Protein FAM188B

Overview
NameProtein FAM188B
Smed IDSMED30012985
Length (bp)2199
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein FAM188B (SMED30012985) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein FAM188B (SMED30012985) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein FAM188B (SMED30012985) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein FAM188B (SMED30012985) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012985

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012985SMESG000064698.1 SmedASXL_016172SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30012985SMESG000064698.1 dd_Smed_v4_13105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30012985SMESG000064698.1 dd_Smed_v4_13105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012985SMESG000064698.1 dd_Smed_v4_13105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30012985SMESG000064698.1 dd_Smed_v4_13105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30012985SMESG000064698.1 dd_Smed_v6_13105_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
whole organismSMED30012985SMESG000064698.1 Contig18512newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30012985SMESG000064698.1 Contig18512uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30012985SMESG000064698.1 Contig38731newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30012985SMESG000064698.1 Contig38731uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30012985SMESG000064698.1 dd_Smed_v4_13105_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein FAM188B vs. Ensembl Human
Match: MINDY4 (MINDY lysine 48 deubiquitinase 4 [Source:HGNC Symbol;Acc:HGNC:21916])

HSP 1 Score: 149.443 bits (376), Expect = 7.972e-37
Identity = 105/356 (29.49%), Postives = 172/356 (48.31%), Query Frame = 1
Query:  874 DESIEFNSVIKP----MKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXXXXXXXXXXRC----------RISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQF-TDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASST 1896
            DE I    ++ P    +K   +S  I   +A ++K LLF S+   +  EW  Q+F F S    + +GI+Q   GP  V+AA+Q  VL + LF  D   +    ++ + +            RC          R        + L   + +    G  K DG+ E L ++ +   E L  F+   I+QF   P   G ILL +S +++      + +    T  LI   G  + EL++LL+ G   S+ FN+ +E+ DS    +++L GI+ RS IG+L+L  H   CQ +G +LKTP++P+W+V     ++ ++F     L+ DW++E  F LY Y  L   ++ I +TID + T
Sbjct:  382 DELIREEVILSPVPSVLKLQTASKPIDLSVAKEIKTLLFGSSFCCFNEEWKLQSFSF-SNTASLKYGIVQNKGGPCGVLAAVQGCVLQKLLFEGDSKADCAQGLQPSDAHRT---------RCLVLALADIVWRAGGRERAVVALASRTQQFSPTGKYKADGVLETLTLHSLTCYEDLVTFLQQSIHQFEVGPY--GCILLTLSAILSRSTELIRQDFDVPTSHLIGAHGYCTQELVNLLLTGKAVSNVFNDVVEL-DSGDGNITLLRGIAARSDIGFLSLFEHYNMCQ-VGCFLKTPRFPIWVV-CSESHFSILFSLQPGLLRDWRTERLFDLYYYDGLANQQEQIRLTIDTTQT 722          
BLAST of Protein FAM188B vs. Ensembl Human
Match: MINDY4B (MINDY family member 4B [Source:HGNC Symbol;Acc:HGNC:35475])

HSP 1 Score: 125.946 bits (315), Expect = 3.762e-30
Identity = 92/327 (28.13%), Postives = 146/327 (44.65%), Query Frame = 1
Query:  937 ITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLF--RSDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLG---VSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHC---EYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASS 1893
            I+  MA  L+ +LF +T   +   W K  F FH  ++E+ F +     G  ++  A+Q  ++   LF  +              K +  +LA +          +    ICL+       S      D  TE L ++E  +KE  +KFI  H+  F      G+IL + S + +      + +L   T +L+ P     +    ++++++ G  S + FN   E           LHG+  RS +GYL         +   Q+G+ LKTPK P+WL    N NY ++FC N+ L+SDWK E  F LY YS     +KL+ +TID  S
Sbjct:   97 ISLAMATKLRQILFGNTVHVFSYNWKKAYFRFHDPSSELAFTLEVGKGGARSIQMAVQGSIIKYLLFTRKGKDCNLGNLCEISKKEQEQALAAALAGILWAAGAAQKATICLVTEDIYVASTPDYSVDNFTERLQLFEFLEKEAAEKFIYDHLLCFRGEGSHGVILFLYSLIFSRTFERLQMDLDVTTTQLLQPNAGGFLCRQAVLNMILTGRASPNVFNGCEE-----GKSQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCN-INGNYSILFCTNRQLLSDWKMERLFDLYFYSGQPSQKKLVRLTIDTHS 417          
BLAST of Protein FAM188B vs. Ensembl Human
Match: AC004691.2 (novel protein, MINDY4 and AQP1 readthrough)

HSP 1 Score: 107.457 bits (267), Expect = 4.713e-24
Identity = 64/196 (32.65%), Postives = 109/196 (55.61%), Query Frame = 1
Query: 1324 ECLVIYEIFDKEHLKKFILHHINQF-TDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKN 1908
            E L ++ +   E L  F+   I+QF   P   G ILL +S +++      + +    T  LI   G  + EL++LL+ G   S+ FN+ +E+ DS    +++L GI+ RS IG+L+L  H   CQ +G +LKTP++P+W+V     ++ ++F     L+ DW++E  F LY Y  L   ++ I +TID + T +++
Sbjct:    2 ETLTLHSLTCYEDLVTFLQQSIHQFEVGPY--GCILLTLSAILSRSTELIRQDFDVPTSHLIGAHGYCTQELVNLLLTGKAVSNVFNDVVEL-DSGDGNITLLRGIAARSDIGFLSLFEHYNMCQ-VGCFLKTPRFPIWVV-CSESHFSILFSLQPGLLRDWRTERLFDLYYYDGLANQQEQIRLTIDTTQTISED 192          
BLAST of Protein FAM188B vs. Ensembl Human
Match: MINDY3 (MINDY lysine 48 deubiquitinase 3 [Source:HGNC Symbol;Acc:HGNC:23578])

HSP 1 Score: 80.4925 bits (197), Expect = 6.079e-17
Identity = 43/129 (33.33%), Postives = 80/129 (62.02%), Query Frame = 1
Query: 1417 GLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            G++L + S L+T G+ N KNE+ + +  LI+P+ G  S  L++LL+ GH  S+ ++      D   + + +L GI +++++G+LTL     YC ++G+YLK+PK+P+W+V     +  V F  + +L++
Sbjct:   33 GVLLFLYSVLLTKGIENIKNEIEDASEPLIDPVYGHGSQSLINLLLTGHAVSNVWDG-----DRECSGMKLL-GIHEQAAVGFLTLMEALRYC-KVGSYLKSPKFPIWIVG-SETHLTVFFAKDMALVA 153          
BLAST of Protein FAM188B vs. Ensembl Human
Match: MINDY3 (MINDY lysine 48 deubiquitinase 3 [Source:HGNC Symbol;Acc:HGNC:23578])

HSP 1 Score: 80.4925 bits (197), Expect = 8.837e-17
Identity = 43/129 (33.33%), Postives = 80/129 (62.02%), Query Frame = 1
Query: 1417 GLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            G++L + S L+T G+ N KNE+ + +  LI+P+ G  S  L++LL+ GH  S+ ++      D   + + +L GI +++++G+LTL     YC ++G+YLK+PK+P+W+V     +  V F  + +L++
Sbjct:   20 GVLLFLYSVLLTKGIENIKNEIEDASEPLIDPVYGHGSQSLINLLLTGHAVSNVWDG-----DRECSGMKLL-GIHEQAAVGFLTLMEALRYC-KVGSYLKSPKFPIWIVG-SETHLTVFFAKDMALVA 140          
BLAST of Protein FAM188B vs. Ensembl Fly
Match: CG14142 (gene:FBgn0036143 transcript:FBtr0300347)

HSP 1 Score: 88.5817 bits (218), Expect = 3.207e-18
Identity = 77/317 (24.29%), Postives = 144/317 (45.43%), Query Frame = 1
Query:  937 ITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFR---SDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLL--DSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDE-----LMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLD-----NHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYS 1842
            ITA +A DL++L+F + +    +EW + +F F +   E+ +G+         +++ +Q  VL   LF    S +       +     +  +L  + +     ISD   + + L   D  F   S      D +TE L ++ +   + L+ F+  +   FT+   PG +L + S ++T  +   + +L +       PL  S+ E     +++LL+ G  + +  N  + + D +S  +   +G+ KR  IG L  D           +Q G+ LKTP YP+W+      ++ V+F  N  L+ ++ +E RF +  YS
Sbjct:   13 ITAELATDLRNLVFGTAAIPMRAEWLQTSFVFGAPKEELAYGLRSPRNATRGLLSVVQGFVLKYLLFARKTSRVASLTDPLLATADMQREALFCALLEILRTISDKGKVTMVLPSEDEVFVDHSACYFH-DSVTEKLYVFTLSPNDELEYFLKRNFKYFTEEETPGTLLFLYSAVLTRSMGKVRTDLDSAKS---TPLTSSNHEEGSLMIVTLLLTGRATPYIHNGVVNVGDESSYAVP-QYGVLKRCMIGLLLWDIESASAAVNQSRQPGSRLKTPNYPIWITSCTG-HFGVIFNKNPDLLRNYHAESRFDVNYYS 323          
BLAST of Protein FAM188B vs. Ensembl Fly
Match: CG7332 (gene:FBgn0030973 transcript:FBtr0074647)

HSP 1 Score: 62.003 bits (149), Expect = 1.194e-9
Identity = 36/129 (27.91%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1417 GLILLIVSCLITHGLSNCKNELSNKTMRLI-NPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            G++L + S  +T GL     ++S+ +  LI +  G     L++L++ G   +H ++ + ++          L GI ++S IG++TL     YC  +G++ K P+YPVW V   + +  V+F + + L+S
Sbjct:  296 GVLLFMYSVFLTKGLELVAADISDTSEPLIHSTYGYGGQSLINLMLTGRAVAHVWDNEQDVGGLK------LRGICEQSDIGFITLMEEMRYCT-VGSFFKNPRYPVW-VMGSDTHLTVLFSNEKRLVS 416          
BLAST of Protein FAM188B vs. Ensembl Fly
Match: CG7332 (gene:FBgn0030973 transcript:FBtr0342877)

HSP 1 Score: 62.003 bits (149), Expect = 1.194e-9
Identity = 36/129 (27.91%), Postives = 69/129 (53.49%), Query Frame = 1
Query: 1417 GLILLIVSCLITHGLSNCKNELSNKTMRLI-NPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            G++L + S  +T GL     ++S+ +  LI +  G     L++L++ G   +H ++ + ++          L GI ++S IG++TL     YC  +G++ K P+YPVW V   + +  V+F + + L+S
Sbjct:  296 GVLLFMYSVFLTKGLELVAADISDTSEPLIHSTYGYGGQSLINLMLTGRAVAHVWDNEQDVGGLK------LRGICEQSDIGFITLMEEMRYCT-VGSFFKNPRYPVW-VMGSDTHLTVLFSNEKRLVS 416          
BLAST of Protein FAM188B vs. Ensembl Zebrafish
Match: si:dkey-30h22.11 (si:dkey-30h22.11 [Source:ZFIN;Acc:ZDB-GENE-110411-104])

HSP 1 Score: 126.331 bits (316), Expect = 1.153e-29
Identity = 101/323 (31.27%), Postives = 172/323 (53.25%), Query Frame = 1
Query:  925 SSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRS---DXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQF-TDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTI 1881
            S +Q+TA   + LK ++F S+   +  EW +Q+F F S    + +GI+QK  GP  V+AA+QA VL + LF     D            ++K L LAL+++I R    + + + I    S F    IG  K DGI E +    +   + L   +  H+ QF + P   G ILL +S +++  ++  ++++   T  LI   G  + EL++LL+ G   S+ F++++++ DS +   ++L GI  RS IG L+L  H   C+ +G++LK P +P+W+V     ++ V+F  ++ L SD  +E  F LY Y  L   ++ I +T+
Sbjct:  327 SMDQMTA---VALKEIIFGSSMACFTEEWKQQSFTF-SDTPGLKYGIVQKKGGPCGVLAAVQACVLEKLLFEESSCDSVDQRLEVSSIVRTKCLYLALADVIWRAGNMNRATVAINTGRSVF--TPIGRYKSDGILEMITYVTVETLDDLTLVLEQHVRQFESGPF--GCILLTISAILSRTIAIVRSDMDVPTSTLIGAHGYCTQELVNLLLCGRAVSNVFDDEMKL-DSGNGNFTLLRGIKTRSDIGLLSLFEHYNICK-VGSHLKNPTFPIWVV-CSESHFSVLFSLSKDLASDHCTENEFDLYYYDGLANQQEPIRLTV 638          
BLAST of Protein FAM188B vs. Ensembl Zebrafish
Match: mindy4b (MINDY family member 4B [Source:ZFIN;Acc:ZDB-GENE-140127-1])

HSP 1 Score: 96.2857 bits (238), Expect = 5.263e-21
Identity = 83/321 (25.86%), Postives = 139/321 (43.30%), Query Frame = 1
Query:  961 LKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXXXXXXXXXXR---CRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLIN-PLG--VSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLD----NHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASS 1893
            L+ +LF +T   +  EW K  F F    +E+ + +  +  G   V   +QA ++   LF      +   +      ++                  +   + +CL+ S          K D  TE L ++    KE  + FI  HI  F +    G+IL + S + +  +   + +L   T +L++   G  V    L++LL+ G  + H FN      + +      L+G+  RS++GYL  +    NH +    +G+ LKTPK P+W+    N  Y V+F  N SL+SDWK E  F LY Y+         +++ID  S
Sbjct:    5 LRTVLFGNTFHIFNYEWKKSFFKFREPFSEMAYALETERGGACAVQMVVQAHIIKYLLFNRSAESDCTIQSMMTVGEMEQRKALAAALTDILWAAGEEETVTVCLVTSERCFTPHLNYKLDSFTERLQLFTFKKKEEARAFIYEHIQCFREEGSHGIILFLYSLIFSRTIDRIQTDLDCTTTQLLHLRFGNFVCRQALINLLLTGRATPHVFNGTSHCKEQDKP----LYGVLTRSNVGYLLWNRDQVNHAQL-PLVGSMLKTPKLPIWVCN-INGTYSVLFGTNCSLLSDWKMEHLFLLYFYNGQPTQLNTTTLSIDTHS 319          
BLAST of Protein FAM188B vs. Ensembl Zebrafish
Match: mindy3 (MINDY lysine 48 deubiquitinase 3 [Source:NCBI gene;Acc:777708])

HSP 1 Score: 81.6481 bits (200), Expect = 8.305e-16
Identity = 43/129 (33.33%), Postives = 76/129 (58.91%), Query Frame = 1
Query: 1417 GLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            G++L + S ++T G+ N KNE+ + T  LI+P+ G  S  L++LL+ GH  S+ ++   E           LHGI +++S+G+LTL     YC ++G +LK+PK+P+W++     +  V F    +L++
Sbjct:  181 GVLLFLYSVILTKGIENIKNEIEDTTEPLIDPVYGHGSQSLINLLVTGHAVSNVWDGDRECSGMK------LHGIYQQASVGFLTLMESLRYC-KVGAFLKSPKFPIWILG-SETHLSVFFTKEMALVA 301          
BLAST of Protein FAM188B vs. Ensembl Xenopus
Match: slc26a3.1 (solute carrier family 26, member 3, gene 1 [Source:Xenbase;Acc:XB-GENE-855719])

HSP 1 Score: 162.54 bits (410), Expect = 4.086e-41
Identity = 104/327 (31.80%), Postives = 178/327 (54.43%), Query Frame = 1
Query:  937 ITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFT-DPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKNQK 1914
            I    A+++K +LF S+   +  EW  Q+F F++ N  + +G IQK  GP  V+AA+Q  VL   LF  D ++         ++  L  A+++I+ R   +  + + +      F     G  K DGI E L++Y+I   E L  F+  HI+QF   P   G  LL +S +++  +   + +    T  LI      + EL++L++ G   S+ FN+ +E+ DS +  +++L G++ R+ IG+L+L  H   CQ +G+YLKTP++P+W++     ++ V+FC  + L+SDWK E RF LY Y  L   +  I +T+D ++T  + Q+
Sbjct:  399 IDLAQAVEIKKILFGSSFCCFSDEWKIQSFTFNN-NQPLRYGFIQKKGGPCGVLAAVQGCVLKNLLFGKDADLRVLQPSDSQRTSCLCKAIADILWRAGDNKEAVVALSCGRPQF--SPAGRYKADGILESLILYKIRKYEDLMGFVQQHISQFELGPF--GCTLLTLSVVLSRSVELVQKDFDVSTNCLIGAHSYCTQELVNLILSGRAVSNVFNDVVEL-DSGNGNITLLRGVAHRTDIGFLSLFEHYNVCQ-VGSYLKTPRFPIWVI-CSESHFSVLFCVRRELMSDWKMERRFDLYYYDGLANQQDEIRLTVDTAATYIEEQE 717          
BLAST of Protein FAM188B vs. Ensembl Xenopus
Match: mettl26 (methyltransferase like 26 [Source:Xenbase;Acc:XB-GENE-981693])

HSP 1 Score: 119.013 bits (297), Expect = 2.230e-28
Identity = 94/331 (28.40%), Postives = 151/331 (45.62%), Query Frame = 1
Query:  952 AMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXXXXXXXXXXR---CRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLIN-PLG--VSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQ-----IGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKNQ 1911
            A +LK +LF +T  ++  EW K  F F +  T + + +  +  G   +  A+Q  ++   LF  + + +   +  +  S+                   + +   ICL+ +          K D  TE L ++E  DKE L+KF+  HI  F +  C G+IL + S L +  L   +++L   T  L+   LG   +   L++L++ G  S   FN   ++ D  +      HG+  RS +G+L      E  QQ     +G+ LKTPK+P+WL    N  Y V+F  N SL+ DWK E  F LY Y+      K + +TID  S   + Q
Sbjct:    2 ATELKKILFGNTFYTFNYEWKKSFFKFCNPFTNMAYSLEAEKTGTRAIQMAVQGHIIKYLLFTKNGDEHSSLQNLQELSQKQQEKALAAALADILWTAGERNKATICLITNDPYFTQGPDYKADNFTERLQLFEFVDKEILEKFLCAHIYCFKNDGCHGVILFLYSLLFSRTLLRLQDDLDITTTHLLQFSLGNFSARQALINLMLTGRASPQVFNGD-QVSDEGNTEHQARHGVLVRSDVGFLHWSR--EEMQQDRLPRVGSMLKTPKFPIWLCN-INGTYSVLFGTNMSLLCDWKMEHFFDLYFYNGQLSQSKTVHLTIDTHSHHWEEQ 328          
BLAST of Protein FAM188B vs. Ensembl Xenopus
Match: dnajb12 (DnaJ heat shock protein family (Hsp40) member B12 [Source:Xenbase;Acc:XB-GENE-944288])

HSP 1 Score: 72.0182 bits (175), Expect = 1.232e-12
Identity = 38/129 (29.46%), Postives = 72/129 (55.81%), Query Frame = 1
Query: 1417 GLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            G++L + S ++T G+ N KNE+ +    LI+P+ G  S  L++LL+ GH  S+ ++   E           L GI   + +G+LT+     +C ++G++LK+PK+P+W++     +  V F    +L++
Sbjct:  164 GVLLFLYSVILTKGIENVKNEIEDAERPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMK------LQGIHSHADVGFLTILESLRFC-KVGSFLKSPKFPIWVIG-SETHLTVFFTKEMALVA 284          
BLAST of Protein FAM188B vs. Ensembl Xenopus
Match: dnajb12 (DnaJ heat shock protein family (Hsp40) member B12 [Source:Xenbase;Acc:XB-GENE-944288])

HSP 1 Score: 72.0182 bits (175), Expect = 1.397e-12
Identity = 38/129 (29.46%), Postives = 72/129 (55.81%), Query Frame = 1
Query: 1417 GLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            G++L + S ++T G+ N KNE+ +    LI+P+ G  S  L++LL+ GH  S+ ++   E           L GI   + +G+LT+     +C ++G++LK+PK+P+W++     +  V F    +L++
Sbjct:  181 GVLLFLYSVILTKGIENVKNEIEDAERPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMK------LQGIHSHADVGFLTILESLRFC-KVGSFLKSPKFPIWVIG-SETHLTVFFTKEMALVA 301          
BLAST of Protein FAM188B vs. Ensembl Xenopus
Match: dnajb12 (DnaJ heat shock protein family (Hsp40) member B12 [Source:Xenbase;Acc:XB-GENE-944288])

HSP 1 Score: 71.633 bits (174), Expect = 1.800e-12
Identity = 38/129 (29.46%), Postives = 72/129 (55.81%), Query Frame = 1
Query: 1417 GLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            G++L + S ++T G+ N KNE+ +    LI+P+ G  S  L++LL+ GH  S+ ++   E           L GI   + +G+LT+     +C ++G++LK+PK+P+W++     +  V F    +L++
Sbjct:  175 GVLLFLYSVILTKGIENVKNEIEDAERPLIDPVYGHGSQSLINLLLTGHAVSNVWDGDRECSGMK------LQGIHSHADVGFLTILESLRFC-KVGSFLKSPKFPIWVIG-SETHLTVFFTKEMALVA 295          
BLAST of Protein FAM188B vs. Ensembl Mouse
Match: Mindy4 (MINDY lysine 48 deubiquitinase 4 [Source:MGI Symbol;Acc:MGI:3583959])

HSP 1 Score: 160.229 bits (404), Expect = 1.800e-40
Identity = 111/351 (31.62%), Postives = 179/351 (51.00%), Query Frame = 1
Query:  874 DESIEFNSVIKP----MKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXX-XXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCP-GLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKN 1908
            DE I+ + V+ P    +K    S  I   +A ++K LLF ST   +  EW  QNF F+ + + + +GI+Q   GP  V+AA+Q  VL + LF  D   N   +++ + ++    LAL+      R        + L   +      G  K DG+ E L +Y +   E L  FI   ++QF     P G ILL +S +++  L   + +    T  LI   G  + EL++LL+ G   S+ FN+ +E+ DS    +++L GI  RS IG+L+L  H   CQ +G +LKTP++P+W+V     ++ ++F     L+ DW+SE  F LY Y  L   ++ I +T+D + T   +
Sbjct:  369 DELIKEDIVLFPPPSMLKLQTVSKPIDLSLAKEIKTLLFGSTFCCFSEEWKLQNFSFNDIAS-LKYGIVQNKGGPCGVLAAVQGCVLQKLLFEGDNRTNSNLRLQPSDAQRTRCLALAIADILWRAGGKEQAVVALASGTPHFSPTGKYKADGVLETLTLYSLTSSEDLVTFIQQSVHQFE--AGPYGCILLTLSAILSRSLELVRQDFDVPTSHLIGAHGYCTQELVNLLLTGRAVSNVFNDVVEL-DSGDGNITLLRGIEARSDIGFLSLFEHYNVCQ-VGCFLKTPRFPIWVV-CSESHFSILFSLQPELLCDWRSERLFDLYYYDGLANQQEEIRLTVDTTKTAPAD 713          
BLAST of Protein FAM188B vs. Ensembl Mouse
Match: Mindy4b-ps (MINDY lysine 48 deubiquitinase 4B, pseudogene [Source:MGI Symbol;Acc:MGI:2140018])

HSP 1 Score: 119.783 bits (299), Expect = 3.590e-28
Identity = 89/327 (27.22%), Postives = 153/327 (46.79%), Query Frame = 1
Query:  937 ITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXXXXXXXXXXRC--RISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLIN--PLGVSSDE-LMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLD---NHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASS 1893
            I   +A  LK  LF +T++  G +W K +F FH   +++ F +  +  G  ++  A+Q  ++   LF  +        +     +    AL+ +++       ++    +C         S      +   E L ++E  +KE  +KF+  H+  F      G+IL + S +++      + +L   T  L++    GVS  + +++L++ G  S + FN   E     S     LHGI  RS IGYL  +   +  +   Q+G+ LKTP +P+WL    N NY ++FC N+ L+SDWK E  F L+ YS     +K + +TID  S
Sbjct:   94 IAPAIATMLKRSLFGNTNQVLGGDWRKAHFKFHDPFSDLAFALQVEKGGAQSIQMAVQGSIIKYLLFTREGKDCSLQSLCNLSQREQEQALAAMLAGILWAAGEAQKAIVCFDTKDIHSTSTLDYSSNNFIERLQLFEFSEKEATEKFVYDHLQCFKGEGSHGVILFLYSLVLSRTFERLQKDLDTTTTHLLHSQAGGVSCRQAVLNLILTGRASPNVFNGYEEGKSEQS-----LHGILARSDIGYLQWNKDTSEGDQLSQVGSMLKTPTFPIWLCN-INGNYSILFCTNRQLLSDWKMERVFDLHFYSGQPSQKKPVHLTIDTHS 414          
BLAST of Protein FAM188B vs. Ensembl Mouse
Match: Mindy4b-ps (MINDY lysine 48 deubiquitinase 4B, pseudogene [Source:MGI Symbol;Acc:MGI:2140018])

HSP 1 Score: 90.1225 bits (222), Expect = 3.138e-19
Identity = 59/175 (33.71%), Postives = 91/175 (52.00%), Query Frame = 1
Query: 1387 INQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLIN--PLGVSSDE-LMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLD---NHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASS 1893
            I +F      G+IL + S +++      + +L   T  L++    GVS  + +++L++ G  S + FN   E     S     LHGI  RS IGYL  +   +  +   Q+G+ LKTP +P+WL    N NY ++FC N+ L+SDWK E  F L+ YS     +K + +TID  S
Sbjct:   84 IERFKGEGSHGVILFLYSLVLSRTFERLQKDLDTTTTHLLHSQAGGVSCRQAVLNLILTGRASPNVFNGYEEGKSEQS-----LHGILARSDIGYLQWNKDTSEGDQLSQVGSMLKTPTFPIWLCN-INGNYSILFCTNRQLLSDWKMERVFDLHFYSGQPSQKKPVHLTIDTHS 252          
BLAST of Protein FAM188B vs. Ensembl Mouse
Match: Mindy3 (MINDY lysine 48 deubiquitinase 3 [Source:MGI Symbol;Acc:MGI:1914210])

HSP 1 Score: 77.0258 bits (188), Expect = 2.291e-14
Identity = 42/129 (32.56%), Postives = 78/129 (60.47%), Query Frame = 1
Query: 1417 GLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            G++L + S L+T G+ N KN + +    LI+P+ G  S  L++LL+ GH  S+ ++      D   + + +L GI +++++G+LTL     YC+ +G+YLK+PK+P+W+V     +  V F  + +L++
Sbjct:  179 GVLLFLYSVLLTKGIENIKNSIEDANEPLIDPVYGHGSQSLINLLLTGHAVSNVWDG-----DRECSGMQLL-GIHEQAAVGFLTLMEALRYCK-VGSYLKSPKFPIWIVG-SETHLTVFFAKDMALVA 299          
BLAST of Protein FAM188B vs. Ensembl Mouse
Match: Mindy4 (MINDY lysine 48 deubiquitinase 4 [Source:MGI Symbol;Acc:MGI:3583959])

HSP 1 Score: 54.299 bits (129), Expect = 4.858e-7
Identity = 35/95 (36.84%), Postives = 52/95 (54.74%), Query Frame = 1
Query:  874 DESIEFNSVIKP----MKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSD 1146
            DE I+ + V+ P    +K    S  I   +A ++K LLF ST   +  EW  QNF F+ + + + +GI+Q   GP  V+AA+Q  VL + LF  D
Sbjct:  369 DELIKEDIVLFPPPSMLKLQTVSKPIDLSLAKEIKTLLFGSTFCCFSEEWKLQNFSFNDIAS-LKYGIVQNKGGPCGVLAAVQGCVLQKLLFEGD 462          
BLAST of Protein FAM188B vs. UniProt/SwissProt
Match: sp|Q3UQI9|MINY4_MOUSE (Probable ubiquitin carboxyl-terminal hydrolase MINDY-4 OS=Mus musculus OX=10090 GN=Mindy4 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.259e-39
Identity = 111/351 (31.62%), Postives = 179/351 (51.00%), Query Frame = 1
Query:  874 DESIEFNSVIKP----MKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXX-XXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCP-GLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKN 1908
            DE I+ + V+ P    +K    S  I   +A ++K LLF ST   +  EW  QNF F+ + + + +GI+Q   GP  V+AA+Q  VL + LF  D   N   +++ + ++    LAL+      R        + L   +      G  K DG+ E L +Y +   E L  FI   ++QF     P G ILL +S +++  L   + +    T  LI   G  + EL++LL+ G   S+ FN+ +E+ DS    +++L GI  RS IG+L+L  H   CQ +G +LKTP++P+W+V     ++ ++F     L+ DW+SE  F LY Y  L   ++ I +T+D + T   +
Sbjct:  369 DELIKEDIVLFPPPSMLKLQTVSKPIDLSLAKEIKTLLFGSTFCCFSEEWKLQNFSFNDIAS-LKYGIVQNKGGPCGVLAAVQGCVLQKLLFEGDNRTNSNLRLQPSDAQRTRCLALAIADILWRAGGKEQAVVALASGTPHFSPTGKYKADGVLETLTLYSLTSSEDLVTFIQQSVHQFE--AGPYGCILLTLSAILSRSLELVRQDFDVPTSHLIGAHGYCTQELVNLLLTGRAVSNVFNDVVEL-DSGDGNITLLRGIEARSDIGFLSLFEHYNVCQ-VGCFLKTPRFPIWVV-CSESHFSILFSLQPELLCDWRSERLFDLYYYDGLANQQEEIRLTVDTTKTAPAD 713          
BLAST of Protein FAM188B vs. UniProt/SwissProt
Match: sp|Q0VA42|MINY4_XENTR (Probable ubiquitin carboxyl-terminal hydrolase MINDY-4 OS=Xenopus tropicalis OX=8364 GN=mindy4 PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.442e-39
Identity = 104/327 (31.80%), Postives = 178/327 (54.43%), Query Frame = 1
Query:  937 ITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCP-GLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKNQK 1914
            I    A+++K +LF S+   +  EW  Q+F F++ N  + +G IQK  GP  V+AA+Q  VL   LF  D ++         ++  L  A+++I+ R   +  + + +      F     G  K DGI E L++Y+I   E L  F+  HI+QF     P G  LL +S +++  +   + +    T  LI      + EL++L++ G   S+ FN+ +E+ DS +  +++L G++ R+ IG+L+L  H   CQ +G+YLKTP++P+W++     ++ V+FC  + L+SDWK E RF LY Y  L   +  I +T+D ++T  + Q+
Sbjct:  399 IDLAQAVEIKKILFGSSFCCFSDEWKIQSFTFNN-NQPLRYGFIQKKGGPCGVLAAVQGCVLKNLLFGKDADLRVLQPSDSQRTSCLCKAIADILWRAGDNKEAVVALSCGRPQF--SPAGRYKADGILESLILYKIRKYEDLMGFVQQHISQFE--LGPFGCTLLTLSVVLSRSVELVQKDFDVSTNCLIGAHSYCTQELVNLILSGRAVSNVFNDVVEL-DSGNGNITLLRGVAHRTDIGFLSLFEHYNVCQ-VGSYLKTPRFPIWVI-CSESHFSVLFCVRRELMSDWKMERRFDLYYYDGLANQQDEIRLTVDTAATYIEEQE 717          
BLAST of Protein FAM188B vs. UniProt/SwissProt
Match: sp|A1A4L4|MINY4_BOVIN (Probable ubiquitin carboxyl-terminal hydrolase MINDY-4 OS=Bos taurus OX=9913 GN=MINDY4 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 7.747e-38
Identity = 105/341 (30.79%), Postives = 172/341 (50.44%), Query Frame = 1
Query:  877 ESIEFNSVIKPMKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQF-TDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASST 1896
            E I  + V   +K    S  I   +A D+K +LF S+   +  EW  Q+F F+  +  + +GI+Q   GP  V+AA+Q  VL + LF  D + +       N  +   LAL+      R        + L   +      G  K DG+ E L+++ +   E L  F+   I+QF   P   G +LL +S +++      + +    T  LI   G  + EL++LL+ G   S+ FN+ +E+ DS +  +++L GIS RS IG+L+L  H   CQ +G +LKTP++P+W+V     ++ V+F     L+ DW++E  F LY Y  L   ++ I +T+D + T
Sbjct:  394 EEIILSPVSSVLKLQVVSKPIDLSVAKDIKTILFGSSFCCFSDEWKLQSFSFND-SVSLKYGIVQNKGGPCGVLAAVQGCVLQKLLFEGDSSADCARLQPSNARRTHCLALAIADIVWRAGGCERAVVTLASGTQHFSPTGKYKADGVLETLILHSLTCYEELVTFLQQSIHQFEAGPY--GCVLLTLSAILSRSTELVRQDFDVPTSHLIGAHGYCTQELVNLLLTGKAVSNVFNDVVEL-DSGNGDVTLLKGISTRSDIGFLSLFEHYNVCQ-VGCFLKTPRFPIWVV-CSESHFSVLFSQQLELLRDWRAERLFDLYYYDGLANQQEQIRLTVDTTQT 728          
BLAST of Protein FAM188B vs. UniProt/SwissProt
Match: sp|Q4G0A6|MINY4_HUMAN (Probable ubiquitin carboxyl-terminal hydrolase MINDY-4 OS=Homo sapiens OX=9606 GN=MINDY4 PE=1 SV=2)

HSP 1 Score: 149.443 bits (376), Expect = 3.829e-36
Identity = 105/356 (29.49%), Postives = 172/356 (48.31%), Query Frame = 1
Query:  874 DESIEFNSVIKP----MKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXXXXXXXXXXRC----------RISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQF-TDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASST 1896
            DE I    ++ P    +K   +S  I   +A ++K LLF S+   +  EW  Q+F F S    + +GI+Q   GP  V+AA+Q  VL + LF  D   +    ++ + +            RC          R        + L   + +    G  K DG+ E L ++ +   E L  F+   I+QF   P   G ILL +S +++      + +    T  LI   G  + EL++LL+ G   S+ FN+ +E+ DS    +++L GI+ RS IG+L+L  H   CQ +G +LKTP++P+W+V     ++ ++F     L+ DW++E  F LY Y  L   ++ I +TID + T
Sbjct:  382 DELIREEVILSPVPSVLKLQTASKPIDLSVAKEIKTLLFGSSFCCFNEEWKLQSFSF-SNTASLKYGIVQNKGGPCGVLAAVQGCVLQKLLFEGDSKADCAQGLQPSDAHRT---------RCLVLALADIVWRAGGRERAVVALASRTQQFSPTGKYKADGVLETLTLHSLTCYEDLVTFLQQSIHQFEVGPY--GCILLTLSAILSRSTELIRQDFDVPTSHLIGAHGYCTQELVNLLLTGKAVSNVFNDVVEL-DSGDGNITLLRGIAARSDIGFLSLFEHYNMCQ-VGCFLKTPRFPIWVV-CSESHFSILFSLQPGLLRDWRTERLFDLYYYDGLANQQEQIRLTIDTTQT 722          
BLAST of Protein FAM188B vs. UniProt/SwissProt
Match: sp|Q5RF72|MINY4_PONAB (Probable ubiquitin carboxyl-terminal hydrolase MINDY-4 OS=Pongo abelii OX=9601 GN=MINDY4 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.220e-35
Identity = 104/356 (29.21%), Postives = 171/356 (48.03%), Query Frame = 1
Query:  874 DESIEFNSVIKP----MKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXXXXXXXXXXRC----------RISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCP-GLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASST 1896
            DE I    ++ P    +K   +S  I   +A ++K LLF S+   +  EW  Q+F F S    + +GI+Q   GP  V+AA+Q  VL + LF  D   +    ++ + +            RC          R        + L   + +    G  K DG+ E L ++ +     L  F+   I+QF     P G ILL +S +++      + +    T  LI   G  + EL++LL+ G   S+ FN+ +E+ DS    +++L GI+ RS IG+L+L  H   CQ +G +LKTP++P+W+V     ++ ++F     L+ DW++E  F LY Y  L   ++ I +TID + T
Sbjct:  382 DELIREEVILSPVPSVLKLQTASKPIDLSVAKEIKTLLFGSSFCCFNEEWKLQSFSF-SNTASLKYGIVQNKGGPCGVLAAVQGCVLQKLLFEGDSKADCARGLQPSDAHRT---------RCLVLALADIVWRAGGRERAVVALASRTQQFSPTGKYKADGVLETLTLHSLTCYGDLVTFLQQSIHQFE--VGPHGCILLTLSAILSRSTELIRQDFDVPTSHLIGAHGYCTQELVNLLLTGKAVSNVFNDVVEL-DSGDGNITLLRGIAARSDIGFLSLFEHYNVCQ-VGCFLKTPRFPIWVV-CSESHFSILFSLQPGLLRDWRTERLFDLYYYDGLANQQEQIRLTIDTTQT 722          
BLAST of Protein FAM188B vs. TrEMBL
Match: A0A091VQ83 (Protein FAM188B (Fragment) OS=Opisthocomus hoazin OX=30419 GN=N306_07666 PE=4 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.791e-46
Identity = 118/332 (35.54%), Postives = 185/332 (55.72%), Query Frame = 1
Query:  925 SSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFR-SDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQF-TDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKNQK 1914
            +S  I   +A +LK+LLF ST   +  EW  Q+F F+++  ++ +GI+QK  GP  V+AA+QA VL + +F  S+ N +          +   L ++      R        + L     +   IG  K DGI E L+++     E L  F+  +I+QF T PC  G ILL VS +++  ++  +N+    T RLI   G  + EL++LL+ G   S+ FN  +E+ DS +  ++IL GI+ RS IG L+L  H + CQ +G YLKTPKYP+WLV     ++ V+FC  + L++DWK+E RF LY Y  L   E+ I +T+D +   T++++
Sbjct:   26 ASKAIDISLAKELKNLLFGSTLCCFSEEWKIQSFTFNNI-PQLKYGIVQKKGGPCGVLAAVQACVLQQLIFADSNRNKDTRCLQPSEVHRTKCLTMALADILWRAGGGEKAIVALPSGRQQFTPIGKYKADGILETLILHSATRYEDLIVFLQQNIHQFETGPC--GCILLTVSVILSRSINLVRNDFDVLTNRLIGSHGYCTQELVNLLLTGKAVSNVFNNVIEL-DSGNGNITILKGITSRSDIGLLSLFEHYDVCQ-VGCYLKTPKYPIWLV-CSESHFSVLFCLEKDLLADWKTERRFDLYYYDGLANQEEEIRLTVDTTQMCTEDKE 351          
BLAST of Protein FAM188B vs. TrEMBL
Match: A0A093IYH1 (Protein FAM188B (Fragment) OS=Eurypyga helias OX=54383 GN=N326_13584 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.049e-45
Identity = 118/331 (35.65%), Postives = 184/331 (55.59%), Query Frame = 1
Query:  928 SNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFR-SDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQF-TDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKNQK 1914
            S  I   +A +LK+LLF S+   +  EW  Q+F F+S+  ++ +GI+QK  GP  V+AA+QA VL + +F  S+ N +          +   L L+      R   +    + L     +   +G  K DGI E L+++     E L  F+  +I+QF   PC  G ILL VS +++  ++  +N+    T RLI   G  + EL++LL+ G   S+ FN  +E+ DS +  ++IL GI+ RS IG L+L  H + CQ +G YLKTPKYP+WLV     ++ V+FC  + L+SDWK+E RF LY Y  L   E+ I +T+D +   T++++
Sbjct:   27 SKAIDISLAKELKNLLFGSSLCCFSEEWKIQSFTFNSI-PQLKYGIVQKKGGPCGVLAAVQACVLQQLIFADSNRNKDARCLQPSEVHRTKCLTLAIADILWRAGGNEKAIVALPSGRQQFTPVGKYKADGILETLILHSAARYEDLMVFLQQNIHQFEIGPC--GCILLTVSVILSRSINLVRNDFDVLTNRLIGSHGYCTQELVNLLLTGKAVSNVFNNVIEL-DSGNGNITILKGITSRSDIGLLSLFEHYDVCQ-VGCYLKTPKYPIWLV-CSESHFSVLFCLEKDLLSDWKTERRFDLYYYDGLANQEEEIRLTVDTTQMCTEDKE 351          
BLAST of Protein FAM188B vs. TrEMBL
Match: A0A099ZQP6 (Protein FAM188B (Fragment) OS=Tinamus guttatus OX=94827 GN=N309_11766 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 1.092e-45
Identity = 119/332 (35.84%), Postives = 186/332 (56.02%), Query Frame = 1
Query:  925 SSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFR-SDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQF-TDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASS--TETKN 1908
            +S  I   +A ++K+LLF S+   +  EW  Q+F F+S+  ++ +GI+QK  GP  V+AA+QA VL + LF  S+ N +  +       +   L ++      R   +    + L     +   IG  K DGI E L+++     E L  F+  +I+QF   PC  G ILL VS +++  ++  +N+    T RLI   G  + EL++LL+ G   S+ FN  +E+ DS +  ++IL GI+ RS IG L+L  H + CQ +G+YLKTPKYP+WLV     ++ V+FC  ++L+ DWK+E RF LY Y  L   E+ I +T+D +   TE K+
Sbjct:   26 ASKAIDISLAKEIKNLLFGSSLCCFSEEWKIQSFTFNSI-PQLKYGIVQKKGGPCGVLAAVQACVLQQLLFGDSNRNKDTRSLQPSEVHRTKCLTMAIAGILWRAGGNEKAIVALPSGKQQFTPIGKYKADGILETLILHSATRYEDLLAFLQKNIHQFEIGPC--GCILLTVSVILSRSINLVRNDFDVLTNRLIGSHGYCTQELVNLLLTGKAVSNVFNNVIEL-DSGNGNITILKGITSRSDIGLLSLFEHYDVCQ-VGSYLKTPKYPIWLV-CSESHFSVLFCLEKNLLGDWKTEQRFDLYYYDGLANQEEEIRLTVDTTQMCTEAKD 351          
BLAST of Protein FAM188B vs. TrEMBL
Match: A0A093I0X1 (Protein FAM188B (Fragment) OS=Tyto alba OX=56313 GN=N341_05000 PE=4 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.909e-45
Identity = 117/323 (36.22%), Postives = 178/323 (55.11%), Query Frame = 1
Query:  928 SNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFR-SDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQF-TDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDAS 1890
            S  I   +A +LK+LLF S+   +  EW  Q+F F+++  ++ +GI+QK  GP  V+AA+QA VL + +F  S+ N            +   L ++      R   +    I L     +   IG  K DGI E L+++     E L  F+  +I+QF   PC  G ILL VS +++  +S  +N+    T RLI   G  + EL++LL+ G   S+ FN ++E +DS +  ++IL GI+ RS IG L+L  H + C Q+G YLKTPKYP+WLV     ++ V+FC  + L+ DWK+E RF LY Y  L   E+ I +T+D +
Sbjct:   27 SKAIDISLAKELKNLLFGSSLCCFSEEWKIQSFTFNNI-PQLKYGIVQKKGGPCGVLAAVQACVLQQLIFADSNRNKGTRCLQPSEVHRTKCLTMAIADILWRAGGNEKAIIALPSGRQQFTPIGKYKADGILETLILHSARRYEDLIVFLQQNIHQFEIGPC--GCILLTVSVILSRSISLVRNDFDVLTNRLIGSHGYCTQELVNLLLTGKAVSNVFNNEIE-LDSGNGNITILKGITSRSDIGLLSLFEHYDVC-QVGCYLKTPKYPIWLV-CSESHFSVLFCLEKDLLGDWKTERRFDLYYYDGLANQEEEIRLTVDTT 343          
BLAST of Protein FAM188B vs. TrEMBL
Match: A0A091NK31 (Protein FAM188B (Fragment) OS=Apaloderma vittatum OX=57397 GN=N311_12706 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 8.392e-45
Identity = 115/323 (35.60%), Postives = 178/323 (55.11%), Query Frame = 1
Query:  928 SNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFR-SDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQF-TDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDAS 1890
            S  I   +A +LK+LLF S+   +  EW  Q+F F+++  ++ +GI+QK  GP  V+AA+QA VL + +F  S+ N +          +   L ++      R   +    + L     +   +G  K DGI E L+++     E L  F+  +I+QF   PC  G ILL VS +++  ++  +N+    T RLI   G  + EL++LL+ G   S+ FN  +E+ DS +  ++IL GI+ RS IG L+L  H + CQ +G YLKTPKYP+WLV     ++ V+FC  + L+ DWK+E RF LY Y  L   E+ I +TID +
Sbjct:   27 SKAIDISLAKELKNLLFGSSLCCFSEEWKIQSFTFNNI-PQLKYGIVQKKGGPCGVLAAVQACVLQQLIFADSNRNKDTRCLQPSEAHRTKCLTMAIADILWRAGGNEKAIVALPSGRQQFTPMGKYKADGILETLILHSATRYEDLIVFLQQNIHQFEIGPC--GCILLTVSVILSRSINLVRNDFDVPTNRLIGSHGYCTQELVNLLLTGKAVSNVFNNVIEL-DSGNGNITILKGITSRSDIGLLSLFEHYDVCQ-VGCYLKTPKYPIWLV-CSESHFSVLFCLEKDLVGDWKTERRFDLYYYDGLANQEEEIRLTIDTT 343          
BLAST of Protein FAM188B vs. Ensembl Cavefish
Match: si:dkey-30h22.11 (si:dkey-30h22.11 [Source:ZFIN;Acc:ZDB-GENE-110411-104])

HSP 1 Score: 125.176 bits (313), Expect = 2.446e-29
Identity = 90/312 (28.85%), Postives = 159/312 (50.96%), Query Frame = 1
Query:  952 AMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLF-RSDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQF-TDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTI 1881
            A  LK ++F S    +  EW +Q+F F + +  + +GI+QK  GP  V+AA+QA VL + LF R+  +         +  +   LA +      R        + +         +G  +PDG+ E +    +   + L+  +  +I QF + P   G +LLIVS +++  +   + ++   T  LI   G  + EL++LL+ G   S+ FN++++ +DS +   ++L GI +RS +G L+L  H   C ++G+YLKTP++P+W+V     ++ V+F   + L S   S   F LY Y  L   ++ I +T+
Sbjct:  328 ATALKEIIFGSPVMCFSEEWKRQSFTFSNTHG-LRYGIVQKKGGPCGVLAAVQATVLQKLLFERTSSDSPSERLRVSDAERTTCLAEAVAEILWRAGGRKRATVAVNSGRRLFTPVGHYRPDGVLETITCISVEGLDDLQLLLQQNIQQFESGPF--GCVLLIVSAVLSRTIQMVRGDMDVPTSTLIGAHGYCTQELVNLLLCGQAVSNVFNDEMK-LDSGNGNFTLLKGIRERSDVGLLSLFEHFNLC-KVGSYLKTPRFPLWVV-CSESHFSVLFSLCKDLTSSQWSPREFDLYYYDGLANQQEPIRLTV 633          
BLAST of Protein FAM188B vs. Ensembl Cavefish
Match: mindy4b (MINDY family member 4B [Source:ZFIN;Acc:ZDB-GENE-140127-1])

HSP 1 Score: 87.8113 bits (216), Expect = 3.381e-18
Identity = 85/326 (26.07%), Postives = 141/326 (43.25%), Query Frame = 1
Query:  961 LKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVV------------KPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSS--DELMSLLIHGHISSHYFNEQLEIIDSNSNRL-SILHGISKRSSIGYLTLDN-HCEYCQ--QIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYS--PLFQSEKLISVT 1878
            L+ +LF +T   +  EW K  F F    + + + +  +  G   +  A+QA ++   LF            +    +             R   ++  +I       R  +I +V            K D  TE L ++    K+  +KFI  HI  F +    G+IL + S + +  +   ++     T  L   LG  S    L++LL+ G  S + FN  L + D + N L   L G+  RS +G+L       E+ +   +G+ LKTPK P+W+    N  Y V+F  N+SL+SDWK E  F LY Y+  P   +  ++++T
Sbjct:    5 LRKILFGNTFHVFNYEWKKSCFKFREPYSNLSYALEAERGGARAIQMAVQAHIIKYLLFTRPAESCTMELGEVGDKEQE-----------RALAAALADILWTAGEERSATISLVTSERCFTPHLDYKLDNFTERLHLFTFKKKDDTRKFIYEHIQCFNEEGSHGVILFLYSLIFSRSIVIQEDLDITSTHLLHFSLGNFSCRQALLNLLLTGRASPNVFNGSL-LCDEDGNPLVQPLRGVLARSDVGFLHWSREQAEHAKLPVVGSMLKTPKLPIWVCN-INGTYGVLFSFNRSLLSDWKMEHLFHLYFYNGQPTQGTTAILTIT 317          
BLAST of Protein FAM188B vs. Ensembl Cavefish
Match: mindy3 (MINDY lysine 48 deubiquitinase 3 [Source:NCBI gene;Acc:103040925])

HSP 1 Score: 80.8777 bits (198), Expect = 1.260e-15
Identity = 43/129 (33.33%), Postives = 77/129 (59.69%), Query Frame = 1
Query: 1417 GLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            G++L + S ++T G+ N KNE+ + +  LI+P+ G  S  L++LL+ GH  S+ ++   E           LHGI +++S+G+LTL     YC ++G++LK+PK+P+W++     +  V F    SL++
Sbjct:  203 GVLLFLYSVILTKGIENIKNEIEDTSEPLIDPVYGHGSQSLINLLVTGHAVSNVWDGDRECSGMK------LHGIHEQASVGFLTLMESLRYC-KVGSFLKSPKFPIWILG-SETHLSVFFTKEMSLVA 323          
BLAST of Protein FAM188B vs. Ensembl Nematostella
Match: EDO38391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD64])

HSP 1 Score: 118.627 bits (296), Expect = 5.343e-28
Identity = 88/299 (29.43%), Postives = 146/299 (48.83%), Query Frame = 1
Query:  952 AMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETL--FRSDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQ-QIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIY 1839
            A  L+ +LF +   S+ S+W KQ+ +F S+N+   +G+     GP  V+A +QA  LI+ L  F +   I        +  +  +L  +      +  +     + L    F+  S    K D +TE L+++   D + L++FI   +  F      G ILL+ S +++        +LS     L++     S  +M+LL+ G  + + FN  +E     +       GI +RS IG+LTL  H +    ++G+ LKTPK+PVW+V      Y V+FC N+ L++DW+ E RF LY Y
Sbjct:  186 AQSLRTVLFGTCGTSFNSDWRKQHINF-SMNSH--YGLSFYKPGPAGVLACLQA-FLIKNLLYFNATPAIAKSMLQPMSSDRQRALVAALSQMMWQAGERKHAVVTLPCGEFQWLSYEGYKLDHLTENLMLFTFSDFDELQRFIKRQVTFFESTSGDGCILLLYSIILSRTTKRVTEDLSEPNSILLDSNNGCSQAMMNLLLTGRATKNVFNGDVEYNKRGTILAYPQKGIKERSEIGFLTLWEHIDSKDVEVGSKLKTPKFPVWVVDSTGGRYGVVFCLNKDLVNDWRLERRFELYYY 480          
BLAST of Protein FAM188B vs. Ensembl Nematostella
Match: EDO33759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR84])

HSP 1 Score: 84.3445 bits (207), Expect = 1.079e-18
Identity = 51/164 (31.10%), Postives = 92/164 (56.10%), Query Frame = 1
Query: 1393 QFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTID 1884
            QF      G ILL+ S ++T  +    +++   T RL+   G  + E+++LL+ G  +S+ F+  +E+ DS   +  +L GI ++S IG L+L  H   C Q+G   KTP+ P+W+V     ++ V+F  ++ L++D K   +F LY Y  L + ++ I +T++
Sbjct:    8 QFEGDGRSGCILLLYSAILTRTIKKVISDMDEPTNRLMGAHGYCTQEMVNLLMTGRAASNAFDNVIEL-DSGGGKKMLLKGIDRQSDIGLLSLFEHYGSC-QVGGNFKTPRLPIWVVC-SESHFSVLFSLDKDLLTDCK---KFDLYYYDGLARQDEEIRLTVE 165          
BLAST of Protein FAM188B vs. Ensembl Nematostella
Match: EDO42424 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1A6])

HSP 1 Score: 64.3142 bits (155), Expect = 7.976e-11
Identity = 42/114 (36.84%), Postives = 65/114 (57.02%), Query Frame = 1
Query: 1417 GLILLIVSCLITHGLSNCKNELSNKTMRLINP-LGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSI-LHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVW-LVKW 1749
            G++L + S ++T G+   K E+ +    L++P  G  S  L++LLI G+  SH       I D + N  S+ L GI K+ +IG+LTL     YC ++G++LK P+Y  W L KW
Sbjct:  164 GVLLFLYSIILTRGIDTIKQEMEDSNEPLVDPHFGHGSQTLINLLITGYGVSH-------IWDHSKNIASLELRGIPKQCNIGFLTLLEAHRYC-EVGSFLKGPEYRRWYLGKW 269          
BLAST of Protein FAM188B vs. Ensembl Medaka
Match: si:dkey-30h22.11 (MINDY lysine 48 deubiquitinase 4 [Source:NCBI gene;Acc:101169924])

HSP 1 Score: 127.872 bits (320), Expect = 2.951e-30
Identity = 91/322 (28.26%), Postives = 165/322 (51.24%), Query Frame = 1
Query:  928 SNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFR----SDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTI 1881
            S  I   +AMDLK +L  S+   + +EW  Q   F   + ++ +GI+Q+  GP  V+A+IQA +L + LF     SD ++         + K L LAL+ ++ +    + + + +    + F     G  + +G+ E +V++ + +   L+  +  HI QF +    G ILL +S +++  +   K ++   +  LI   G  + EL+SLL+ G   S+ F++ +E +DS     ++L GI  R  +G L+L  H   C ++G +LKTP YP+W+V     ++ V+F   + L++     + F LY Y  L   ++ I +T+
Sbjct:  315 SRPIDQSIAMDLKAVLLGSSLNCFSAEWRNQGLTFSDTH-DLRYGIVQRKGGPCGVLASIQAFILKKLLFENTESSDSDLQRLRPSNATRRKCLVLALAEVLWKAGEEERATVAVNTGLNHF--TPSGRYRSEGVLEKMVLFTVDNLRDLQILVEQHIEQF-ETGTLGCILLTISAVLSRSIEKVKEDMDVSSSTLIGAHGYCTQELVSLLLCGRAVSNVFDDDME-LDSGGGDTTLLKGIKSRCDVGLLSLFEHYNIC-KVGAHLKTPSYPIWVV-CSESHFSVLFGLQRELLTSKDQHLEFDLYYYDGLANQQEEIRLTV 629          
BLAST of Protein FAM188B vs. Ensembl Medaka
Match: mindy3 (MINDY lysine 48 deubiquitinase 3 [Source:NCBI gene;Acc:101164339])

HSP 1 Score: 84.7297 bits (208), Expect = 6.584e-17
Identity = 46/132 (34.85%), Postives = 77/132 (58.33%), Query Frame = 1
Query: 1408 CCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            CC G++L + S ++T G+ N +NE+ + T  LI+P+ G  S  L++LL+ GH  S+ ++   E           LHGI K++S+G+LTL     YC ++GT+ K+PK+P+W++     +  V F    SL+ 
Sbjct:  169 CC-GVLLFLYSVILTKGIENIRNEIQDPTEPLIDPVHGHGSQSLVNLLVTGHAVSNVWDGDRECSGMK------LHGIHKQASVGFLTLMESLRYC-KVGTFFKSPKFPIWILG-SETHLSVFFTKEMSLVG 291          
BLAST of Protein FAM188B vs. Ensembl Medaka
Match: mindy3 (MINDY lysine 48 deubiquitinase 3 [Source:NCBI gene;Acc:101164339])

HSP 1 Score: 84.7297 bits (208), Expect = 6.624e-17
Identity = 46/132 (34.85%), Postives = 77/132 (58.33%), Query Frame = 1
Query: 1408 CCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            CC G++L + S ++T G+ N +NE+ + T  LI+P+ G  S  L++LL+ GH  S+ ++   E           LHGI K++S+G+LTL     YC ++GT+ K+PK+P+W++     +  V F    SL+ 
Sbjct:  189 CC-GVLLFLYSVILTKGIENIRNEIQDPTEPLIDPVHGHGSQSLVNLLVTGHAVSNVWDGDRECSGMK------LHGIHKQASVGFLTLMESLRYC-KVGTFFKSPKFPIWILG-SETHLSVFFTKEMSLVG 311          
BLAST of Protein FAM188B vs. Ensembl Medaka
Match: mindy3 (MINDY lysine 48 deubiquitinase 3 [Source:NCBI gene;Acc:101164339])

HSP 1 Score: 84.3445 bits (207), Expect = 7.283e-17
Identity = 46/132 (34.85%), Postives = 77/132 (58.33%), Query Frame = 1
Query: 1408 CCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            CC G++L + S ++T G+ N +NE+ + T  LI+P+ G  S  L++LL+ GH  S+ ++   E           LHGI K++S+G+LTL     YC ++GT+ K+PK+P+W++     +  V F    SL+ 
Sbjct:  160 CC-GVLLFLYSVILTKGIENIRNEIQDPTEPLIDPVHGHGSQSLVNLLVTGHAVSNVWDGDRECSGMK------LHGIHKQASVGFLTLMESLRYC-KVGTFFKSPKFPIWILG-SETHLSVFFTKEMSLVG 282          
BLAST of Protein FAM188B vs. Ensembl Medaka
Match: mindy3 (MINDY lysine 48 deubiquitinase 3 [Source:NCBI gene;Acc:101164339])

HSP 1 Score: 84.3445 bits (207), Expect = 8.622e-17
Identity = 46/132 (34.85%), Postives = 77/132 (58.33%), Query Frame = 1
Query: 1408 CCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLIS 1800
            CC G++L + S ++T G+ N +NE+ + T  LI+P+ G  S  L++LL+ GH  S+ ++   E           LHGI K++S+G+LTL     YC ++GT+ K+PK+P+W++     +  V F    SL+ 
Sbjct:  172 CC-GVLLFLYSVILTKGIENIRNEIQDPTEPLIDPVHGHGSQSLVNLLVTGHAVSNVWDGDRECSGMK------LHGIHKQASVGFLTLMESLRYC-KVGTFFKSPKFPIWILG-SETHLSVFFTKEMSLVG 294          
BLAST of Protein FAM188B vs. Planmine SMEST
Match: SMESG000064698.1 (SMESG000064698.1)

HSP 1 Score: 1253.04 bits (3241), Expect = 0.000e+0
Identity = 695/695 (100.00%), Postives = 695/695 (100.00%), Query Frame = 1
Query:  100 MNSSQLXXXXXXXXXXXXXXXXXXXXXXXXYAGVGGRNIVNCIKKEKIYYSAGGKFDSNKSFSHFKAPQFDPSCELQESFYKELKSVSDHSKSNRSNSDGIKSKLRKNEISKTENKSSIENSLPRLPIKSAGTEPVTDVISTINDQIEKLENRKLKLSISEKQARMKELLSKGRQNWSNFKSEINFIKSVESNSVNKICNDSEYMIKDEKLLNVILNDIVIGEKENLKDDFSYLDLNKEENINFTHNRMIEKKSESQGDESIEFNSVIKPMKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKNQKIXXXXXXXXXXXXXXXXSLTEKRLKKMSEKTLKFLLEDCSIEDYLNENVHEIPEEESDMQYLDKLIHIKWSKATITLENNEINISKLFKN 2184
            MNSSQLNKKNDKNKFKNDIIISEDIETTESYAGVGGRNIVNCIKKEKIYYSAGGKFDSNKSFSHFKAPQFDPSCELQESFYKELKSVSDHSKSNRSNSDGIKSKLRKNEISKTENKSSIENSLPRLPIKSAGTEPVTDVISTINDQIEKLENRKLKLSISEKQARMKELLSKGRQNWSNFKSEINFIKSVESNSVNKICNDSEYMIKDEKLLNVILNDIVIGEKENLKDDFSYLDLNKEENINFTHNRMIEKKSESQGDESIEFNSVIKPMKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDLNINWFNKIKKNKSKILSLALSNIISRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKNQKIREEENRKKTEKERENKSLTEKRLKKMSEKTLKFLLEDCSIEDYLNENVHEIPEEESDMQYLDKLIHIKWSKATITLENNEINISKLFKN
Sbjct:    1 MNSSQLNKKNDKNKFKNDIIISEDIETTESYAGVGGRNIVNCIKKEKIYYSAGGKFDSNKSFSHFKAPQFDPSCELQESFYKELKSVSDHSKSNRSNSDGIKSKLRKNEISKTENKSSIENSLPRLPIKSAGTEPVTDVISTINDQIEKLENRKLKLSISEKQARMKELLSKGRQNWSNFKSEINFIKSVESNSVNKICNDSEYMIKDEKLLNVILNDIVIGEKENLKDDFSYLDLNKEENINFTHNRMIEKKSESQGDESIEFNSVIKPMKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDLNINWFNKIKKNKSKILSLALSNIISRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKNQKIREEENRKKTEKERENKSLTEKRLKKMSEKTLKFLLEDCSIEDYLNENVHEIPEEESDMQYLDKLIHIKWSKATITLENNEINISKLFKN 695          
BLAST of Protein FAM188B vs. Planmine SMEST
Match: SMESG000064698.1 (SMESG000064698.1)

HSP 1 Score: 1248.03 bits (3228), Expect = 0.000e+0
Identity = 695/697 (99.71%), Postives = 695/697 (99.71%), Query Frame = 1
Query:  100 MNSSQLXXXXXXXXXXXXXXXXXXXXXXXXYAGVGGRNIVNCIKKEKIYYSAGGKFDSNKSFSHFKAPQFDPSCELQESFYKELKSVSDHSKSNRSNSDGIKSKLR--KNEISKTENKSSIENSLPRLPIKSAGTEPVTDVISTINDQIEKLENRKLKLSISEKQARMKELLSKGRQNWSNFKSEINFIKSVESNSVNKICNDSEYMIKDEKLLNVILNDIVIGEKENLKDDFSYLDLNKEENINFTHNRMIEKKSESQGDESIEFNSVIKPMKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDXXXXXXXXXXXXXXXXXXXXXXXXXXRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKNQKIXXXXXXXXXXXXXXXXSLTEKRLKKMSEKTLKFLLEDCSIEDYLNENVHEIPEEESDMQYLDKLIHIKWSKATITLENNEINISKLFKN 2184
            MNSSQLNKKNDKNKFKNDIIISEDIETTESYAGVGGRNIVNCIKKEKIYYSAGGKFDSNKSFSHFKAPQFDPSCELQESFYKELKSVSDHSKSNRSNSDGIKSKLR  KNEISKTENKSSIENSLPRLPIKSAGTEPVTDVISTINDQIEKLENRKLKLSISEKQARMKELLSKGRQNWSNFKSEINFIKSVESNSVNKICNDSEYMIKDEKLLNVILNDIVIGEKENLKDDFSYLDLNKEENINFTHNRMIEKKSESQGDESIEFNSVIKPMKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDLNINWFNKIKKNKSKILSLALSNIISRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKNQKIREEENRKKTEKERENKSLTEKRLKKMSEKTLKFLLEDCSIEDYLNENVHEIPEEESDMQYLDKLIHIKWSKATITLENNEINISKLFKN
Sbjct:    1 MNSSQLNKKNDKNKFKNDIIISEDIETTESYAGVGGRNIVNCIKKEKIYYSAGGKFDSNKSFSHFKAPQFDPSCELQESFYKELKSVSDHSKSNRSNSDGIKSKLRFLKNEISKTENKSSIENSLPRLPIKSAGTEPVTDVISTINDQIEKLENRKLKLSISEKQARMKELLSKGRQNWSNFKSEINFIKSVESNSVNKICNDSEYMIKDEKLLNVILNDIVIGEKENLKDDFSYLDLNKEENINFTHNRMIEKKSESQGDESIEFNSVIKPMKENFSSNQITAGMAMDLKHLLFNSTSRSWGSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDLNINWFNKIKKNKSKILSLALSNIISRCRISDSSPINICLLDSSFRGKSIGVVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTETKNQKIREEENRKKTEKERENKSLTEKRLKKMSEKTLKFLLEDCSIEDYLNENVHEIPEEESDMQYLDKLIHIKWSKATITLENNEINISKLFKN 697          
BLAST of Protein FAM188B vs. Planmine SMEST
Match: SMESG000042272.1 (SMESG000042272.1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.870e-11
Identity = 40/138 (28.99%), Postives = 77/138 (55.80%), Query Frame = 1
Query: 1411 CPGLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIR 1821
            C G++  + S ++T+G+   ++ +S++T  LI+P+ G SS  L +LLI G  S + F+ + ++         I+ GI  +  IG+LT+  +  YC ++G  LK PK P+W++     +  V+F  + ++I    + +R
Sbjct:  154 CYGILCFLYSVILTYGVEEMRSAMSDETASLIDPIYGHSSQCLTNLLITGRASPYLFDNEKDLGG------YIISGILHQPKIGFLTIMEYLRYC-EVGWNLKNPKIPIWILA-SETHLTVLFSKDTNVIEKDNNSLR 283          
BLAST of Protein FAM188B vs. Planmine SMEST
Match: SMESG000042272.1 (SMESG000042272.1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.582e-11
Identity = 40/138 (28.99%), Postives = 77/138 (55.80%), Query Frame = 1
Query: 1411 CPGLILLIVSCLITHGLSNCKNELSNKTMRLINPL-GVSSDELMSLLIHGHISSHYFNEQLEIIDSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIR 1821
            C G++  + S ++T+G+   ++ +S++T  LI+P+ G SS  L +LLI G  S + F+ + ++         I+ GI  +  IG+LT+  +  YC ++G  LK PK P+W++     +  V+F  + ++I    + +R
Sbjct:  154 CYGILCFLYSVILTYGVEEMRSAMSDETASLIDPIYGHSSQCLTNLLITGRASPYLFDNEKDLGG------YIISGILHQPKIGFLTIMEYLRYC-EVGWNLKNPKIPIWILA-SETHLTVLFSKDTNVIEKDNNSLR 283          
BLAST of Protein FAM188B vs. Planmine SMEST
Match: SMESG000019512.1 (SMESG000019512.1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.927e-10
Identity = 51/203 (25.12%), Postives = 91/203 (44.83%), Query Frame = 1
Query: 1357 EHLKKFILHHINQFTDPCCPGLILLIVSCLITHGLSNCKNELS-NKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEIID-SNSNRLSILHGISKRSSIGYLTLDNHCEYCQQ--------------------------IGTYLKTPKYPVWLVKWKNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTI 1881
            E  + F+    N FT     G ILL+ S   + GL     +      M L++     +   ++L++ G+ ++ + +  ++I D S+S +     GI KRS IG+L  D+  E                              +G+ LKTP++P+W+V   N NY V+F     L++ W++E  F L+  + L   ++L  ++I
Sbjct:    4 EERRSFVCLSSNTFTSRQYCGSILLLYSIAFSRGLQELFEDFEFEPNMSLLSYTETLTQSGINLILTGY-ATEFLHNGVQISDVSDSGKTRPQFGIKKRSDIGFLKYDSPVESNSNFFSNNSSRRMSDSQITSSGDLEQLYVVGSMLKTPRFPIWVVN-SNGNYGVLFSLRDDLLTHWRAENNFQLHYLNCLPSQQELCVLSI 204          
The following BLAST results are available for this feature:
BLAST of Protein FAM188B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MINDY47.972e-3729.49MINDY lysine 48 deubiquitinase 4 [Source:HGNC Symb... [more]
MINDY4B3.762e-3028.13MINDY family member 4B [Source:HGNC Symbol;Acc:HGN... [more]
AC004691.24.713e-2432.65novel protein, MINDY4 and AQP1 readthrough[more]
MINDY36.079e-1733.33MINDY lysine 48 deubiquitinase 3 [Source:HGNC Symb... [more]
MINDY38.837e-1733.33MINDY lysine 48 deubiquitinase 3 [Source:HGNC Symb... [more]
back to top
BLAST of Protein FAM188B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM188B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG141423.207e-1824.29gene:FBgn0036143 transcript:FBtr0300347[more]
CG73321.194e-927.91gene:FBgn0030973 transcript:FBtr0074647[more]
CG73321.194e-927.91gene:FBgn0030973 transcript:FBtr0342877[more]
back to top
BLAST of Protein FAM188B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-30h22.111.153e-2931.27si:dkey-30h22.11 [Source:ZFIN;Acc:ZDB-GENE-110411-... [more]
mindy4b5.263e-2125.86MINDY family member 4B [Source:ZFIN;Acc:ZDB-GENE-1... [more]
mindy38.305e-1633.33MINDY lysine 48 deubiquitinase 3 [Source:NCBI gene... [more]
back to top
BLAST of Protein FAM188B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a3.14.086e-4131.80solute carrier family 26, member 3, gene 1 [Source... [more]
mettl262.230e-2828.40methyltransferase like 26 [Source:Xenbase;Acc:XB-G... [more]
dnajb121.232e-1229.46DnaJ heat shock protein family (Hsp40) member B12 ... [more]
dnajb121.397e-1229.46DnaJ heat shock protein family (Hsp40) member B12 ... [more]
dnajb121.800e-1229.46DnaJ heat shock protein family (Hsp40) member B12 ... [more]
back to top
BLAST of Protein FAM188B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mindy41.800e-4031.62MINDY lysine 48 deubiquitinase 4 [Source:MGI Symbo... [more]
Mindy4b-ps3.590e-2827.22MINDY lysine 48 deubiquitinase 4B, pseudogene [Sou... [more]
Mindy4b-ps3.138e-1933.71MINDY lysine 48 deubiquitinase 4B, pseudogene [Sou... [more]
Mindy32.291e-1432.56MINDY lysine 48 deubiquitinase 3 [Source:MGI Symbo... [more]
Mindy44.858e-736.84MINDY lysine 48 deubiquitinase 4 [Source:MGI Symbo... [more]
back to top
BLAST of Protein FAM188B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3UQI9|MINY4_MOUSE1.259e-3931.62Probable ubiquitin carboxyl-terminal hydrolase MIN... [more]
sp|Q0VA42|MINY4_XENTR2.442e-3931.80Probable ubiquitin carboxyl-terminal hydrolase MIN... [more]
sp|A1A4L4|MINY4_BOVIN7.747e-3830.79Probable ubiquitin carboxyl-terminal hydrolase MIN... [more]
sp|Q4G0A6|MINY4_HUMAN3.829e-3629.49Probable ubiquitin carboxyl-terminal hydrolase MIN... [more]
sp|Q5RF72|MINY4_PONAB2.220e-3529.21Probable ubiquitin carboxyl-terminal hydrolase MIN... [more]
back to top
BLAST of Protein FAM188B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A091VQ831.791e-4635.54Protein FAM188B (Fragment) OS=Opisthocomus hoazin ... [more]
A0A093IYH11.049e-4535.65Protein FAM188B (Fragment) OS=Eurypyga helias OX=5... [more]
A0A099ZQP61.092e-4535.84Protein FAM188B (Fragment) OS=Tinamus guttatus OX=... [more]
A0A093I0X11.909e-4536.22Protein FAM188B (Fragment) OS=Tyto alba OX=56313 G... [more]
A0A091NK318.392e-4535.60Protein FAM188B (Fragment) OS=Apaloderma vittatum ... [more]
back to top
BLAST of Protein FAM188B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-30h22.112.446e-2928.85si:dkey-30h22.11 [Source:ZFIN;Acc:ZDB-GENE-110411-... [more]
mindy4b3.381e-1826.07MINDY family member 4B [Source:ZFIN;Acc:ZDB-GENE-1... [more]
mindy31.260e-1533.33MINDY lysine 48 deubiquitinase 3 [Source:NCBI gene... [more]
back to top
BLAST of Protein FAM188B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM188B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM188B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO383915.343e-2829.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337591.079e-1831.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424247.976e-1136.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein FAM188B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-30h22.112.951e-3028.26MINDY lysine 48 deubiquitinase 4 [Source:NCBI gene... [more]
mindy36.584e-1734.85MINDY lysine 48 deubiquitinase 3 [Source:NCBI gene... [more]
mindy36.624e-1734.85MINDY lysine 48 deubiquitinase 3 [Source:NCBI gene... [more]
mindy37.283e-1734.85MINDY lysine 48 deubiquitinase 3 [Source:NCBI gene... [more]
mindy38.622e-1734.85MINDY lysine 48 deubiquitinase 3 [Source:NCBI gene... [more]
back to top
BLAST of Protein FAM188B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064698.10.000e+0100.00SMESG000064698.1[more]
SMESG000064698.10.000e+099.71SMESG000064698.1[more]
SMESG000042272.11.870e-1128.99SMESG000042272.1[more]
SMESG000042272.12.582e-1128.99SMESG000042272.1[more]
SMESG000019512.11.927e-1025.12SMESG000019512.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012985 ID=SMED30012985|Name=Protein FAM188B|organism=Schmidtea mediterranea sexual|type=transcript|length=2199bp
ATCTTTAAATCCATAGTAACCATATTATTTTTGTAAATTCTAAATTATTG
AAAAAACGTAATTCGGTTTATTTAGTAATTAAATATCAAATAAATCTAAA
TGAATTCTTCTCAATTAAATAAAAAAAATGATAAAAATAAATTTAAAAAT
GATATAATAATCTCCGAAGATATAGAGACAACTGAATCATATGCAGGCGT
TGGTGGCAGAAATATCGTAAATTGTATTAAAAAGGAGAAAATATATTATT
CTGCTGGTGGAAAATTTGATAGTAATAAATCATTTTCTCATTTCAAAGCC
CCTCAATTCGATCCCAGTTGCGAGCTGCAAGAATCATTTTATAAAGAATT
AAAATCAGTTTCTGATCATTCAAAGAGTAATAGGTCCAATAGTGATGGAA
TTAAATCCAAATTGCGGAAGAATGAAATTTCTAAAACAGAAAATAAATCT
TCAATTGAGAATAGTCTTCCACGATTACCGATCAAATCAGCTGGCACTGA
ACCTGTGACGGATGTAATTTCTACAATAAATGATCAAATCGAAAAGTTAG
AGAACAGAAAATTAAAATTATCTATTAGTGAAAAACAAGCTCGGATGAAA
GAATTATTAAGTAAAGGTCGTCAAAATTGGTCAAATTTCAAATCGGAAAT
TAATTTCATTAAATCTGTAGAATCAAATAGCGTAAATAAGATATGTAATG
ACTCCGAATACATGATTAAAGATGAAAAACTACTAAATGTTATTCTGAAC
GATATTGTAATTGGTGAAAAGGAGAATTTAAAAGACGATTTCTCTTATCT
CGACTTAAATAAAGAGGAAAATATAAATTTTACCCATAATCGTATGATTG
AAAAGAAATCGGAAAGTCAAGGTGACGAAAGTATAGAATTTAATTCAGTA
ATCAAGCCAATGAAAGAAAATTTTTCTTCTAACCAAATAACCGCTGGTAT
GGCAATGGATCTTAAACATTTGCTTTTCAATTCCACAAGTCGTTCTTGGG
GATCGGAATGGTACAAACAAAATTTTGATTTTCATTCTGTCAATACTGAA
GTATTCTTTGGAATAATTCAAAAATCTAGGGGTCCCAACAATGTTATGGC
AGCAATTCAGGCTGAGGTTTTGATTGAAACATTATTTCGGAGTGATTTAA
ATATCAACTGGTTCAATAAAATTAAGAAAAACAAAAGCAAAATTTTATCA
CTCGCCCTTTCAAATATTATCTCCCGTTGCAGAATTTCTGACTCATCTCC
AATAAATATTTGCCTACTGGACAGCTCTTTCAGAGGTAAAAGCATTGGGG
TTGTAAAGCCGGATGGAATAACAGAATGTTTAGTTATATATGAAATATTC
GATAAAGAACACTTAAAGAAATTCATTCTTCACCATATTAATCAATTTAC
TGATCCATGTTGCCCTGGATTGATTCTGCTGATCGTATCTTGCTTAATAA
CTCACGGTCTCAGCAATTGTAAAAACGAACTTAGCAACAAAACAATGAGG
CTTATAAACCCGTTAGGAGTTTCTAGTGATGAATTAATGAGTCTATTAAT
TCATGGTCATATCAGTTCTCATTATTTTAATGAGCAGCTGGAAATAATTG
ATTCCAATTCCAATCGACTATCGATTCTCCATGGAATATCTAAACGCAGT
TCTATTGGATATTTAACATTAGACAATCACTGTGAATATTGCCAACAGAT
TGGTACTTATCTGAAGACTCCTAAGTACCCTGTATGGTTGGTGAAATGGA
AGAATGATAACTATTGTGTAATGTTTTGTCACAATCAATCATTAATTAGT
GATTGGAAATCTGAAATCAGATTTACACTGTACATTTATTCTCCTTTATT
CCAAAGTGAAAAACTAATATCAGTGACAATAGATGCAAGCTCCACAGAAA
CTAAAAACCAGAAAATAAGAGAAGAAGAAAACAGGAAAAAAACTGAAAAA
GAAAGAGAAAATAAAAGTTTAACGGAAAAAAGATTAAAGAAAATGTCCGA
AAAGACACTTAAATTTCTTTTAGAAGATTGCTCAATCGAAGACTATCTTA
ATGAAAATGTTCACGAGATACCCGAAGAAGAATCTGACATGCAATATTTG
GATAAACTTATCCATATTAAATGGTCCAAGGCAACAATTACATTGGAAAA
TAATGAGATAAATATTTCGAAACTTTTTAAAAACTAAATAAATTCTGTG
back to top

protein sequence of SMED30012985-orf-1

>SMED30012985-orf-1 ID=SMED30012985-orf-1|Name=SMED30012985-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=696bp
MNSSQLNKKNDKNKFKNDIIISEDIETTESYAGVGGRNIVNCIKKEKIYY
SAGGKFDSNKSFSHFKAPQFDPSCELQESFYKELKSVSDHSKSNRSNSDG
IKSKLRKNEISKTENKSSIENSLPRLPIKSAGTEPVTDVISTINDQIEKL
ENRKLKLSISEKQARMKELLSKGRQNWSNFKSEINFIKSVESNSVNKICN
DSEYMIKDEKLLNVILNDIVIGEKENLKDDFSYLDLNKEENINFTHNRMI
EKKSESQGDESIEFNSVIKPMKENFSSNQITAGMAMDLKHLLFNSTSRSW
GSEWYKQNFDFHSVNTEVFFGIIQKSRGPNNVMAAIQAEVLIETLFRSDL
NINWFNKIKKNKSKILSLALSNIISRCRISDSSPINICLLDSSFRGKSIG
VVKPDGITECLVIYEIFDKEHLKKFILHHINQFTDPCCPGLILLIVSCLI
THGLSNCKNELSNKTMRLINPLGVSSDELMSLLIHGHISSHYFNEQLEII
DSNSNRLSILHGISKRSSIGYLTLDNHCEYCQQIGTYLKTPKYPVWLVKW
KNDNYCVMFCHNQSLISDWKSEIRFTLYIYSPLFQSEKLISVTIDASSTE
TKNQKIREEENRKKTEKERENKSLTEKRLKKMSEKTLKFLLEDCSIEDYL
NENVHEIPEEESDMQYLDKLIHIKWSKATITLENNEINISKLFKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039785MINY3/4
IPR025257DUF4205
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0006915apoptotic process
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 598..627
NoneNo IPR availableCOILSCoilCoilcoord: 140..172
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 87..114
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 603..626
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 87..126
IPR025257Domain of unknown function DUF4205SMARTSM01174DUF4205_3coord: 289..630
e-value: 1.3E-41
score: 154.2
IPR025257Domain of unknown function DUF4205PFAMPF13898DUF4205coord: 289..614
e-value: 1.5E-70
score: 237.9
IPR039785Ubiquitin carboxyl-terminal hydrolase MINDY-3/4PANTHERPTHR12473UNCHARACTERIZEDcoord: 109..681