +   V++   RTYP+A+ G  I Y F+  +  F LS+ +     S  + ++    +HY +G+    FP
Sbjct:   28 ASLLISVNPETQQLVDSLGRERFFHGTNVVVKHKPYHPSVEGYDNTSFSEVDMKILQDLGLNTIRLGMMLPGYVPTRGNYNETYLKIIQEIVSKAAKYGIYTLLDMHQDVMSAKFC-VEGFPDWAVNTGNADNFPFPLEDKYPLNLQTGYPYPKDC-AKHAWGDYYFTEAAAAAFQNFYNNTDGLLDAWADFWKKTAQGFKDYKSVIGYELINEPFAGDIYRDPSLMIPGVADERNLAPAYDVIHKAIRTVDEQHSIFFEGVTWDYF-------AAGFSKVPGGDAYRNRSVLSYHYY-------EP------------PDFNKKFQFEVRMEDLRRLKCGGFLTEL-LTVGD---TAKDMSDMLELFDICDQHKQSWMGWLYKSYGCYKQHLGCLTDSM-HDETGHLRDIVLQNTTRTYPQAVAGHTIGYKFDRITKKFDLSFVVTADCRSTESIVYFNKDLHYSNGYDVTVFP 469          
BLAST of endoglycoceramidase vs. UniProt/SwissProt
Match: sp|Q6L6S1|EGCSE_HYDVU (Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.016e-64
Identity = 162/508 (31.89%), Postives = 248/508 (48.82%), Query Frame = 3
Query:  312 IAVN-QKGQFIDNYNRILKFHGFNSVQKSYPW------YDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVN-----QFPEP-------EGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAI-NHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNV--------------VKMFARTYPRALQGQPIKYSFNMTSGYFQLSYE-IDLTISAPTEIFIPVTVHYVHGF---VNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRPLSL 1721
            I+VN +    ID Y R   FHG N V K +P+      ++    ++  +K+ +++G N +RLG M  G  P   ++N+TYI+++Q+IV    +YG+++ +DMHQDV S K+   +G+P W+VN      FP P       +    +P+P D    +SWA YY T AA   FQNLY N   + + W+ FWK  A  F    +V+GYELINEP+ GN +++  LL+PG A   NL P YD L  AIR VD +  IF+E VT   +         GF  VPG    +++SVLSYHYY       +P             DF  K  FE+   ++     G  L+E      D N +         + +  +++ QS   W    + S G I  N+              +   +RTYP+A+ G+   Y+F++ +  F L YE +    S  T ++    +HY +G+   +N  F + P+    EN  F  + +     + +VT  + PLS 
Sbjct:   23 ISVNPETNMLIDGYGRERFFHGTNVVVKHFPFHPETTGFNKDTFSEDDMKILQKFGLNSIRLGMMLPGYVPKREEYNETYIKVIQSIVTTAAKYGIYTLLDMHQDVFSPKFC-VEGMPDWIVNTQGAKDFPMPLHKPFNLDPKTGYPYPEDC-AKFSWADYYFTEAAGQAFQNLYDNVDGLRDEWAQFWKKTADVFKEEPSVIGYELINEPFCGNVFKHPTLLIPGVADYLNLQPTYDALQKAIRQVDEEHNIFFEGVTWDFF-------EVGFTEVPGGKQYQNRSVLSYHYY-------EP------------PDFSKKLNFEARLLDLKRLKCGGFLTEMFTVGTDFNSMF-------EMFDLCDKFKQS---WHGWMYKSYGCIEQNLGCLNMSSPGKESIQIANTSRTYPQAVAGRTQSYAFDIKTKVFTLVYETVGSCKSGRTIVYFNKNLHYPNGYRYEINPNFKVTPS----ENEYFLYLDEVNKVPNTVVTFKLFPLSF 488          
BLAST of endoglycoceramidase vs. TrEMBL
Match: A0A1S3K9X1 (endoglycoceramidase OS=Lingula unguis OX=7574 GN=LOC106179962 PE=3 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 1.489e-136
Identity = 219/471 (46.50%), Postives = 286/471 (60.72%), Query Frame = 3
Query:  309 RIAVNQKGQFIDNYNRILKFHGFNSVQKSYPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPI-AINHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPST-GNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPTHFD-KENFIFSVMADGKSKQHEIVTVIIRP 1712
            +I+VN  G F+D   R++ FHG N VQK +PWY + +LN T+L+ YK WGFN VRLG MWSG+EP EG FN TY  I+ +IV  L  YGM+S +DMHQDVMSSK+  YDGIPLWLVN+ P P  +  FP P       SW   Y+  A    FQ LY N   A+ ++S FW+  A+ F     V+GYELINEPW G+ + N+ LLLPG AG  NL+P+Y+++  AIR VD+DT+IFYEPVT G  Y +   + GTGFN VPG  + +++S LSYHYYC+          Y    +I C DF+   VF +   +  + GGGS L+EFG+C  DGN  +  T ECE+ ++  +   QS+TYWDS F+ SNG +  N V+ F+R YPRA  G P   +FN+TS  F   Y   + I  PTEIF+P   HY  GF  E    +   FD  E  I+    D K K +    VII+P
Sbjct:   30 KISVNADGWFVDPNGRVMLFHGINMVQKGFPWYPATLLNKTKLRDYKNWGFNAVRLGMMWSGLEPQEGVFNTTYANIMSSIVDTLENYGMYSLLDMHQDVMSSKFQSYDGIPLWLVNKLPNPSQDEAFPWPF--KNIGSWEDGYLAKATGMAFQGLYSNRSNALGYFSRFWQTTAKIFKGRGGVLGYELINEPWAGDIWSNLSLLLPGNAGSRNLMPMYNVINKAIRAVDDDTIIFYEPVTWGVIYKNDYHHFGTGFNMVPGGNDYKNRSALSYHYYCWFDKPADEPFPYPEWKRIACDDFWGPFVFLAVRGDREKIGGGSFLTEFGICSTDGNNKTEGTVECESTMQGADAALQSWTYWDSSFYYSNGSVNWNQVRSFSRVYPRATAGTPKYLNFNLTSLIFTYRYVHLVAIQQPTEIFVP-KFHYPKGFTVELKGQLKWTFDINECVIYVTPVDSKLK-YINAQVIIKP 496          
BLAST of endoglycoceramidase vs. TrEMBL
Match: R7VMA9 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_95004 PE=3 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 3.540e-136
Identity = 219/480 (45.62%), Postives = 294/480 (61.25%), Query Frame = 3
Query:  282 CAEPKTSSFRIAVNQKGQFI-DNYNRILKFHGFNSVQKSYPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIA-INHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEIDLTISAPTEIFIPVTVHYVHGF-VNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRP 1712
            C   ++ SF +    +  FI DN  R   F GFN+VQK  PW+ S +LND++L  Y+ WGFN VRLG MWSG+EP EG  N +YI+++Q IV KL + GMF  +DMHQDV+SS +  YDGIPLWL+ +   P   ++FP PL      SWA  Y+T A    FQ +Y N    ++ +  FW+++   F +   V+GYELINEPW G+ + +  LLLP +AGR NL P YDIL  AIR +DN+ LIFYEPVT G +     + GTGF  VPG   Q+ KSVLSYHYYC+LLNS  P +N     +  C     + VF +  + +   GGG  L+EFGLC PDG+P S  T+ECE VL++ +   QS+TYWDS FF+SNG     VV+ F+R YP A+ G+P+  SF + +G F  ++  D TI+A TEIFIP  +HY HG  VN T P +   FD       V  +  ++   + T+I+ P
Sbjct:   18 CCLTRSESFDV----RDHFIQDNAGRTRVFRGFNAVQKGAPWFPSHLLNDSQLDFYQAWGFNAVRLGVMWSGLEPIEGHINASYIKVMQNIVSKLGERGMFVILDMHQDVLSSAFQTYDGIPLWLLEKL--PPSPHQFPWPLAPFPQSSWALGYLTQATGRAFQGIYNNEAGTLDCFVKFWEIVVTHFRSFENVLGYELINEPWAGDIFTDPSLLLPAEAGRRNLQPFYDILSRAIRALDNEKLIFYEPVTWGVFLNGQYS-GTGFTSVPGGSKQQSKSVLSYHYYCWLLNS--PATNSGGLTRDFCDQVLGRAVFRTVQEEVKNLGGGIFLTEFGLCEPDGDPASEGTRECEFVLQQADDNLQSWTYWDSKFFNSNGDPRLEVVRPFSRPYPVAVAGKPMSMSFVIDTGRFNFTFLCDPTINAATEIFIP-KLHYPHGITVNVTPPRVAWKFDPARSFLKV--EPCARDVIMATLIVSP 485          
BLAST of endoglycoceramidase vs. TrEMBL
Match: A0A2H1CEZ1 (Cellulase OS=Fasciola hepatica OX=6192 GN=D915_004368 PE=3 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 1.330e-132
Identity = 204/450 (45.33%), Postives = 281/450 (62.44%), Query Frame = 3
Query:  291 PKTSSFRIAVNQKGQFIDNYNRILKFHGFNSVQKSYPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKN-PIAINHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYP-STGNLGTGFNRVPGRLNQR---DKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEID---LTISA-PTEIFIPVTVHYVHGFVNETFP 1613
            P  +  ++ +N+ GQF+    +IL FHGFNSVQK  PWYD Q+ N T+L++++ WG N+VRLG MW GV P +G  ++ Y+  ++ IV    ++G++  +DMHQDV+S+++  Y+GIP WLV++ P+P  +  +P P        W   Y+TYA  +  + LY N   A  HW  FW+V+AQ F     V+GYELINEP   NFYEN E LLPG  G  +LLP YD LV+ IR VD+DTLIFYEP+T G + P S  + GTGFNRVPG L      +KSVLSYHYYC+LL +  P       +K+IC    M +VF ++ ++I  TGGG  L+EFGLC PDGNP SINT EC+A++ K ++ +QS+ YWD  F D  G  +   V+ F R YP+  +G P +  F+  +G F+ S+E+D   LT+     EIF+P  V Y  G V    P
Sbjct:   18 PSQALDKVRLNKDGQFVGANGQILLFHGFNSVQKGPPWYDRQMKNRTQLQMFQSWGVNVVRLGIMWPGVMPNKGIVSEEYLGHIREIVESCQEFGIYVLLDMHQDVLSTRFGTYEGIPTWLVDELPKPRASRAYPWPFSAPPA-QWFENYLTYACVNCAEQLYTNVSGAWEHWGQFWEVVAQRFGKYPNVIGYELINEPPMSNFYENPERLLPGYVGLHHLLPTYDYLVNRIRAVDSDTLIFYEPLTYGVFLPDSILDTGTGFNRVPGLLQDHKAAEKSVLSYHYYCWLLQTADPARAMHWWEKVICDHGLMPSVFANSRRSIERTGGGRFLTEFGLCGPDGNPHSINTVECDALMIKADEEFQSWMYWDGNFLDRVGNPIETQVRFFVRPYPKTTRGSPDRLRFDPKTGEFRYSFELDTSKLTVEQLVAEIFVPNQVQYTTGAVVRVTP 466          
BLAST of endoglycoceramidase vs. TrEMBL
Match: A0A504Y582 (Glycoside hydrolase subgroup catalytic core OS=Fasciola gigantica OX=46835 GN=FGIG_06797 PE=3 SV=1)

HSP 1 Score: 405.601 bits (1041), Expect = 2.930e-132
Identity = 203/450 (45.11%), Postives = 282/450 (62.67%), Query Frame = 3
Query:  291 PKTSSFRIAVNQKGQFIDNYNRILKFHGFNSVQKSYPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKN-PIAINHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYP-STGNLGTGFNRVPGRLNQR---DKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEID---LTISA-PTEIFIPVTVHYVHGFVNETFP 1613
            P  +  ++ +N+ GQF+    +IL FHGFNSVQK  PWYD Q+ N T+L++++ WG N+VRLG MW GV P +G  ++ Y+  ++ IV    ++G++  +DMHQDV+S+++  Y+GIP WLV++ P+P  +  +P P        W   Y+TYA  +  + LY N   A  HW  FW+V+AQ F     V+GYELINEP   NFYEN E LLPG  G  +LLP YD LV+ IR VD+DTLIFYEP+T G + P S  + GTGF+RVPG L      +KSVLSYHYYC+LL +  P+      +K+IC    M +VF ++ ++I  TGGG  L+EFGLC PDGNP SINT EC+A++ K ++ +QS+ YWD  F D  G  +   V+ F R YP+  +G P +  F+  +G F+ S+E+D   LT+     EIF+P  V Y  G V    P
Sbjct:   18 PSQALDKVRLNKDGQFVGENGQILLFHGFNSVQKGPPWYDRQMKNRTQLQMFQSWGVNVVRLGIMWPGVMPNKGIVSEEYLGHIREIVESCQEFGIYVLLDMHQDVLSTRFGSYEGIPTWLVDELPKPRASRAYPWPFSAPPA-QWFENYLTYACVNCAEQLYTNVSGAWEHWGQFWEVVAQRFGKYPNVIGYELINEPPMSNFYENPERLLPGYVGLHHLLPTYDYLVNRIRAVDSDTLIFYEPLTYGVFLPDSILDTGTGFSRVPGLLQDHKAAEKSVLSYHYYCWLLQTADPSRAMHWWEKVICDHGLMPSVFANSRRSIERTGGGRFLTEFGLCGPDGNPHSINTVECDALMIKADEEFQSWMYWDGNFLDRVGNPIETQVRFFVRPYPKTTRGSPDRLRFDPKTGEFRYSFELDTSKLTVEQLVAEIFVPNQVQYTTGAVVRVTP 466          
BLAST of endoglycoceramidase vs. TrEMBL
Match: A0A267DVP4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021510g1 PE=3 SV=1)

HSP 1 Score: 398.667 bits (1023), Expect = 1.533e-129
Identity = 201/432 (46.53%), Postives = 275/432 (63.66%), Query Frame = 3
Query:  303 SFRIAVNQKGQFIDNYNRILKFHGFNSVQKSYPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPI-AINHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPS-DKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEIDLTISAPTEIFIPVTVHYVHG 1592
            + +I+VN +GQF+D + R+  FHG NSV K  PWY  Q+LN +RL+ Y++WGFN VRLGTMW+GV+P +   N TY+ +L  IV  L ++GM+S MDMHQDV++SKY  YDG+P WLV+ FP P     +P P     +  WA  YIT+A    FQ LYKN   ++ HW+ FW+ +A +   +  V+GYELINEPW G+ Y    LLLPG AGR+NLLPVYD L   +   D   ++FYEPVT       TG+ GTGF+R+PG     ++S LSYHYYC++++   P     P   ++ C    +    E+A +    TGGG  L+EFGLC P G   +  T EC  VL++T++  QS+TYWDS F  ++G    +VV+ FAR YP A  GQP+ YSFN+TSG F  +Y+ D  + APT +F+P++VHY  G
Sbjct:   26 AHKISVNSRGQFVDGFGRVRIFHGINSVLKQPPWYPDQMLNASRLRAYQDWGFNAVRLGTMWAGVQPRKDAVNATYLAVLSKIVTTLAEHGMYSIMDMHQDVLTSKYGSYDGVPRWLVDSFPPPPQPYPWPLPGPPTPS-QWAEGYITWAVGSAFQYLYKNESGSLTHWANFWRSVASAVRTSDHVLGYELINEPWAGDVYNRPALLLPGVAGRDNLLPVYDYLTQVLAKEDPSRIVFYEPVTWSLVVGGTGSGGTGFDRLPGGPANANRSALSYHYYCWIVS---PGDGIYPLWKRLACDALLLTRNLENAKEATAATGGGRFLTEFGLCAPTGQANATGTIECNEVLQRTDEEQQSWTYWDSNFTRADGSWNWDVVRSFARAYPMATAGQPVSYSFNLTSGRFDFAYQPDPKVRAPTVVFLPMSVHYPSG 453          
BLAST of endoglycoceramidase vs. Ensembl Nematostella
Match: EDO30535 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0I2])

HSP 1 Score: 233.802 bits (595), Expect = 2.636e-70
Identity = 153/438 (34.93%), Postives = 222/438 (50.68%), Query Frame = 3
Query:  312 IAVNQKGQ-FIDNYNRILKFHGFNSVQKSYPWYDS------QILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVN-----QFPEP-----EGNNKFPHPLDINTT-YSWATYYITYAASDGFQNLYKNPIAI-NHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWD-SIFFDSNGKILPNVVKMF-------------ARTYPRALQGQPIKYSFNMTSGYFQLSYE 1526
            I+V+   Q F+D   R   FHG N V K +PW+           ++  ++L +  G N++RLG MW GVEPT G++N+TYI +++ IV    +YG++  +DMHQDVMS K+   +G P W  N      FPEP     + + K  +P D +   + WA+YY T AAS  FQNLY N   + + W+ FW   A +F +  +V+GYELINEPW G+ Y +  L++P  A R NL P Y++L  AIR+ D+   IF+EPVT   Y       G GF  VPG    +++SVLSYHYY        P+    P          ++  F+    ++     G +L+EF          S + Q C   +   +QY QS+  W    ++ SN K    V  ++              RTYP A+ G  I +++N  S  F L YE
Sbjct:   27 ISVDPATQRFVDPDGRERFFHGSNVVVKHFPWHPELEGFAPGTFSEQDMELMQSLGLNVLRLGYMWPGVEPTRGKYNETYIEVIKKIVTLSAKYGIYVLLDMHQDVMSRKFC-VEGFPNWAANPGNARNFPEPLHAPYKIDPKTGYPSDEDCAKFPWASYYATEAASVAFQNLYNNTDGLRDSWAAFWAKAALTFRDFPSVIGYELINEPWSGDIYSDPLLMVPKMADRMNLAPAYEVLAKAIRSHDDQKCIFFEPVTWDDY-------GVGFESVPGGEKYKNRSVLSYHYYHL------PDGPSGP----------VELNFKVRDNDLKRLQCGGMLTEFQAS-------SGDLQSCLKTMATADQYLQSWMGWIYKPYYPSNKKAPYKVAALWDEDGLNDVWVENTCRTYPHAVAGHTIAFNYNPVSLEFSLQYE 433          
BLAST of endoglycoceramidase vs. Ensembl Nematostella
Match: EDO44690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV54])

HSP 1 Score: 230.335 bits (586), Expect = 1.071e-68
Identity = 151/438 (34.47%), Postives = 221/438 (50.46%), Query Frame = 3
Query:  312 IAVNQKGQ-FIDNYNRILKFHGFNSVQKSYPWYDS------QILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVN-----QFPEP-----EGNNKFPHPLDINTT-YSWATYYITYAASDGFQNLYKNPIAI-NHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWD-SIFFDSNGKILPNVVKMF-------------ARTYPRALQGQPIKYSFNMTSGYFQLSYE 1526
            I+V+   Q F+D   R   FHG N V K +PW+           ++  ++L +  G N++RLG MW GVEPT G++N+TYI +++ IV    +YG++  +DMHQDVMS K+   +G P W  N      FPEP     + + K  +P D +   + WA+YY T AAS  FQNLY N   + + W+ FW   A +F +  +V+GYELINEPW G+ Y +  L++P  A R NL P Y++L  AIR+ D+    F+EPVT   Y       G GF  VPG    +++SVLSYHYY        P+    P          ++  F+    ++     G +L+EF          S + Q C   +   +QY QS+  W    ++ SN K    V  ++              RTYP A+ G  I ++++  S  F L YE
Sbjct:   27 ISVDPATQRFVDPDGRERFFHGSNVVVKHFPWHPELEGFAPGTFSEQDMELMQSLGLNVLRLGYMWPGVEPTRGKYNETYIEVIKKIVTLSAKYGIYVLLDMHQDVMSRKFC-VEGFPNWAANPGNARNFPEPLHAPYKIDPKTGYPSDEDCAKFPWASYYATEAASVAFQNLYNNTDGLRDSWAAFWAKAALTFRDFPSVIGYELINEPWSGDIYSDPLLMVPKMADRMNLAPAYEVLAKAIRSHDDQKCAFFEPVTWDDY-------GVGFESVPGGEKYKNRSVLSYHYYHL------PDGPSGP----------VELNFKVRDNDLKRLQCGGMLTEFQAS-------SGDLQSCLKTMATADQYLQSWMGWIYKPYYPSNKKAPYKVAALWDEDGLNDVWVENTCRTYPHAVAGHTIAFNYDPISLEFSLQYE 433          
BLAST of endoglycoceramidase vs. Planmine SMEST
Match: SMESG000030353.1 (SMESG000030353.1)

HSP 1 Score: 1003.43 bits (2593), Expect = 0.000e+0
Identity = 495/499 (99.20%), Postives = 496/499 (99.40%), Query Frame = 3
Query:  225 MKSKWIHXXXXXXXXXXXXCAEPKTSSFRIAVNQKGQFIDNYNRILKFHGFNSVQKSYPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRPLSL 1721
            MKSKWIHLLFII FLSMSSCAEPKTSSFRIAVNQKGQFIDNYNRILKFHGFNSVQKS+PWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNP SINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQL YEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRPLSL
Sbjct:    1 MKSKWIHLLFIIPFLSMSSCAEPKTSSFRIAVNQKGQFIDNYNRILKFHGFNSVQKSFPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPFSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLFYEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRPLSL 499          
BLAST of endoglycoceramidase vs. Planmine SMEST
Match: SMESG000030353.1 (SMESG000030353.1)

HSP 1 Score: 993.03 bits (2566), Expect = 0.000e+0
Identity = 477/480 (99.38%), Postives = 478/480 (99.58%), Query Frame = 3
Query:  282 CAEPKTSSFRIAVNQKGQFIDNYNRILKFHGFNSVQKSYPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRPLSL 1721
            CAEPKTSSFRIAVNQKGQFIDNYNRILKFHGFNSVQKS+PWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNP SINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQL YEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRPLSL
Sbjct:    4 CAEPKTSSFRIAVNQKGQFIDNYNRILKFHGFNSVQKSFPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPFSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLFYEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRPLSL 483          
BLAST of endoglycoceramidase vs. Planmine SMEST
Match: SMESG000030369.1 (SMESG000030369.1)

HSP 1 Score: 956.436 bits (2471), Expect = 0.000e+0
Identity = 461/473 (97.46%), Postives = 465/473 (98.31%), Query Frame = 3
Query:  300 SSFRIAVNQKGQFIDNYNRILKFHGFNSVQKSYPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRPLS 1718
            S +RIAVNQKGQFIDNYNRILKFHGFNSV+K +PWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKY+  DGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKVIAQSFVNNTAVMGYELINEPW GNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYF LSYEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPT FDKENFIFSVMADGKSKQHEIVTVII PLS
Sbjct:   24 SQYRIAVNQKGQFIDNYNRILKFHGFNSVKKIFPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYNGNDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKVIAQSFVNNTAVMGYELINEPWLGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFLLSYEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPTRFDKENFIFSVMADGKSKQHEIVTVIIIPLS 496          
BLAST of endoglycoceramidase vs. Planmine SMEST
Match: SMESG000030357.1 (SMESG000030357.1)

HSP 1 Score: 911.368 bits (2354), Expect = 0.000e+0
Identity = 438/447 (97.99%), Postives = 442/447 (98.88%), Query Frame = 3
Query:  381 SVQKSYPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKVIAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRPLSL 1721
            ++ KS+PWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKY+  DGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKVIAQSFVNNTAVMGYELINEPW GNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNP SINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRPLSL
Sbjct:    4 TLSKSFPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQTYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYNGNDGIPLWLVNQFPEPEGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKVIAQSFVNNTAVMGYELINEPWLGNFYENMELLLPGKAGRENLLPVYDILVDAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSYHYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLSEFGLCIPDGNPFSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPNVVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEIDLTISAPTEIFIPVTVHYVHGFVNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRPLSL 450          
The following BLAST results are available for this feature:
BLAST of endoglycoceramidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endoglycoceramidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endoglycoceramidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endoglycoceramidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endoglycoceramidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endoglycoceramidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endoglycoceramidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9GV16|EGCSE_CYANO3.594e-7033.26Endoglycoceramidase OS=Cyanea nozakii OX=135523 PE... [more]
sp|Q6L6S1|EGCSE_HYDVU1.016e-6431.89Endoglycoceramidase OS=Hydra vulgaris OX=6087 PE=1... [more]
back to top
BLAST of endoglycoceramidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K9X11.489e-13646.50endoglycoceramidase OS=Lingula unguis OX=7574 GN=L... [more]
R7VMA93.540e-13645.63Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2H1CEZ11.330e-13245.33Cellulase OS=Fasciola hepatica OX=6192 GN=D915_004... [more]
A0A504Y5822.930e-13245.11Glycoside hydrolase subgroup catalytic core OS=Fas... [more]
A0A267DVP41.533e-12946.53Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of endoglycoceramidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endoglycoceramidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endoglycoceramidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endoglycoceramidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO305352.636e-7034.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446901.071e-6834.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of endoglycoceramidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endoglycoceramidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000030353.10.000e+099.20SMESG000030353.1[more]
SMESG000030353.10.000e+099.38SMESG000030353.1[more]
SMESG000030369.10.000e+097.46SMESG000030369.1[more]
SMESG000030357.10.000e+097.99SMESG000030357.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012991 ID=SMED30012991|Name=endoglycoceramidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1776bp
TCATAATCATTATTCCAAATCTACCAAAAATGTATCGTAGTTATTCTGTG
TCACCTTATCACACCCATTTAAAATGACATTCACAACTGACCTGGATCTA
AGAGCCTTGAATGTGATTAAAGGAAGTACAATGATCCGCATTAAGTGCTT
CAAATAATTAGCTGATCAATCATGTGATGCTGATATAAATAATAAAATTC
ATTAGATGTATTTTAATACAAGCGATGAAATCAAAATGGATTCATCTTTT
ATTTATTATTTCATTCCTTTCAATGAGCTCATGCGCTGAGCCTAAAACTT
CCTCGTTTCGAATAGCAGTGAACCAGAAAGGACAATTCATAGACAATTAT
AATAGAATTCTGAAGTTTCATGGATTTAACTCTGTTCAGAAAAGTTACCC
GTGGTATGACAGCCAAATACTGAATGATACCAGGCTAAAGTTATACAAGG
AATGGGGATTCAATCTCGTCAGATTGGGAACGATGTGGTCCGGAGTTGAA
CCAACCGAAGGACAGTTCAATCAGACTTATATTAGAATTTTGCAAACAAT
TGTTGGTAAATTGAACCAATATGGAATGTTCAGCTTCATGGATATGCATC
AAGACGTCATGTCAAGCAAATATAGTGAATATGATGGTATACCTTTATGG
TTGGTTAACCAGTTTCCTGAACCTGAAGGTAATAACAAATTCCCTCATCC
TCTCGACATAAATACCACTTATTCATGGGCAACCTATTATATAACTTATG
CAGCGTCAGATGGTTTCCAAAATCTGTATAAAAACCCGATTGCAATCAAC
CATTGGAGTACATTTTGGAAAGTCATAGCTCAGTCATTCGTGAATAACAC
GGCGGTTATGGGGTATGAGTTGATAAATGAGCCTTGGTTTGGTAACTTCT
ATGAGAATATGGAATTACTTTTACCAGGTAAGGCCGGCAGGGAGAACCTT
TTGCCAGTCTATGACATACTTGTAGATGCAATTAGAACAGTTGATAATGA
CACCCTGATATTCTATGAACCAGTGACTATTGGGGCGTACTATCCGAGCA
CTGGAAATCTCGGAACTGGATTCAACCGAGTTCCTGGTCGACTTAACCAA
CGAGATAAATCAGTTCTTTCCTATCACTATTACTGTTTCCTATTGAATAG
TTTACAACCAAATTCAAATTATTCACCATCGGATAAAATTATTTGCCAGG
ACTTTTTTATGAAGAATGTTTTTGAATCGGCCGCGAAAAACATAAACGAA
ACAGGGGGAGGATCCCTATTATCAGAATTTGGGTTATGCATTCCTGATGG
CAACCCTCTCTCCATCAATACTCAAGAATGCGAGGCAGTCTTGGAGAAAA
CCGAACAATATTATCAAAGTTTCACATATTGGGATTCGATTTTCTTCGAT
TCTAACGGAAAGATTCTTCCAAATGTTGTCAAAATGTTCGCCAGGACATA
TCCGAGAGCCTTACAAGGTCAACCAATCAAATACTCGTTCAACATGACCT
CTGGCTATTTTCAATTATCCTATGAAATAGACTTAACAATCTCTGCGCCA
ACCGAGATATTCATTCCGGTTACGGTTCATTACGTCCACGGATTCGTCAA
TGAAACCTTTCCTATTATGCCGACCCACTTTGACAAGGAGAATTTTATAT
TTTCCGTAATGGCGGATGGAAAATCGAAACAACATGAAATAGTTACAGTC
ATAATTAGACCTCTTTCATTGTAGTTGTCATGGGGATTTTCAATTATATA
TAAATATATATATATATATATATATA
back to top

protein sequence of SMED30012991-orf-1

>SMED30012991-orf-1 ID=SMED30012991-orf-1|Name=SMED30012991-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=500bp
MKSKWIHLLFIISFLSMSSCAEPKTSSFRIAVNQKGQFIDNYNRILKFHG
FNSVQKSYPWYDSQILNDTRLKLYKEWGFNLVRLGTMWSGVEPTEGQFNQ
TYIRILQTIVGKLNQYGMFSFMDMHQDVMSSKYSEYDGIPLWLVNQFPEP
EGNNKFPHPLDINTTYSWATYYITYAASDGFQNLYKNPIAINHWSTFWKV
IAQSFVNNTAVMGYELINEPWFGNFYENMELLLPGKAGRENLLPVYDILV
DAIRTVDNDTLIFYEPVTIGAYYPSTGNLGTGFNRVPGRLNQRDKSVLSY
HYYCFLLNSLQPNSNYSPSDKIICQDFFMKNVFESAAKNINETGGGSLLS
EFGLCIPDGNPLSINTQECEAVLEKTEQYYQSFTYWDSIFFDSNGKILPN
VVKMFARTYPRALQGQPIKYSFNMTSGYFQLSYEIDLTISAPTEIFIPVT
VHYVHGFVNETFPIMPTHFDKENFIFSVMADGKSKQHEIVTVIIRPLSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041036GH5_C
IPR013780Glyco_hydro_b
IPR013781Glyco_hydro_catalytic_dom
IPR001547Glyco_hydro_5
IPR017853Glycoside_hydrolase_SF
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.20.20.80coord: 48..416
e-value: 8.3E-80
score: 270.9
NoneNo IPR availablePANTHERPTHR31308:SF3coord: 28..495
NoneNo IPR availablePANTHERPTHR31308FAMILY NOT NAMEDcoord: 28..495
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..20
score: 6.0
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.839
IPR041036Glycoside hydrolase family 5 C-terminal domainPFAMPF18564Glyco_hydro_5_Ccoord: 407..489
e-value: 8.0E-11
score: 42.3
IPR013780Glycosyl hydrolase, all-betaGENE3DG3DSA:2.60.40.1180coord: 39..456
e-value: 8.3E-80
score: 270.9
IPR001547Glycoside hydrolase, family 5PFAMPF00150Cellulasecoord: 52..388
e-value: 1.9E-29
score: 103.0
IPR017853Glycoside hydrolase superfamilySUPERFAMILYSSF51445(Trans)glycosidasescoord: 2..394