slit-2

Overview
Nameslit-2 (AFJ24869.1)
Smed IDSMED30012984
Length (bp)1774
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slit-2 (SMED30012984) t-SNE clustered cells

Violin plots show distribution of expression levels for slit-2 (SMED30012984) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slit-2 (SMED30012984) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slit-2 (SMED30012984) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012984

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012984SMESG000033458.1 SmedASXL_011337SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30012984SMESG000033458.1 dd_Smed_v4_9153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30012984SMESG000033458.1 dd_Smed_v6_9153_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30012984SMESG000033458.1 OX_Smed_1.0.20500ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slit-2 vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 84.3445 bits (207), Expect = 3.562e-16
Identity = 84/254 (33.07%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+  SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  413 DLACPEKCR---CEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRL------------------------LSLYDNQITTVAPGAFDTL-HSLSTLNLLANPFNCNCYLAWLGEWL--RKKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 622          

HSP 2 Score: 70.0922 bits (170), Expect = 9.339e-12
Identity = 72/274 (26.28%), Postives = 116/274 (42.34%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I                          EI L++ TI       I   AFS    L+ +DLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C   +  R   K++ +  A+++C
Sbjct:  190 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETIT-------------------------EIRLEQNTIK-----VIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYR--SKLSGDCFADLAC 416          
BLAST of slit-2 vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 84.3445 bits (207), Expect = 3.845e-16
Identity = 84/254 (33.07%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+  SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  495 DLACPEKCR---CEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRL------------------------LSLYDNQITTVAPGAFDTL-HSLSTLNLLANPFNCNCYLAWLGEWL--RKKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 704          

HSP 2 Score: 70.0922 bits (170), Expect = 1.013e-11
Identity = 72/274 (26.28%), Postives = 116/274 (42.34%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I                          EI L++ TI       I   AFS    L+ +DLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C   +  R   K++ +  A+++C
Sbjct:  272 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETIT-------------------------EIRLEQNTIK-----VIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYR--SKLSGDCFADLAC 498          

HSP 3 Score: 51.6026 bits (122), Expect = 4.935e-6
Identity = 63/252 (25.00%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  199 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRL-LFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            CP  C   +C  + + C    L  +P N PR  +++ L+  N    R+T T+ +        L+ L +    +++IE  AF  L  L+ L L+ N L LF       +  L  L L  N+   + + +FRG V +++L +    +  +   + + +   L  L L +N +  LS   F+ + + L    L +N   C C L WL+  L+ R       P+  L       C  P +L+G ++  +    F C
Sbjct:   28 CPAQC---SCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNIT--RITKTDFAGLRH----LRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRD-LEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQR-------PRVGLYT----QCMGPSHLRGHNVAEVQKREFVC 257          
BLAST of slit-2 vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 83.9593 bits (206), Expect = 3.884e-16
Identity = 84/254 (33.07%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+  SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  503 DLACPEKCR---CEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRL------------------------LSLYDNQITTVAPGAFDTL-HSLSTLNLLANPFNCNCYLAWLGEWL--RKKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 712          

HSP 2 Score: 72.4034 bits (176), Expect = 1.759e-12
Identity = 73/280 (26.07%), Postives = 117/280 (41.79%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I                          EI L++ TI       I   AFS    L+ +DLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C       IP  +    K++ +  A+++C
Sbjct:  272 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETIT-------------------------EIRLEQNTIK-----VIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLAC 506          

HSP 3 Score: 51.6026 bits (122), Expect = 5.067e-6
Identity = 63/252 (25.00%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  199 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRL-LFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            CP  C   +C  + + C    L  +P N PR  +++ L+  N    R+T T+ +        L+ L +    +++IE  AF  L  L+ L L+ N L LF       +  L  L L  N+   + + +FRG V +++L +    +  +   + + +   L  L L +N +  LS   F+ + + L    L +N   C C L WL+  L+ R       P+  L       C  P +L+G ++  +    F C
Sbjct:   28 CPAQC---SCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNIT--RITKTDFAGLRH----LRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRD-LEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQR-------PRVGLYT----QCMGPSHLRGHNVAEVQKREFVC 257          
BLAST of slit-2 vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 83.9593 bits (206), Expect = 3.893e-16
Identity = 84/254 (33.07%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+  SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  507 DLACPEKCR---CEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRL------------------------LSLYDNQITTVAPGAFDTL-HSLSTLNLLANPFNCNCYLAWLGEWL--RKKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 716          

HSP 2 Score: 72.4034 bits (176), Expect = 1.970e-12
Identity = 73/280 (26.07%), Postives = 117/280 (41.79%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I                          EI L++ TI       I   AFS    L+ +DLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C       IP  +    K++ +  A+++C
Sbjct:  276 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETIT-------------------------EIRLEQNTIK-----VIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLAC 510          

HSP 3 Score: 51.6026 bits (122), Expect = 4.988e-6
Identity = 63/252 (25.00%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  199 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRL-LFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            CP  C   +C  + + C    L  +P N PR  +++ L+  N    R+T T+ +        L+ L +    +++IE  AF  L  L+ L L+ N L LF       +  L  L L  N+   + + +FRG V +++L +    +  +   + + +   L  L L +N +  LS   F+ + + L    L +N   C C L WL+  L+ R       P+  L       C  P +L+G ++  +    F C
Sbjct:   28 CPAQC---SCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNIT--RITKTDFAGLRH----LRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRD-LEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQR-------PRVGLYT----QCMGPSHLRGHNVAEVQKREFVC 257          
BLAST of slit-2 vs. Ensembl Human
Match: SLIT2 (slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGNC:11086])

HSP 1 Score: 83.9593 bits (206), Expect = 3.949e-16
Identity = 84/254 (33.07%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+  SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  499 DLACPEKCR---CEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRL------------------------LSLYDNQITTVAPGAFDTL-HSLSTLNLLANPFNCNCYLAWLGEWL--RKKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 708          

HSP 2 Score: 69.707 bits (169), Expect = 1.040e-11
Identity = 72/274 (26.28%), Postives = 116/274 (42.34%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I                          EI L++ TI       I   AFS    L+ +DLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C   +  R   K++ +  A+++C
Sbjct:  276 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETIT-------------------------EIRLEQNTIK-----VIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYR--SKLSGDCFADLAC 502          

HSP 3 Score: 51.2174 bits (121), Expect = 5.377e-6
Identity = 63/252 (25.00%), Postives = 109/252 (43.25%), Query Frame = 1
Query:  199 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRL-LFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            CP  C   +C  + + C    L  +P N PR  +++ L+  N    R+T T+ +        L+ L +    +++IE  AF  L  L+ L L+ N L LF       +  L  L L  N+   + + +FRG V +++L +    +  +   + + +   L  L L +N +  LS   F+ + + L    L +N   C C L WL+  L+ R       P+  L       C  P +L+G ++  +    F C
Sbjct:   28 CPAQC---SCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNIT--RITKTDFAGLRH----LRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRD-LEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQR-------PRVGLYT----QCMGPSHLRGHNVAEVQKREFVC 257          
BLAST of slit-2 vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 68.1662 bits (165), Expect = 1.434e-11
Identity = 78/275 (28.36%), Postives = 123/275 (44.73%), Query Frame = 1
Query:  187 KDSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFK-SLSLKTLVLDSNRNLQLAKDSFRG-LVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEI 1005
            + + CP  C    C    + C    L ++P N P    ++ L +       +T    + + S  + LK L + +  + +I +++FS L++LQ+L LS NR+  +  N F+ +L L  L L  N    ++    +G   ++ L++   H+  L +  I      L  L L  NRL       +  FR LD   L NNP+NC C+L+W+   L+    +               VC  P NL+GSSIE L      C   + +R   K T E TAEI
Sbjct:   13 ESATCPAEC---VCVDRTVSCVGQQLTEVPQNIPNDTIRLDLQDN-----EITKIGPNDFSSL-MNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNRIRHLPDNVFQNNLKLTHLDLSENDITVVSDAQLQGPEFLEVLNLDKNHIFCLENNVISSWVS-LEVLTLNGNRLTTFEEPSNARFRQLD---LFNNPWNCDCRLRWMRKWLEKAEGQNKT------------VCATPLNLQGSSIEILQDKFMTCSGNRKRR--YKKTCE-TAEI 259          

HSP 2 Score: 55.0694 bits (131), Expect = 1.655e-7
Identity = 72/252 (28.57%), Postives = 97/252 (38.49%), Query Frame = 1
Query:  199 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLA-LTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ 948
            CP  C    C  T + C   GL  +P N P               P  T          EI L++  IS     SI S +F +L  L  LDLS N +  I P  F  L +L TLVL  N    L  D+F GL    L + + +               L+ L+L DN ++ +S         L  L+L  NP  C C L+WLA + LQ              +  +   CE PK L+      L    F+C+
Sbjct:  260 CPLPC---TCTGTTVDCRDSGLTYVPTNLP---------------PSTT----------EIRLEQNQIS-----SIPSHSFKNLKNLTRLDLSKNIITEIQPKAFLGLHNLHTLVLYGNNITDLKSDTFEGLGSLQLLLLNANQLTCIRRGTFDHVPKLSMLSLYDNDIKSISEVTFQNLTSLSTLHLAKNPLICDCNLQWLAQINLQKN------------IETSGARCEQPKRLRKKKFATLPPNKFKCK 466          
BLAST of slit-2 vs. Ensembl Celegans
Match: lron-9 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:O02329])

HSP 1 Score: 56.9954 bits (136), Expect = 3.128e-8
Identity = 52/211 (24.64%), Postives = 96/211 (45.50%), Query Frame = 1
Query:  385 LKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLS--LKTLVLDSN-------------RNLQLAKDSFRGLV---------VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNP-VCEYPKNLKGSSIENLSIVSFQ 942
            L +L+++   ++ +E + F  L  L+ELDL  N +  I  + FK L+  LKT+ L +N               L LA+  F  +          ++ L +  C++  +   + +     L  LNL  N+L+ L N    L   +++L++ +NP+ C  +L      ++ R K+ + +     +  TN  VC+ P  L+G  I  + +  FQ
Sbjct:  306 LTRLSLAGNFISKLEPDVFFGLSSLEELDLGWNEIKTIPTDVFKPLTDKLKTISLRNNPISELPSTGLGMLEKLSLAECGFTSISADQLKDYPKLEELDLSKCNISNIVENTFENQKDSLKKLNLQKNKLKSLPNLIKNL-PAIESLDVSSNPYRCDGELVNFVFGVEDRVKKAEENGNSFFVANTNETVCDRPYTLRGEQILQVEVEKFQ 515          
BLAST of slit-2 vs. Ensembl Celegans
Match: lron-9 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:O02329])

HSP 1 Score: 56.9954 bits (136), Expect = 3.128e-8
Identity = 52/211 (24.64%), Postives = 96/211 (45.50%), Query Frame = 1
Query:  385 LKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLS--LKTLVLDSN-------------RNLQLAKDSFRGLV---------VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNP-VCEYPKNLKGSSIENLSIVSFQ 942
            L +L+++   ++ +E + F  L  L+ELDL  N +  I  + FK L+  LKT+ L +N               L LA+  F  +          ++ L +  C++  +   + +     L  LNL  N+L+ L N    L   +++L++ +NP+ C  +L      ++ R K+ + +     +  TN  VC+ P  L+G  I  + +  FQ
Sbjct:  306 LTRLSLAGNFISKLEPDVFFGLSSLEELDLGWNEIKTIPTDVFKPLTDKLKTISLRNNPISELPSTGLGMLEKLSLAECGFTSISADQLKDYPKLEELDLSKCNISNIVENTFENQKDSLKKLNLQKNKLKSLPNLIKNL-PAIESLDVSSNPYRCDGELVNFVFGVEDRVKKAEENGNSFFVANTNETVCDRPYTLRGEQILQVEVEKFQ 515          
BLAST of slit-2 vs. Ensembl Celegans
Match: lron-9 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:O02329])

HSP 1 Score: 56.6102 bits (135), Expect = 3.455e-8
Identity = 52/211 (24.64%), Postives = 96/211 (45.50%), Query Frame = 1
Query:  385 LKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLS--LKTLVLDSN-------------RNLQLAKDSFRGLV---------VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNP-VCEYPKNLKGSSIENLSIVSFQ 942
            L +L+++   ++ +E + F  L  L+ELDL  N +  I  + FK L+  LKT+ L +N               L LA+  F  +          ++ L +  C++  +   + +     L  LNL  N+L+ L N    L   +++L++ +NP+ C  +L      ++ R K+ + +     +  TN  VC+ P  L+G  I  + +  FQ
Sbjct:  306 LTRLSLAGNFISKLEPDVFFGLSSLEELDLGWNEIKTIPTDVFKPLTDKLKTISLRNNPISELPSTGLGMLEKLSLAECGFTSISADQLKDYPKLEELDLSKCNISNIVENTFENQKDSLKKLNLQKNKLKSLPNLIKNL-PAIESLDVSSNPYRCDGELVNFVFGVEDRVKKAEENGNSFFVANTNETVCDRPYTLRGEQILQVEVEKFQ 515          
BLAST of slit-2 vs. Ensembl Celegans
Match: lron-11 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:A0A078BS18])

HSP 1 Score: 54.6842 bits (130), Expect = 1.421e-7
Identity = 60/210 (28.57%), Postives = 94/210 (44.76%), Query Frame = 1
Query:  385 LKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGL-VVQSLSMKDC-HLKILTHESIKQISGY-----------------------LTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSF 939
            LK L +S   +  IE  A   L  L+ L+L++N+L+ +  NT+   +LKTL L SN  + L   SF GL  +Q L++    +LK +   +  Q+S                         L+ L+L++N L Y++    L +  + NL+L NN ++CSC L+   L  +   K                 C  P+NL G+ I  LS  S 
Sbjct:  215 LKHLDVSENLIGDIEEGALYGLEKLETLNLTNNQLVRLPGNTWSLPALKTLDLSSNLFVSLETASFDGLPALQYLNISHSRNLKTIQMATFVQLSSLHWLSISSSALTHIHPSAFNPIPPLSHLDLSNNELRYVAPGM-LQWPNIRNLHLANNDWHCSCDLRVSNLNPRDDAK-----------------CSGPENLAGAPINELSSCSI 406          
BLAST of slit-2 vs. Ensembl Fly
Match: kek3 (gene:FBgn0028370 transcript:FBtr0300848)

HSP 1 Score: 83.1889 bits (204), Expect = 2.920e-16
Identity = 91/298 (30.54%), Postives = 127/298 (42.62%), Query Frame = 1
Query:  193 SECPELCNQGACKLTM----LLCETPGLLQIPMNPPRGIQKVILS-NQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLS-LKTLVLDSNRNLQLAKDSFRGLVVQ--SLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWL-ALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTS----EITAEISCISDDMSNSQVKW 1047
            +ECP +C    CK       +LC    L  IP     G Q + LS N+  L P  ++       ++ + L+K+ ++ C L  IE  AF  LI L ELDLS N L  I       +S L+ L L  N  L++  D+F G V Q   L + DC L  +   +   +   L  L L  NRL  + +        L  L L  N +NCSC L+ L A  LQ       N P         P CE P  L G + + L +  F C +P++   D          IT  +SC  + +    VKW
Sbjct:   77 AECPAVCE---CKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFAT-----AQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAF-GHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQ------QNIPSG-----IPPTCESPPRLSGRAWDKLDVDDFAC-VPQIVATDTTAHGVEGRNIT--MSCYVEGVPQPAVKW 351          
BLAST of slit-2 vs. Ensembl Fly
Match: kek3 (gene:FBgn0028370 transcript:FBtr0080752)

HSP 1 Score: 83.1889 bits (204), Expect = 2.920e-16
Identity = 91/298 (30.54%), Postives = 127/298 (42.62%), Query Frame = 1
Query:  193 SECPELCNQGACKLTM----LLCETPGLLQIPMNPPRGIQKVILS-NQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLS-LKTLVLDSNRNLQLAKDSFRGLVVQ--SLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWL-ALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTS----EITAEISCISDDMSNSQVKW 1047
            +ECP +C    CK       +LC    L  IP     G Q + LS N+  L P  ++       ++ + L+K+ ++ C L  IE  AF  LI L ELDLS N L  I       +S L+ L L  N  L++  D+F G V Q   L + DC L  +   +   +   L  L L  NRL  + +        L  L L  N +NCSC L+ L A  LQ       N P         P CE P  L G + + L +  F C +P++   D          IT  +SC  + +    VKW
Sbjct:   77 AECPAVCE---CKWKSGKESVLCLNANLTHIPQPLDAGTQLLDLSGNEIQLIPDDSFAT-----AQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLLSAIPSLALYHVSELRELRLSGNPILRVPDDAF-GHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTITSLASLHGLELARNTWNCSCSLRPLRAWMLQ------QNIPSG-----IPPTCESPPRLSGRAWDKLDVDDFAC-VPQIVATDTTAHGVEGRNIT--MSCYVEGVPQPAVKW 351          
BLAST of slit-2 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330730)

HSP 1 Score: 72.4034 bits (176), Expect = 8.419e-13
Identity = 71/254 (27.95%), Postives = 115/254 (45.28%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYL-SNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            ++ CP +C   +C    + C   GL  +P      ++++ L   N     +  T+  R       L+ L +++  + +IE  +F  L+ L+ LD+S+N +  +    FK   SL++L LD+N+   L + +F+GLV          L+ILT               L +N L  L  N F  L R L  L L +NPF C C L WL+  L++ T+         L   T   C+ P  LKG ++ +L    F+C
Sbjct:   70 EARCPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTV--IYETDFQRL----TKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLV---------ELEILT---------------LNNNNLTSLPHNIFGGLGR-LRALRLSDNPFACDCHLSWLSRFLRSATR---------LAPYTR--CQSPSQLKGQNVADLHDQEFKC 278          

HSP 2 Score: 66.6254 bits (161), Expect = 5.144e-11
Identity = 66/254 (25.98%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLS-LKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLE-YLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            DS+CP +C+   C+ T + C   GL +IP + P    +++L++            L R  S+ +                   F  L +L +L+L  N+L  I PN F+  S ++ L L  N+  +++   F GL                H+        L TLNL DN++   +   F+ L   L +LNL +NPFNC+C L W A  L+ ++           L      C  P  ++   I++L    F+C
Sbjct:  516 DSDCPAMCH---CEGTTVDCTGRGLKEIPRDIPLHTTELLLND----------NELGRISSDGL-------------------FGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGL----------------HQ--------LKTLNLYDNQISCVMPGSFEHL-NSLTSLNLASNPFNCNCHLAWFAEWLRKKS-----------LNGGAARCGAPSKVRDVQIKDLPHSEFKC 701          

HSP 3 Score: 53.1434 bits (126), Expect = 7.618e-7
Identity = 68/278 (24.46%), Postives = 117/278 (42.09%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFL--YPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVL-DSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSND-FDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
            ++ CP  C    C   ++ C    L  +P+  P    ++ L  QNF+   P  ++++  R       L+++ +SN +++ I  +A S L  L  L L  N++  +    FK L    L+L ++N    + KD+FR L   SL                            DN ++ L+N  FD + + +  ++L  NPF C C L+WLA  L               +  +   CE PK +    IE+L    F+C   +L+   +K++ E   +  C
Sbjct:  292 ENSCPHPCR---CADGIVDCREKSLTSVPVTLPDDTTELRLE-QNFITELPPKSFSSFRR-------LRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSL------------------------YDNNIQSLANGTFDAM-KSIKTVHLAKNPFICDCNLRWLADYLHKNP-----------IETSGARCESPKRMHRRRIESLREEKFKCSWDELR---MKLSGECRMDSDC 519          
BLAST of slit-2 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330729)

HSP 1 Score: 72.4034 bits (176), Expect = 8.957e-13
Identity = 71/254 (27.95%), Postives = 115/254 (45.28%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYL-SNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            ++ CP +C   +C    + C   GL  +P      ++++ L   N     +  T+  R       L+ L +++  + +IE  +F  L+ L+ LD+S+N +  +    FK   SL++L LD+N+   L + +F+GLV          L+ILT               L +N L  L  N F  L R L  L L +NPF C C L WL+  L++ T+         L   T   C+ P  LKG ++ +L    F+C
Sbjct:   70 EARCPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTV--IYETDFQRL----TKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLV---------ELEILT---------------LNNNNLTSLPHNIFGGLGR-LRALRLSDNPFACDCHLSWLSRFLRSATR---------LAPYTR--CQSPSQLKGQNVADLHDQEFKC 278          

HSP 2 Score: 66.6254 bits (161), Expect = 4.978e-11
Identity = 66/254 (25.98%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLS-LKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLE-YLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            DS+CP +C+   C+ T + C   GL +IP + P    +++L++            L R  S+ +                   F  L +L +L+L  N+L  I PN F+  S ++ L L  N+  +++   F GL                H+        L TLNL DN++   +   F+ L   L +LNL +NPFNC+C L W A  L+ ++           L      C  P  ++   I++L    F+C
Sbjct:  516 DSDCPAMCH---CEGTTVDCTGRGLKEIPRDIPLHTTELLLND----------NELGRISSDGL-------------------FGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGL----------------HQ--------LKTLNLYDNQISCVMPGSFEHL-NSLTSLNLASNPFNCNCHLAWFAEWLRKKS-----------LNGGAARCGAPSKVRDVQIKDLPHSEFKC 701          

HSP 3 Score: 53.1434 bits (126), Expect = 8.307e-7
Identity = 68/278 (24.46%), Postives = 117/278 (42.09%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFL--YPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVL-DSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSND-FDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
            ++ CP  C    C   ++ C    L  +P+  P    ++ L  QNF+   P  ++++  R       L+++ +SN +++ I  +A S L  L  L L  N++  +    FK L    L+L ++N    + KD+FR L   SL                            DN ++ L+N  FD + + +  ++L  NPF C C L+WLA  L               +  +   CE PK +    IE+L    F+C   +L+   +K++ E   +  C
Sbjct:  292 ENSCPHPCR---CADGIVDCREKSLTSVPVTLPDDTTELRLE-QNFITELPPKSFSSFRR-------LRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSL------------------------YDNNIQSLANGTFDAM-KSIKTVHLAKNPFICDCNLRWLADYLHKNP-----------IETSGARCESPKRMHRRRIESLREEKFKCSWDELR---MKLSGECRMDSDC 519          
BLAST of slit-2 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330732)

HSP 1 Score: 72.4034 bits (176), Expect = 8.957e-13
Identity = 71/254 (27.95%), Postives = 115/254 (45.28%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYL-SNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            ++ CP +C   +C    + C   GL  +P      ++++ L   N     +  T+  R       L+ L +++  + +IE  +F  L+ L+ LD+S+N +  +    FK   SL++L LD+N+   L + +F+GLV          L+ILT               L +N L  L  N F  L R L  L L +NPF C C L WL+  L++ T+         L   T   C+ P  LKG ++ +L    F+C
Sbjct:   70 EARCPRVC---SCTGLNVDCSHRGLTSVPRKISADVERLELQGNNLTV--IYETDFQRL----TKLRMLQLTDNQIHTIERNSFQDLVSLERLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLV---------ELEILT---------------LNNNNLTSLPHNIFGGLGR-LRALRLSDNPFACDCHLSWLSRFLRSATR---------LAPYTR--CQSPSQLKGQNVADLHDQEFKC 278          

HSP 2 Score: 66.6254 bits (161), Expect = 4.978e-11
Identity = 66/254 (25.98%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLS-LKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLE-YLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            DS+CP +C+   C+ T + C   GL +IP + P    +++L++            L R  S+ +                   F  L +L +L+L  N+L  I PN F+  S ++ L L  N+  +++   F GL                H+        L TLNL DN++   +   F+ L   L +LNL +NPFNC+C L W A  L+ ++           L      C  P  ++   I++L    F+C
Sbjct:  516 DSDCPAMCH---CEGTTVDCTGRGLKEIPRDIPLHTTELLLND----------NELGRISSDGL-------------------FGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIKEISNKMFLGL----------------HQ--------LKTLNLYDNQISCVMPGSFEHL-NSLTSLNLASNPFNCNCHLAWFAEWLRKKS-----------LNGGAARCGAPSKVRDVQIKDLPHSEFKC 701          

HSP 3 Score: 53.1434 bits (126), Expect = 8.307e-7
Identity = 68/278 (24.46%), Postives = 117/278 (42.09%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFL--YPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVL-DSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSND-FDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
            ++ CP  C    C   ++ C    L  +P+  P    ++ L  QNF+   P  ++++  R       L+++ +SN +++ I  +A S L  L  L L  N++  +    FK L    L+L ++N    + KD+FR L   SL                            DN ++ L+N  FD + + +  ++L  NPF C C L+WLA  L               +  +   CE PK +    IE+L    F+C   +L+   +K++ E   +  C
Sbjct:  292 ENSCPHPCR---CADGIVDCREKSLTSVPVTLPDDTTELRLE-QNFITELPPKSFSSFRR-------LRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSL------------------------YDNNIQSLANGTFDAM-KSIKTVHLAKNPFICDCNLRWLADYLHKNP-----------IETSGARCESPKRMHRRRIESLREEKFKCSWDELR---MKLSGECRMDSDC 519          
BLAST of slit-2 vs. Ensembl Zebrafish
Match: lrrc4cb (leucine rich repeat containing 4C, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-080327-5])

HSP 1 Score: 82.8037 bits (203), Expect = 3.832e-16
Identity = 72/248 (29.03%), Postives = 112/248 (45.16%), Query Frame = 1
Query:  385 LKKLTISNCSLTSIESEAFSHLIYLQELDLSS-NRLLFIYPNTFKSLS-----------------------LKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQR--IDIKVTSEITAEISCISDDMSNSQVKW 1047
            LK+L + N  + SI S+AFS L  L+ LDL    RL +I    F+ LS                       L  L +  N+   +   SF+GLV +Q L M    ++ +   S   +   L  LNLA N L +L +D       L  ++L +NP+NC+C + WL+  L      R+  P ++        C  P +LKG  I  L    FQC  P +    +D+ +T  + AE+ C ++ +++  V W
Sbjct:  151 LKELWLRNNPIESIPSDAFSRLPSLRRLDLGELKRLSYISSGAFQGLSNLRYLNLGMCNLKEVPNIQPLIRLDELEMSGNQLTVIQPSSFKGLVHLQKLWMMHAQVQTIERNSFDDLHS-LRELNLAHNNLTFLPHDLYTPLHHLQRVHLHHNPWNCNCDILWLSWWL------RETVPTNTSCCAR---CNSPPSLKGRYIGELDQSYFQCYAPVIIEPPVDLNLTEGMAAELKCRTNSVTS--VSW 386          
BLAST of slit-2 vs. Ensembl Zebrafish
Match: lrrc4cb (leucine rich repeat containing 4C, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-080327-5])

HSP 1 Score: 82.8037 bits (203), Expect = 3.832e-16
Identity = 72/248 (29.03%), Postives = 112/248 (45.16%), Query Frame = 1
Query:  385 LKKLTISNCSLTSIESEAFSHLIYLQELDLSS-NRLLFIYPNTFKSLS-----------------------LKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQR--IDIKVTSEITAEISCISDDMSNSQVKW 1047
            LK+L + N  + SI S+AFS L  L+ LDL    RL +I    F+ LS                       L  L +  N+   +   SF+GLV +Q L M    ++ +   S   +   L  LNLA N L +L +D       L  ++L +NP+NC+C + WL+  L      R+  P ++        C  P +LKG  I  L    FQC  P +    +D+ +T  + AE+ C ++ +++  V W
Sbjct:  151 LKELWLRNNPIESIPSDAFSRLPSLRRLDLGELKRLSYISSGAFQGLSNLRYLNLGMCNLKEVPNIQPLIRLDELEMSGNQLTVIQPSSFKGLVHLQKLWMMHAQVQTIERNSFDDLHS-LRELNLAHNNLTFLPHDLYTPLHHLQRVHLHHNPWNCNCDILWLSWWL------RETVPTNTSCCAR---CNSPPSLKGRYIGELDQSYFQCYAPVIIEPPVDLNLTEGMAAELKCRTNSVTS--VSW 386          
BLAST of slit-2 vs. Ensembl Zebrafish
Match: slit2 (slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-3])

HSP 1 Score: 78.9518 bits (193), Expect = 9.118e-15
Identity = 80/255 (31.37%), Postives = 115/255 (45.10%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ 948
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+ +SN  +T IE   F     + EL L+SNRL  ++ +  K L  L+TL+L SNR   +   SF GL    L                        L+L DN +  +S   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I+++++  F C+
Sbjct:  486 DLACPEKCR---CEGTTVDCSGQKLTKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINLSNNKITDIEEGTFEGASGVNELILTSNRLEGVHYSMLKGLGGLRTLMLRSNRISCVNNGSFTGLSSVRL------------------------LSLYDNLITSMSPGAFDTL-HSLSTLNLLANPFNCNCHLAWLGEWL--RKKR---------IVTGNPRCQSPYFLKEIPIQDVAVQDFACE 696          

HSP 2 Score: 74.7146 bits (182), Expect = 2.150e-13
Identity = 76/274 (27.74%), Postives = 122/274 (44.53%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
            +CPELC    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I + AF+    L+ +DLS+N++  +  ++F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  +S + +   L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  LQ      DN  + S  R     C  P+ L    I  +    F+C    ++    K+  +  A+++C
Sbjct:  263 QCPELC---TCSNNVVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------SIKIIPAGAFAPYKRLRRIDLSNNQITELASDSFQGLRSLNSLVLYGNKITELPKGLFDGLFSLQLLLLNANKINCLRVDSFQDLQN-LNLLSLYDNKLQTIAKGTFSSLRAIQTLHLAQNPFMCDCHLKWLADYLQ------DNPIETSGAR-----CTSPRRLANKRIGQIKSKKFRCS--GVEDYRSKLGGDCFADLAC 489          
BLAST of slit-2 vs. Ensembl Zebrafish
Match: slit2 (slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-3])

HSP 1 Score: 78.9518 bits (193), Expect = 9.242e-15
Identity = 80/255 (31.37%), Postives = 115/255 (45.10%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ 948
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+ +SN  +T IE   F     + EL L+SNRL  ++ +  K L  L+TL+L SNR   +   SF GL    L                        L+L DN +  +S   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I+++++  F C+
Sbjct:  486 DLACPEKCR---CEGTTVDCSGQKLTKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINLSNNKITDIEEGTFEGASGVNELILTSNRLEGVHYSMLKGLGGLRTLMLRSNRISCVNNGSFTGLSSVRL------------------------LSLYDNLITSMSPGAFDTL-HSLSTLNLLANPFNCNCHLAWLGEWL--RKKR---------IVTGNPRCQSPYFLKEIPIQDVAVQDFACE 696          

HSP 2 Score: 74.3294 bits (181), Expect = 2.587e-13
Identity = 76/274 (27.74%), Postives = 122/274 (44.53%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
            +CPELC    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I + AF+    L+ +DLS+N++  +  ++F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  +S + +   L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  LQ      DN  + S  R     C  P+ L    I  +    F+C    ++    K+  +  A+++C
Sbjct:  263 QCPELC---TCSNNVVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------SIKIIPAGAFAPYKRLRRIDLSNNQITELASDSFQGLRSLNSLVLYGNKITELPKGLFDGLFSLQLLLLNANKINCLRVDSFQDLQN-LNLLSLYDNKLQTIAKGTFSSLRAIQTLHLAQNPFMCDCHLKWLADYLQ------DNPIETSGAR-----CTSPRRLANKRIGQIKSKKFRCS--GVEDYRSKLGGDCFADLAC 489          
BLAST of slit-2 vs. Ensembl Zebrafish
Match: slit2 (slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-3])

HSP 1 Score: 78.9518 bits (193), Expect = 9.262e-15
Identity = 80/255 (31.37%), Postives = 115/255 (45.10%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ 948
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+ +SN  +T IE   F     + EL L+SNRL  ++ +  K L  L+TL+L SNR   +   SF GL    L                        L+L DN +  +S   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I+++++  F C+
Sbjct:  486 DLACPEKCR---CEGTTVDCSGQKLTKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINLSNNKITDIEEGTFEGASGVNELILTSNRLEGVHYSMLKGLGGLRTLMLRSNRISCVNNGSFTGLSSVRL------------------------LSLYDNLITSMSPGAFDTL-HSLSTLNLLANPFNCNCHLAWLGEWL--RKKR---------IVTGNPRCQSPYFLKEIPIQDVAVQDFACE 696          

HSP 2 Score: 74.7146 bits (182), Expect = 2.222e-13
Identity = 76/274 (27.74%), Postives = 122/274 (44.53%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
            +CPELC    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I + AF+    L+ +DLS+N++  +  ++F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  +S + +   L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  LQ      DN  + S  R     C  P+ L    I  +    F+C    ++    K+  +  A+++C
Sbjct:  263 QCPELC---TCSNNVVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------SIKIIPAGAFAPYKRLRRIDLSNNQITELASDSFQGLRSLNSLVLYGNKITELPKGLFDGLFSLQLLLLNANKINCLRVDSFQDLQN-LNLLSLYDNKLQTIAKGTFSSLRAIQTLHLAQNPFMCDCHLKWLADYLQ------DNPIETSGAR-----CTSPRRLANKRIGQIKSKKFRCS--GVEDYRSKLGGDCFADLAC 489          
BLAST of slit-2 vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 83.9593 bits (206), Expect = 4.590e-16
Identity = 83/254 (32.68%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+ +SN  +T IE  AF     + EL L+SNR+  +    FK L  LKTL+L SNR   +  DSF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  518 DLACPEKCR---CEGTTVDCSNQKLTKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINLSNNKITDIEEGAFEGANGVNELLLTSNRMENVRHKMFKGLEGLKTLMLRSNRISCVNNDSFTGLSSVRL------------------------LSLYDNQITTVAPGAFDTL-HSLSTLNLLANPFNCNCHLAWLGDWL--RKKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 727          

HSP 2 Score: 69.707 bits (169), Expect = 1.043e-11
Identity = 75/286 (26.22%), Postives = 119/286 (41.61%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDI------KVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ +DLS+N++  I  + F+ L SL +LVL  N+  +L K  F GLV+  L + + + +  L  +S + +   L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C       IP +  +        K++ +  A+++C
Sbjct:  281 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEMRLE-QN-----------------------------SIKVIPPGAFSPYKKLRRIDLSNNQISEIAADAFQGLRSLNSLVLYGNKITELPKGLFEGLVLLQLLLLNANKINCLRVDSFQDLHN-LNLLSLYDNKLQTIAKGTFAPLRAIQTLHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSAQEQYFIPGIHHLGCTEDYRSKLSGDCFADLAC 521          
BLAST of slit-2 vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 83.5741 bits (205), Expect = 4.671e-16
Identity = 83/254 (32.68%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+ +SN  +T IE  AF     + EL L+SNR+  +    FK L  LKTL+L SNR   +  DSF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  518 DLACPEKCR---CEGTTVDCSNQKLTKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINLSNNKITDIEEGAFEGANGVNELLLTSNRMENVRHKMFKGLEGLKTLMLRSNRISCVNNDSFTGLSSVRL------------------------LSLYDNQITTVAPGAFDTL-HSLSTLNLLANPFNCNCHLAWLGDWL--RKKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 727          

HSP 2 Score: 69.707 bits (169), Expect = 1.026e-11
Identity = 75/286 (26.22%), Postives = 119/286 (41.61%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDI------KVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ +DLS+N++  I  + F+ L SL +LVL  N+  +L K  F GLV+  L + + + +  L  +S + +   L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C       IP +  +        K++ +  A+++C
Sbjct:  281 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEMRLE-QN-----------------------------SIKVIPPGAFSPYKKLRRIDLSNNQISEIAADAFQGLRSLNSLVLYGNKITELPKGLFEGLVLLQLLLLNANKINCLRVDSFQDLHN-LNLLSLYDNKLQTIAKGTFAPLRAIQTLHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSAQEQYFIPGIHHLGCTEDYRSKLSGDCFADLAC 521          
BLAST of slit-2 vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 83.5741 bits (205), Expect = 4.761e-16
Identity = 83/254 (32.68%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+ +SN  +T IE  AF     + EL L+SNR+  +    FK L  LKTL+L SNR   +  DSF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  518 DLACPEKCR---CEGTTVDCSNQKLTKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINLSNNKITDIEEGAFEGANGVNELLLTSNRMENVRHKMFKGLEGLKTLMLRSNRISCVNNDSFTGLSSVRL------------------------LSLYDNQITTVAPGAFDTL-HSLSTLNLLANPFNCNCHLAWLGDWL--RKKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 727          

HSP 2 Score: 69.707 bits (169), Expect = 1.054e-11
Identity = 75/286 (26.22%), Postives = 119/286 (41.61%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDI------KVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ +DLS+N++  I  + F+ L SL +LVL  N+  +L K  F GLV+  L + + + +  L  +S + +   L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C       IP +  +        K++ +  A+++C
Sbjct:  281 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEMRLE-QN-----------------------------SIKVIPPGAFSPYKKLRRIDLSNNQISEIAADAFQGLRSLNSLVLYGNKITELPKGLFEGLVLLQLLLLNANKINCLRVDSFQDLHN-LNLLSLYDNKLQTIAKGTFAPLRAIQTLHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSAQEQYFIPGIHHLGCTEDYRSKLSGDCFADLAC 521          
BLAST of slit-2 vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 83.5741 bits (205), Expect = 5.092e-16
Identity = 83/254 (32.68%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+ +SN  +T IE  AF     + EL L+SNR+  +    FK L  LKTL+L SNR   +  DSF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  480 DLACPEKCR---CEGTTVDCSNQKLTKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINLSNNKITDIEEGAFEGANGVNELLLTSNRMENVRHKMFKGLEGLKTLMLRSNRISCVNNDSFTGLSSVRL------------------------LSLYDNQITTVAPGAFDTL-HSLSTLNLLANPFNCNCHLAWLGDWL--RKKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 689          

HSP 2 Score: 70.0922 bits (170), Expect = 9.334e-12
Identity = 74/274 (27.01%), Postives = 117/274 (42.70%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ +DLS+N++  I  + F+ L SL +LVL  N+  +L K  F GLV+  L + + + +  L  +S + +   L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C   +  R   K++ +  A+++C
Sbjct:  257 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEMRLE-QN-----------------------------SIKVIPPGAFSPYKKLRRIDLSNNQISEIAADAFQGLRSLNSLVLYGNKITELPKGLFEGLVLLQLLLLNANKINCLRVDSFQDLHN-LNLLSLYDNKLQTIAKGTFAPLRAIQTLHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYR--SKLSGDCFADLAC 483          
BLAST of slit-2 vs. Ensembl Xenopus
Match: atad3a (ATPase family, AAA domain containing 3A [Source:Xenbase;Acc:XB-GENE-946129])

HSP 1 Score: 83.5741 bits (205), Expect = 5.226e-16
Identity = 83/254 (32.68%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+ +SN  +T IE  AF     + EL L+SNR+  +    FK L  LKTL+L SNR   +  DSF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  518 DLACPEKCR---CEGTTVDCSNQKLTKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINLSNNKITDIEEGAFEGANGVNELLLTSNRMENVRHKMFKGLEGLKTLMLRSNRISCVNNDSFTGLSSVRL------------------------LSLYDNQITTVAPGAFDTL-HSLSTLNLLANPFNCNCHLAWLGDWL--RKKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 727          

HSP 2 Score: 69.3218 bits (168), Expect = 1.280e-11
Identity = 75/286 (26.22%), Postives = 119/286 (41.61%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDI------KVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ +DLS+N++  I  + F+ L SL +LVL  N+  +L K  F GLV+  L + + + +  L  +S + +   L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C       IP +  +        K++ +  A+++C
Sbjct:  281 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEMRLE-QN-----------------------------SIKVIPPGAFSPYKKLRRIDLSNNQISEIAADAFQGLRSLNSLVLYGNKITELPKGLFEGLVLLQLLLLNANKINCLRVDSFQDLHN-LNLLSLYDNKLQTIAKGTFAPLRAIQTLHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSAQEQYFIPGIHHLGCTEDYRSKLSGDCFADLAC 521          
BLAST of slit-2 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 86.2705 bits (212), Expect = 3.920e-17
Identity = 84/254 (33.07%), Postives = 117/254 (46.06%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+  SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL                        G +  L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  495 DLACPEKCR---CEGTTVDCSNQRLNKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGL------------------------GSVRLLSLYDNQITTVAPGAFDSL-HSLSTLNLLANPFNCNCHLAWLGEWL--RRKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 704          

HSP 2 Score: 72.7886 bits (177), Expect = 7.824e-13
Identity = 72/274 (26.28%), Postives = 116/274 (42.34%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ LDLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C   +  R   K++ +  A+++C
Sbjct:  272 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------SIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYR--SKLSGDCFADLAC 498          

HSP 3 Score: 50.0618 bits (118), Expect = 8.397e-6
Identity = 62/252 (24.60%), Postives = 108/252 (42.86%), Query Frame = 1
Query:  199 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRL-LFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            CP  C   +C  + + C    L  +P N PR  +++ L+  N    R+T  + +        L+ L +    +++IE  AF  L  L+ L L+ N L LF       +  L  L L  N+   + + +FRG V +++L +    +  +   + + +   L  L L +N +  LS   F+ + + L    L +N   C C L WL+  L+ R       P+  L       C  P +L+G ++  +    F C
Sbjct:   28 CPAQC---SCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNIT--RITKIDFAGLRH----LRVLQLMENRISTIERGAFQDLKELERLRLNRNNLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRD-LEVLTLNNNNITRLSVASFNHMPK-LRTFRLHSNNLYCDCHLAWLSDWLRQR-------PRVGLY----TQCMGPSHLRGHNVAEVQKREFVC 257          
BLAST of slit-2 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 85.8853 bits (211), Expect = 8.390e-17
Identity = 84/254 (33.07%), Postives = 117/254 (46.06%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+  SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL                        G +  L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  507 DLACPEKCR---CEGTTVDCSNQRLNKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGL------------------------GSVRLLSLYDNQITTVAPGAFDSL-HSLSTLNLLANPFNCNCHLAWLGEWL--RRKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 716          

HSP 2 Score: 74.3294 bits (181), Expect = 2.711e-13
Identity = 73/280 (26.07%), Postives = 117/280 (41.79%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ LDLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C       IP  +    K++ +  A+++C
Sbjct:  276 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------SIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLAC 510          
BLAST of slit-2 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 85.8853 bits (211), Expect = 8.504e-17
Identity = 84/254 (33.07%), Postives = 117/254 (46.06%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+  SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL                        G +  L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  495 DLACPEKCR---CEGTTVDCSNQRLNKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGL------------------------GSVRLLSLYDNQITTVAPGAFDSL-HSLSTLNLLANPFNCNCHLAWLGEWL--RRKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 704          

HSP 2 Score: 72.0182 bits (175), Expect = 1.469e-12
Identity = 72/274 (26.28%), Postives = 116/274 (42.34%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ LDLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C   +  R   K++ +  A+++C
Sbjct:  272 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------SIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYR--SKLSGDCFADLAC 498          
BLAST of slit-2 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 85.5001 bits (210), Expect = 8.964e-17
Identity = 84/254 (33.07%), Postives = 117/254 (46.06%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+  SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL                        G +  L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  499 DLACPEKCR---CEGTTVDCSNQRLNKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGL------------------------GSVRLLSLYDNQITTVAPGAFDSL-HSLSTLNLLANPFNCNCHLAWLGEWL--RRKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 708          

HSP 2 Score: 72.0182 bits (175), Expect = 1.548e-12
Identity = 72/274 (26.28%), Postives = 116/274 (42.34%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ LDLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C   +  R   K++ +  A+++C
Sbjct:  276 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------SIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYR--SKLSGDCFADLAC 502          
BLAST of slit-2 vs. Ensembl Mouse
Match: Slit2 (slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:1315205])

HSP 1 Score: 85.5001 bits (210), Expect = 9.055e-17
Identity = 84/254 (33.07%), Postives = 117/254 (46.06%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+  SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL                        G +  L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  507 DLACPEKCR---CEGTTVDCSNQRLNKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGL------------------------GSVRLLSLYDNQITTVAPGAFDSL-HSLSTLNLLANPFNCNCHLAWLGEWL--RRKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 716          

HSP 2 Score: 74.3294 bits (181), Expect = 2.900e-13
Identity = 73/280 (26.07%), Postives = 117/280 (41.79%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ LDLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C       IP  +    K++ +  A+++C
Sbjct:  276 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------SIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLAC 510          
BLAST of slit-2 vs. UniProt/SwissProt
Match: sp|Q9WVC1|SLIT2_RAT (Slit homolog 2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Slit2 PE=1 SV=3)

HSP 1 Score: 88.1965 bits (217), Expect = 7.758e-17
Identity = 81/253 (32.02%), Postives = 115/253 (45.45%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+ +SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL                        G +  L+L DN++  ++         L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  499 DLACPEKCR---CEGTTVDCSNQKLNKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINLSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFTGL------------------------GSVRLLSLYDNQITTVAPGAFGTLHSLSTLNLLANPFNCNCHLAWLGEWL--RRKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 708          

HSP 2 Score: 71.2478 bits (173), Expect = 1.398e-11
Identity = 72/274 (26.28%), Postives = 116/274 (42.34%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ LDLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C   +  R   K++ +  A+++C
Sbjct:  276 HCPIAC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------SIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYR--SKLSGDCFADLAC 502          
BLAST of slit-2 vs. UniProt/SwissProt
Match: sp|Q9R1B9|SLIT2_MOUSE (Slit homolog 2 protein OS=Mus musculus OX=10090 GN=Slit2 PE=2 SV=2)

HSP 1 Score: 85.8853 bits (211), Expect = 5.948e-16
Identity = 84/254 (33.07%), Postives = 117/254 (46.06%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+  SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL                        G +  L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  495 DLACPEKCR---CEGTTVDCSNQRLNKIPDHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRISCVGNDSFIGL------------------------GSVRLLSLYDNQITTVAPGAFDSL-HSLSTLNLLANPFNCNCHLAWLGEWL--RRKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 704          

HSP 2 Score: 72.0182 bits (175), Expect = 1.028e-11
Identity = 72/274 (26.28%), Postives = 116/274 (42.34%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ LDLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C   +  R   K++ +  A+++C
Sbjct:  272 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------SIRVIPPGAFSPYKKLRRLDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTVAKGTFSALRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYR--SKLSGDCFADLAC 498          
BLAST of slit-2 vs. UniProt/SwissProt
Match: sp|O94813|SLIT2_HUMAN (Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=SLIT2 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.865e-15
Identity = 84/254 (33.07%), Postives = 116/254 (45.67%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+  SN  +T IE  AF     + E+ L+SNRL  +    FK L SLKTL+L SNR   +  DSF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++I  F C
Sbjct:  503 DLACPEKCR---CEGTTVDCSNQKLNKIPEHIPQYTAELRLNNNEFTV--LEATGIFKKLPQ---LRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRL------------------------LSLYDNQITTVAPGAFDTL-HSLSTLNLLANPFNCNCYLAWLGEWL--RKKR---------IVTGNPRCQKPYFLKEIPIQDVAIQDFTC 712          

HSP 2 Score: 72.4034 bits (176), Expect = 8.445e-12
Identity = 73/280 (26.07%), Postives = 117/280 (41.79%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDIKVTSEITAEISC 1011
             CP  C    C   ++ C   GL +IP N P  I                          EI L++ TI       I   AFS    L+ +DLS+N++  + P+ F+ L SL +LVL  N+  +L K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  ++L  NPF C C LKWLA  L T             +  +   C  P+ L    I  +    F+C       IP  +    K++ +  A+++C
Sbjct:  272 HCPAAC---TCSNNIVDCRGKGLTEIPTNLPETIT-------------------------EIRLEQNTIK-----VIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHN-LNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNP-----------IETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLAC 506          
BLAST of slit-2 vs. UniProt/SwissProt
Match: sp|O88279|SLIT1_RAT (Slit homolog 1 protein OS=Rattus norvegicus OX=10116 GN=Slit1 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 5.741e-14
Identity = 74/257 (28.79%), Postives = 117/257 (45.53%), Query Frame = 1
Query:  184 TKDSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ 948
            T D  CP  C    C+ +++ C    L +IP   P+   ++ L+N       L  T L +  S    LKK+ +SN  ++ IE   F     + EL L++N+L  +    F+ L  L+TL+L +NR   +  DSF GL  V+ LS+ D H+  ++  +                        FD L + L  LNL  NPFNC+CQL WL   L+ R            +   NP C+ P  L+   +++++   F+C+
Sbjct:  508 TSDVACPHKCR---CEASVVECSGLKLSKIPERIPQSTTELRLNNNEISI--LEATGLFKKLSH---LKKINLSNNKVSEIEDGTFEGATSVSELHLTANQLESVRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGA------------------------FDTL-QALSTLNLLANPFNCNCQLAWLGDWLRKRK-----------IVTGNPRCQNPDFLRQIPLQDVAFPDFRCE 720          

HSP 2 Score: 75.0998 bits (183), Expect = 1.149e-12
Identity = 73/281 (25.98%), Postives = 119/281 (42.35%), Query Frame = 1
Query:  193 SECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDIKVTSEITAEISC 1011
              CP +C   +C   ++ C   GL  IP N P  + ++          RL    +                     SI   AFS    L+ +DLS+N++  I P+ F+ L SL +LVL  N+   L +  F GL    L + + + +  +  ++ + +   L+ L+L DN+++ L+       R +  L+L  NPF C C LKWLA  L+T             +  T   C  P+ L    I  +    F+C       IP  +  D  + SE T++++C
Sbjct:  280 GSCPAMC---SCSNGIVDCRGKGLTAIPANLPETMTEI----------RLELNGIK--------------------SIPPGAFSPYRKLRRIDLSNNQIAEIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQN-LSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNP-----------IETTGARCASPRRLANKRIGQIKSKKFRCSAKEQYFIPGTE--DYHLNSECTSDVAC 513          
BLAST of slit-2 vs. UniProt/SwissProt
Match: sp|Q8C031|LRC4C_MOUSE (Leucine-rich repeat-containing protein 4C OS=Mus musculus OX=10090 GN=Lrrc4c PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 6.024e-14
Identity = 80/310 (25.81%), Postives = 126/310 (40.65%), Query Frame = 1
Query:  385 LKKLTISNCSLTSIESEAFSHLIYLQELDLSS-NRLLFIYPNTFKSLS-----------------------LKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQR--IDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPD---QNSGVNQASIIVSKKSEFDF----------YSCLIINENGNATV 1194
            LK+L + N  + SI S AF+ +  L+ LDL    RL +I    F+ LS                       L  L L  N    +   SF+GL+ +Q L M    ++++   +   +   L  +NLA N L  L +D       L+ ++L +NP+NC+C + WL+  +      RD +P ++        C  P NLKG  I  L    F C  P +     D+ VT  + AE+ C            R   +L+ + +  P+      G  +  I V      +F          Y+C++ N  GN T 
Sbjct:  150 LKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQVIERNAFDNLQS-LVEINLAHNNLTLLPHDLFTPLHHLERIHLHHNPWNCNCDILWLSWWI------RDMAPSNTACCAR---CNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKC------------RASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQDTGMYTCMVSNSVGNTTA 437          
BLAST of slit-2 vs. TrEMBL
Match: I1ZIL5 (Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 997.653 bits (2578), Expect = 0.000e+0
Identity = 505/506 (99.80%), Postives = 505/506 (99.80%), Query Frame = 1
Query:   97 MYIFRCIYRXXXXXXXXXXXXXVCLSIRPTKDSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQEIKATW 1614
            MYIFRCIYRLLLTLIIELLTIEVCLSIRPTKDSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENN FNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQEIKATW
Sbjct:    1 MYIFRCIYRLLLTLIIELLTIEVCLSIRPTKDSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNLFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQEIKATW 506          
BLAST of slit-2 vs. TrEMBL
Match: A0A5P8I4L0 (PXDN-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 2.416e-79
Identity = 168/453 (37.09%), Postives = 243/453 (53.64%), Query Frame = 1
Query:  199 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPV-CEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNS--QVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINS---PPNTVNQFNLRNNITKSSVILKEFDKLHV-NYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVP 1536
            CP +C++ AC+  +L C   GLLQIP    +   K+I+SNQ F  P LTY+N S YG     ++K+ +  C L SI S  FSHL  L+ LDLS N L  I P+TFK+L L+ L LD N+ +Q  + SFRGL V  LS+ DC+L  L  E   +IS  L  L L +N+L  +   F +LF  L +L +  NPFNC+C L+WL   L +R K  + S   S  R+ N   C YP  +KG  I +L +  F C  P+L+ ID+ +TS  +A+++CIS+  ++S   V W   +  +     Y  +   + +AS+ V +KS  D Y C+I N N   TV I I WP          +N+    PN +  +    N T           LHV +  + KQ+T +EM+  + GTF IT++ F+ +Y  +    K +  K     YE  + S+SQTYD+P
Sbjct:   26 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLS---SSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMTEHKNT-----YVPEIQSIEKASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANST-----------LHVRSVFYEKQFTLLEMIGGVVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIP 459          
BLAST of slit-2 vs. TrEMBL
Match: A0A0R3SAT8 (Ig-like domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1502 PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.257e-50
Identity = 157/503 (31.21%), Postives = 249/503 (49.50%), Query Frame = 1
Query:  178 RPTKDSECPELCNQGACKLTMLLCETPGLLQ-IPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQI--SGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLL---RL------TNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTS---------EITAE--ISCISDDMSNSQVKW----RYRYNLSPLFYRYPDQNSGVNQASI---IVSKKSEFD------FYSCLIINENGNATVDIKIKWPTLNKEYVESPINSP--PNTVNQFNLRNNITKSSVILK------EFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPYH 1554
            R  +  E  ++C+   C    + C+  G L  +P + P GI+KVI+ +Q F    L+  N+S Y      +++LTI +C L +IES  FS L  L +LDLS N L  I  NTF  L L  L LD N+ L L  ++F  L V SLSM++C L+ L+ E  + +  SG LTTL L  N L  L   F+  FR L  L+L  NPF C C+L WL+  LQ R +R DN     ++   RL       +P+CE P  L+G  I +L+   F C  P+++ +++  TS           TA   I C +      Q+ W    R+   L PL       + GV + S+   +++K S  D       ++C+ I+  GN + D+ +KWPTL       P NS   P + ++ +   + +  +  L+      + D+L   + ++K++T +E++ A+ GTF  T++ F++ Y+++  R +    K+  K     VY       +P+   YH
Sbjct:   24 REVRADEVCQICD--GCIYGSISCQEAGRLHMLPNDLPSGIRKVIIVSQRFDSQFLSRPNISSYSLPGSEIQELTIMDCGLRAIESRTFSGLNSLTKLDLSKNSLSRIQGNTFSGLRLDLLRLDDNQGLTLDAEAFENLTVSSLSMQNCGLRSLSFEVFRPLLQSGTLTTLRLTSNSLTTLDARFEPFFRNLSFLSLAKNPFVCDCKLMWLSRILQ-RKRRADNDDAFPMINDDRLLIEPDDDHPICESPGRLRGKQIVSLASSDFYCGPPQMRALEVDFTSLRVGGSEAVNTTAGILIKCAAQGSPEMQLTWFRRDRWGAGLIPL-SGLRQISPGVVEVSVSRSLLAKNSTSDSEDSGELFTCMGIDTYGNTSADLFLKWPTL-------PTNSAVKPQSPDKRSSLESSSSDTFYLEGEQQRFQTDRLD-EFFFMKKFTILELIGAVVGTFTATIMLFLMGYILLYVRHRQQYPKSPSK----TVYPLVSNAGLPKFPDYH 510          
BLAST of slit-2 vs. TrEMBL
Match: A0A0R3TNY6 (Ig-like domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9134 PE=4 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 2.918e-49
Identity = 145/479 (30.27%), Postives = 233/479 (48.64%), Query Frame = 1
Query:  178 RPTKDSECPELCNQGACKLTMLLCETPGLLQ-IPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQI--SGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLR---------LTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTS---------EITAE--ISCISDDMSNSQVKW----RYRYNLSPLFYRYPDQNSGVNQASI---IVSKKSE------FDFYSCLIINENGNATVDIKIKWPTLNKEYV---------ESPINSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKN 1479
            R  K  E  ++C+   C    + C+  G L  +P + P GI+KVI+ +Q F    L+  N+S Y     ++++LTI +C L +IES  FS L  L +LD+S N L  I  NTF  L L  L LD N+ L L  ++F  L V SLSM++C L+ L+ E  + +  SG LTTL L  N L  L   F+  FR L  L+L  NPF C C+L WL+ TLQ R +R DN     ++            +P+CE P  L+G  I  L+   F C  P+++ +++  +S           TA   I C +      Q+ W    R+   L PL       + GV + SI   +++K S        + ++C+ I+  GN + D+ ++WP      +          SP+  P    +   +     K+       D+L   + ++K++T +E++ A+ GTF  T++ F++ Y+++  R +    K+
Sbjct:   24 REIKADEVCQICD--GCIYGSISCQEAGRLHMLPNDLPPGIRKVIIVSQRFDSQFLSRQNISSYSLPGTVIQELTIMDCGLRAIESRTFSGLNSLTKLDVSKNSLSRIQGNTFSGLRLDLLRLDDNQGLTLDAEAFENLTVSSLSMQNCGLRSLSFEVFRPLLQSGTLTTLRLTSNSLTTLDIRFEPFFRNLSFLSLAKNPFTCDCKLMWLSRTLQ-RKRREDNDDAFPMINDDILLIEPDDDHPICESPSRLRGKQIVTLASTDFYCGPPQMKALEVDFSSFRVGGGETVNTTAGIVIKCAAQGSPEMQLAWFQRDRWGNGLVPL-SGSKHVSPGVVEVSISRSLLAKNSTGGSEELGELFTCMGIDTYGNTSADLSLRWPAFQPTSIVPSQPSDKRNSPV-PPAGDADYLEVDQKSFKT-------DRLD-EFFFMKKFTVLELIGAVVGTFTATIMLFLMGYILLYMRHRQQYPKS 489          
BLAST of slit-2 vs. TrEMBL
Match: A0A068YC11 (Variable lymphocyte receptor OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000739800 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 5.723e-47
Identity = 161/507 (31.76%), Postives = 241/507 (47.53%), Query Frame = 1
Query:  184 TKDSECPELCNQGACKLTMLLCETPGLLQ-IPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQI--SGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLL---RL------TNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAE-----------ISCISDDMSNSQVKW--RYRYNLSPLFYRYPDQN---SGVNQASIIVS-----KKSEFD----FYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILK---------EFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSES----QTYDVPQMSPYH 1554
            T D  C  +C    C    + C+   LL  +P N P GI+KVI+ +Q F    L+  N+S Y    + + +LTI +C L +IE+  FS L  L +LDLS N L  I  +TF  L L  L LD N+ L L  ++F  L V SLSM++C L+ L++E  + +  S  LTTL L  N L  L   F+  FR L  L+L  NPF C C+L WL+ TLQ R +R D+      L   RL       +PVCE P +L+G  I +LS   F C  P+++ +++  +     +           I C +      Q+ W  R R    P+  R P      SGV + SI  S      KSE +     ++CL ++  GN + D+ ++WP L              +    N RN +  SS   K         + D+L   Y ++K++T +E++ A+ GTF  T++ F++ Y+++  R +    K+  K     V S        Y V + SP H
Sbjct:   27 TADEVC-RICE--GCTYGSISCQEADLLHMLPNNLPNGIEKVIIVSQRFDSQFLSRQNISSYTLPGVNIHELTIMHCGLRAIEAGTFSGLSSLTKLDLSKNSLSRIQGHTFSGLRLDLLRLDDNQGLTLDSEAFENLTVSSLSMQNCGLRSLSYEVFQPLVQSRSLTTLRLTSNSLTTLDARFEPFFRNLSFLSLARNPFVCDCKLVWLSRTLQ-RKRRADSDDAFRRLNDDRLLIVPDDDHPVCESPNHLRGKHIVSLSTRDFFCGPPQMRALEVDFSDLRVGQSETFNMTGVVLIKCAAQGSPEMQLAWFRRDRRGGEPI--RLPGLRQVASGVVEVSISHSLFAKNSKSETEDAGQLFTCLGVDTYGNTSADLSLRWPALPLLSPLP-------SSPTSNNRNPMEPSSGDSKYLNNDKGYFQSDRLD-EYFFMKKFTILELIGAVVGTFTATILLFLMGYILLYMRHRQQYPKSPSKTVYPLVTSTGLPKFPDYQVLESSPQH 519          
BLAST of slit-2 vs. Ensembl Cavefish
Match: lrrc4cb (leucine-rich repeat-containing protein 4C-like [Source:NCBI gene;Acc:103034014])

HSP 1 Score: 81.6481 bits (200), Expect = 8.063e-16
Identity = 90/338 (26.63%), Postives = 143/338 (42.31%), Query Frame = 1
Query:  385 LKKLTISNCSLTSIESEAFSHLIYLQELDLSS-NRLLFIYPNTFKSLS-----------------------LKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQR--IDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFY-----RYPDQNSG-VNQASIIVSKKSEFDFYSCLIINENGNATVDIKIK-----------WPTLNKEYVESPINSPPNT 1266
            LK+L + N  + SI S AF+ L  L+ LDL    RL ++    F+ L                        L  L +  N+   +   SF+GLV +  L M    ++I+   S   +   L  LNLA N L ++ +D     R L  ++L +NP+NC+C + WL+  L      R+  P ++        C  P +LKG  I  L    FQC  P +     D+ VT     E+ C ++ +++  V W    N S L +     R   QN G +N  S+ +    +   Y+C + N  GN +  + +            + T+  E +ESPI+    T
Sbjct:  151 LKELWLRNNPIESIPSYAFNRLPSLRRLDLGELKRLSYVSDGAFEGLGNLRYLNLGMCNLKEVPNIQPLVRLDELEMSGNQLTVIRPGSFKGLVHLHKLWMMHAQVQIIERNSFDDLQS-LGELNLAHNNLTFVPHDLFTPLRHLQRVHLHHNPWNCNCDILWLSWWL------RETVPTNTSCCAR---CYSPPSLKGRYIGELDQSYFQCYAPVIVESPADLNVTEGTAVELKCRTNSLTS--VSW-LTPNGSVLTHGASKGRVTVQNDGTLNFTSVTM---QDMGTYTCKVSNMLGNVSASVLLNVTSVDNSGFSYFTTVTVETIESPIDGDGRT 472          
BLAST of slit-2 vs. Ensembl Cavefish
Match: lrrc4.2 (leucine rich repeat containing 4.2 [Source:ZFIN;Acc:ZDB-GENE-030131-7997])

HSP 1 Score: 75.0998 bits (183), Expect = 8.457e-14
Identity = 74/281 (26.33%), Postives = 116/281 (41.28%), Query Frame = 1
Query:  385 LKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRI--DIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDF----------YSCLIINENGNA 1188
            LK L +  C+L   E    S L+ L+EL++S N    I P +F+ L SLK L + ++R   + +++F  +                          L  LNLA N L  L +D       L  L+L +NP+ C C + WLA  L      R+  P +S        C  P +L+G  +  +   +FQC  P +     D+ +++E  AE+ C +  MS+  V+W        L         G N   I V      +F          Y+C++ N  GN+
Sbjct:  192 LKYLNLGMCNLR--EMPVLSPLVGLEELEMSENYFPEIKPGSFRGLKSLKKLWIMNSRITTMERNAFDDVTA------------------------LVELNLAHNNLSSLPHDLFAPLSYLVELHLHHNPWRCDCDVVWLAWWL------REYIPTNS---TCCGRCHTPAHLRGRYLVEVDQTTFQCSAPFILDAPRDLNISAERVAELKCRTAPMSS--VRW--------LLPNGTVLTHGSNHPRIYVLNDGTLNFSNVLASDTGVYTCMVTNMAGNS 427          
BLAST of slit-2 vs. Ensembl Cavefish
Match: lrrc4ca (leucine-rich repeat-containing protein 4C [Source:NCBI gene;Acc:103046976])

HSP 1 Score: 74.7146 bits (182), Expect = 1.189e-13
Identity = 76/303 (25.08%), Postives = 124/303 (40.92%), Query Frame = 1
Query:  385 LKKLTISNCSLTSIESEAFSHLIYLQELDLSS-NRLLFIYPNTFKSLS-----------------------LKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQR--IDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFD--FYSCLIINENGNATVDIKI 1206
            LK+L + N  + SI S AF+ +  L+ LDL    RL +I    F+ LS                       L  L +  N+   +   SF+GLV +Q L M    ++ +   +   +   L  LNLA N L  L +D       L+ ++L +NP+NC+C + WL+  L+       +             C  P + KG  I  L    F C  P +     D+ VT  + AE+ C +  +++  V W            Y  + S +N  ++  +  +  D   Y+C++ N  GN T    +
Sbjct:  151 LKELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLGMCNLKEIPNLIPLVRLDELEMSGNQLSVIRPGSFKGLVHLQKLWMMHAQIQTIERNAFDDLQS-LVELNLAHNNLTLLPHDLFTPLHHLERVHLHHNPWNCNCDILWLSWWLKEMVPANTSCCAR---------CSTPTSHKGRYIGELDQNYFHCYAPVIVEPPADLNVTEGMAAELKCRASSLTS--VSWITPNGSIMTHGAYKVRISVLNDGTLNFTNVTMQDTGTYTCMVSNSAGNTTASATL 441          
BLAST of slit-2 vs. Ensembl Cavefish
Match: slit2 (slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-010306-3])

HSP 1 Score: 75.0998 bits (183), Expect = 1.321e-13
Identity = 76/255 (29.80%), Postives = 116/255 (45.49%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLS-LKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ 948
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F    L  T + +   +   L+K+ +S+  ++ IE   F     + EL L+SNRL  ++ +  K L+ L+TL+L SN+   ++  SF GL    L                        L+L DN +  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I++++   F C+
Sbjct:  487 DLACPEKCR---CEGTTVDCSGQKLTKIPDHIPQYTAELRLNNNEFSV--LEATGIFKKLPQ---LRKINLSSNRISDIEEGTFEGAAGVNELILTSNRLENVHHSMLKGLTGLRTLMLRSNKISCVSNSSFTGLSSVRL------------------------LSLYDNLITSIAPGAFDTL-HSLSTLNLLANPFNCNCHLAWLGEWL--RRKR---------IVTGNPRCQNPYFLKEIPIQDVAAQDFACE 697          

HSP 2 Score: 71.2478 bits (173), Expect = 2.088e-12
Identity = 74/273 (27.11%), Postives = 114/273 (41.76%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
            +CPE C    C   ++ C   GL +IP N P  I ++ L  QN                             S+  I   AFS    L+ +DLS+N++  +  ++F+ L SL +LVL  N+  +L K  F GL    L + + +          Q    L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  LQ      +N  + S  R     C  P+ L    I  +    F+C    ++    K+     A+++C
Sbjct:  264 QCPEFC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------SIKVIPPGAFSPYKRLRRIDLSNNQISELAADSFQGLRSLNSLVLYGNKITELPKGLFEGLFSLQLLLLNANKLNCLRVDAFQDLQNLNLLSLYDNKLQTIAKGTFSSLRSIQTLHLAQNPFMCDCHLKWLADYLQ------ENPIETSGAR-----CTSPRRLANKRIGQIKSKKFRCS--GVEDYRSKLGGSCFADLAC 490          
BLAST of slit-2 vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 72.0182 bits (175), Expect = 7.512e-13
Identity = 73/286 (25.52%), Postives = 124/286 (43.36%), Query Frame = 1
Query:  379 IILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQR--IDIKVTSEITAEISCISDDMSNSQVKW-----------RYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATV 1194
            I L+ L +  C L  I +   + L+ L+EL+LS NRL  I P +F+ L SL+ L L  ++   + +++F  L                 +S+++       LNL+ N L  L +D     + L+ ++L +NP+ C+C + WL+  L      ++  P ++        C  P  LKG  I  L    F C  P +     D+ VT  + AE+ C +   S + V W            YR  +S L       +  +N  ++ +    +   Y+C++ N  GN T 
Sbjct:  177 INLRYLNLGMCGLKDIPN--LTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTVIERNAFDDL-----------------KSLEE-------LNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWL------KETVPSNTTCCAR---CHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRT-GTSMTSVNWITPNGTLMTHGSYRVRISVL------HDGTLNFTNVTLRDTGQ---YTCMVTNSAGNTTA 417          
BLAST of slit-2 vs. Ensembl Sea Lamprey
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 68.9366 bits (167), Expect = 1.464e-12
Identity = 74/303 (24.42%), Postives = 128/303 (42.24%), Query Frame = 1
Query:  385 LKKLTISNCSLTSIESEAFSHLIYLQELDLSS-NRLLFIYPNTFKSLS-----------------------LKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIP--KLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFD--FYSCLIINENGNATVDIKI 1206
            L+ L + N  +  I +  F+ +  LQ LDL    +L FI    F+ LS                       L+ L L  NR   L   SF+GL  ++ L +    ++++   +  ++   L  LNLA N L  L +D     + L+ ++L +NP+ C C + WL+  L      R+N P ++        C  P + K  ++  L    F C  P  ++   D+ ++  + AE+ C +   S S V W      S     Y  + S ++  ++  +  +  D   Y+CL+ N  GN+T    +
Sbjct:  105 LRDLWLRNNPIEDISAYTFTRIPSLQRLDLGELTKLQFISNEAFEGLSNLRYLNLGMCNLREVPKLSPLVRLEELELSGNRIEILRPGSFQGLANLRKLWIMHSEVRLVERNAFDELQS-LKELNLAHNSLMSLPHDLFSPLQKLERVHLHHNPWTCDCDILWLSWWL------RENVPNNATCCAR---CALPADRKAINLWELDSSRFTCYPPLIEVPPSDVNISEGMAAELRCRAPS-SASSVTWITPNGTSMTHGSYKIRISVLHDGTLNFTNVTVQDTGIYTCLVANSVGNSTASATL 396          
BLAST of slit-2 vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 66.2402 bits (160), Expect = 1.667e-11
Identity = 67/278 (24.10%), Postives = 122/278 (43.88%), Query Frame = 1
Query:  508 TFKSL-SLKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKL--QRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIV---SKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILK 1320
             F+ L SLK L L  N    + + +F+GLV ++ L +   H+++L   +   +   L  L L +NRL  ++         L  L L++N   C C+L WLA  L+            S   L    CE+P+ L+G S+ +++   F C+ P++  +  D+ VT   T  + C ++      + W +  N   +     D+   + Q   ++   ++ ++   Y C+  N  G      ++K P +   Y + P  +PP  V Q +    +   SV L+
Sbjct:   42 AFEDLESLKYLYLYKNEIQSIDRHAFKGLVSLEQLYIHFNHIEVLEPNTFVDLP-KLERLFLHNNRLSRIATGTFTQLSSLRRLRLDSNRLVCDCELVWLAELLRAFAG--------SGGTLAAATCEHPRRLQGRSVSSITAQEFHCESPRITSEPHDVDVTPGNTVYLRCRAEGNPKPAIIWLHNSNEIAM---AEDERRNLLQDGTLMIRDTRHTDQGTYQCMARNVAG------EVKAPEVVLRYFDVP--APPTFVIQPHDTEVLVGESVTLE 299          
BLAST of slit-2 vs. Ensembl Sea Lamprey
Match: islr2 (immunoglobulin superfamily containing leucine-rich repeat 2 [Source:ZFIN;Acc:ZDB-GENE-050320-95])

HSP 1 Score: 64.6994 bits (156), Expect = 3.972e-11
Identity = 72/313 (23.00%), Postives = 126/313 (40.26%), Query Frame = 1
Query:  352 NLSRYGSEEI-ILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLL-FIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQ---RIDIKVT---SEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASI----IVSKK----------------SEFDFYSCLIINENGNATVDIKI 1206
            +LSR   EEI ++  L +S+  L SIE    + L+ L+ LDLS+N+L  F + +     +L+ L L++N  ++L +D+F  L                          L +L L  N    +          L +L L  NP  CSC+ +WL   L T +          +    N  C  P  LKG +++ +  V  +C  P ++     D++ T   S+    + C +D +    V W+ R     +     D+     +A +    ++ K+                SE   Y+C+  N+ G ++   +I
Sbjct:   68 SLSRDAFEEIPLMSSLWLSHNELVSIEKGTLAGLVQLRNLDLSNNQLADFSWEDLRNLTALQVLKLNNNNLVRLPRDAFETLT------------------------DLRSLRLHHNLFATIEEGTFENLHALSHLLLYENPLRCSCKARWLPAWLNTTSI--------DIPSKENIACAEPDELKGQAVQQMPDV--ECVAPTVRLSSSPDVRETRLYSDFAVVLDCQADGLPAPTVSWKLRKEGGEIDLGVFDEEKVPEEAVVETNDVLDKRVMAFRNGTLVIPQLSESEEGAYTCVATNDMGESSASARI 346          
BLAST of slit-2 vs. Ensembl Sea Lamprey
Match: LGI1 (leucine rich glioma inactivated 1 [Source:HGNC Symbol;Acc:HGNC:6572])

HSP 1 Score: 63.5438 bits (153), Expect = 5.810e-11
Identity = 55/188 (29.26%), Postives = 83/188 (44.15%), Query Frame = 1
Query:  394 LTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLD---NLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            LT  +     I +  FSHL  L  L L S+    I  + FK L  L  L +++N   ++++++FRGL            K LTH            L+LA+N+L  L  D   +F+GLD   +++L  N  +C C++KWL   L +      N+  H +       C  P    G S  +LS   F C
Sbjct:   56 LTFDDADFNQIANGTFSHLPTLHVLLLGSSSFS-IRDDAFKGLVKLHYLFIENNIIDEISRNAFRGL------------KTLTH------------LSLANNKLRSLPRD---VFKGLDAMTDVDLRGNALHCDCKMKWLVSWLHST-----NASVHDI------TCASPPEFAGRSTRSLSASDFSC 204          
BLAST of slit-2 vs. Ensembl Sea Lamprey
Match: flrt3 (fibronectin leucine rich transmembrane 3 [Source:ZFIN;Acc:ZDB-GENE-030131-1988])

HSP 1 Score: 58.151 bits (139), Expect = 2.043e-9
Identity = 65/240 (27.08%), Postives = 103/240 (42.92%), Query Frame = 1
Query:  220 GACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLT--SIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSND-FDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSI 930
            GA  L +L      L  +P+  PRG++++ L +       ++   L   G+    LK+L +    L+  SI   AF  L  L EL L+ N    + P       L+ L L  NR  +++  +  GL                    +Q    L  L+L+ N L  L    FD L + L  L++ NNP+ C+C L W    LQ   KRR      S+  +   VC+ P+  +G+ +E L++
Sbjct:  152 GAAGLKVLFLSRNLLSAVPIGLPRGLEELRLDDNRVGA--ISEQALGGLGN----LKRLFLEGNQLSEKSIAERAFRDLDSLAELSLARNAFAAV-PANLPGTRLERLYLQDNRISRVSAGALAGL--------------------RQ----LARLDLSGNSLGVLPQGVFDDLSQ-LAQLSVRNNPWRCTCALLW----LQEWMKRRS-----SVTMVRGMVCQAPETARGTPLEGLAL 350          
BLAST of slit-2 vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 56.9954 bits (136), Expect = 1.772e-8
Identity = 58/246 (23.58%), Postives = 113/246 (45.93%), Query Frame = 1
Query:  382 ILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNR---NLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLN---LENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ----IPKL------QRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNL 1065
            +L+KL +    L+ I+   F HL+ L+ L+L++NR+  I   +F  L SL+ L L +N     ++     FRGL  + SL +    +  +   +   +   +  LNL+ N +  +  +    F+G+D L    L  +   C C++KW    L++R      S +H++       C +P+ L   S+ N++  +F C     IP++      Q+        +   +  +  + S+ +++WR  Y +
Sbjct:  347 VLRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIYHISQGSFSDLRSLEGLDLSNNDISWTVEEMNGPFRGLTNLASLRLDGNRITAIAATAFLGLEN-IKYLNLSANIITSIQENS---FQGMDKLQKLWLNTSQLMCDCKIKWFGSWLRSRP-----STRHTV----RARCLHPQTLYMKSVFNITPDAFVCDTSNPIPQISVHPPSQKAMRGDNVTLRCRVQVVQRNSSSVRLQWRLGYEV 579          
BLAST of slit-2 vs. Ensembl Nematostella
Match: EDO47109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB0])

HSP 1 Score: 53.5286 bits (127), Expect = 1.565e-7
Identity = 46/169 (27.22%), Postives = 75/169 (44.38%), Query Frame = 1
Query:  466 LDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFR--GLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNP---VCEYPKNLKGSSIENLSIVSFQCQIPK 957
            LDL  N L     + F  LSL+ L LD N+ L    ++F   G  +Q L M   +L  +T + +  +   +  L+L +N +  +        + L  ++L  NP +C C+L WL   L +R  +         L L++P    C  P ++KG +   L   SF C   +
Sbjct:  219 LDLGDNLLEVFEVDAFDGLSLRKLRLDGNK-LDEIPEAFAKVGHFLQELDMSGNYLHEITSDQLLDLHA-IERLDLNENNISKIRIGALRGMKKLRQISLSGNPLSCDCRLVWLKHVLDSRQDQ---------LHLSSPQSTTCASPASVKGQTFLGLDARSFLCTCAQ 376          
BLAST of slit-2 vs. Ensembl Medaka
Match: lrrc4cb (leucine rich repeat containing 4C [Source:NCBI gene;Acc:101160634])

HSP 1 Score: 78.5666 bits (192), Expect = 6.748e-15
Identity = 77/296 (26.01%), Postives = 124/296 (41.89%), Query Frame = 1
Query:  385 LKKLTISNCSLTSIESEAFSHLIYLQELDLSS-NRLLFIYPNTFKSLS-----------------------LKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQR--IDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFD--FYSCLIINENGN 1185
            LK+L + N  + SI S AF+ +  L+ LDL    RL +I    FK LS                       L+ L +  N+   +   SF GL  +Q L M    ++ +   S   +   L  LNLA N L +L +D       L+ ++L +NP+NC+C + WL+  L+       +             C  P   KG  I  L    FQC +P +     D+ VT  + AE+ C ++ M++  + W            Y  + S +N  ++  +  +  D   Y+C++ N  GN
Sbjct:  151 LKELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLSYISELAFKDLSNLRYLNLGMCNLKEIPNIIPLVKLEELEMSGNQLTVIKPSSFTGLANLQKLWMMHSQVQTIERNSFDDLQS-LVELNLAHNNLTFLPHDLFTPLHHLERVHLHHNPWNCNCDILWLSWWLKETVPANTSCCAR---------CHTPSVFKGRYIGELDHSYFQCDVPVIVEPPSDLNVTEGMGAELKCRTNSMTS--ISWLTPNGSMVTHGAYKVRLSVLNDGTLNFTSVTMQDTGTYTCMVSNTAGN 434          
BLAST of slit-2 vs. Ensembl Medaka
Match: slit2 (slit guidance ligand 2 [Source:NCBI gene;Acc:101173607])

HSP 1 Score: 78.1814 bits (191), Expect = 1.388e-14
Identity = 79/257 (30.74%), Postives = 115/257 (44.75%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLT--YTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ 948
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F     T  +  L         L+K+ +SN  +T IE   F     + EL L+SN+L  I+ +  K L  L+TL+L SNR   ++  SF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I+++++  F C+
Sbjct:  511 DLACPEKCR---CEGTTVDCSNQKLTKIPDHIPQYTAELRLNNNEFTVLEATGIFKKLPH-------LRKINLSNNRITDIEEGTFEGASGVNELILTSNKLENIHHSMLKGLGGLRTLMLRSNRISCVSNSSFVGLSSVRL------------------------LSLYDNQVTSMTPGAFDTLHS-LSTLNLLANPFNCNCHLAWLGDWL--RRKR---------IVTGNPRCQNPYFLKEIPIQDVAVQDFACE 721          

HSP 2 Score: 73.559 bits (179), Expect = 4.646e-13
Identity = 75/280 (26.79%), Postives = 122/280 (43.57%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDIKVTSEITAEISC 1011
            +CPE C    C   ++ C   GL +IP N P  I ++ L  QN                             ++  I + AFS    L+ +DLS+N++  +  + F+ L SL +LVL  N+  +++K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  LQ      DN  + S  R     C  P+ L    I  +    F+C       IP  +    K+  +  A+++C
Sbjct:  280 QCPESC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------AIKVIPAGAFSPYKRLRRIDLSNNQISELASDAFQGLRSLNSLVLYGNKITEISKGLFEGLFSLQLLLLNANKIACLRVDAFQDLHN-LNLLSLYDNKLQTIAKGTFSSLRAIQTLHLAQNPFICDCHLKWLADYLQ------DNPIETSGAR-----CTSPRRLANKRIGQIKSKKFRCSAREQYFIPGTEDYRSKLGGDCFADLAC 514          

HSP 3 Score: 56.6102 bits (135), Expect = 6.410e-8
Identity = 64/255 (25.10%), Postives = 113/255 (44.31%), Query Frame = 1
Query:  199 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLS--RYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNT--FKSLSLKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            CP  C   +C  T + C   GL  +P N PR  +++ L+  N    ++T  + +  R+      L+ L +    +T+IE  AF  L  L+ L L+ N L  ++P      +  L  L L  N+   + + +FRG V +++L +   H+  +   + + +   L  L L +N +  LS   F+ + + L    L +N   C C + WL+  L+ R       P+  L       C  P +L+G ++  +    F C
Sbjct:   36 CPTQC---SCTGTTVDCHGQGLRSVPRNIPRNTERLDLNANNLT--KITKADFAGLRH------LRVLQLMENKITTIERGAFQDLKELERLRLNRNNLA-VFPELLFLGTTKLHRLDLSENQIQGVPRKAFRGAVEIKNLQLDYNHISCIEDGAFRALRD-LEVLTLNNNNISRLSVASFNHMPK-LRTFRLHSNNLQCDCHVAWLSEWLRQR-------PRLGLYT----QCMSPPHLRGHNVAEVQKKEFVC 265          
BLAST of slit-2 vs. Ensembl Medaka
Match: slit2 (slit guidance ligand 2 [Source:NCBI gene;Acc:101173607])

HSP 1 Score: 78.1814 bits (191), Expect = 1.393e-14
Identity = 79/257 (30.74%), Postives = 115/257 (44.75%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLT--YTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ 948
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F     T  +  L         L+K+ +SN  +T IE   F     + EL L+SN+L  I+ +  K L  L+TL+L SNR   ++  SF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I+++++  F C+
Sbjct:  455 DLACPEKCR---CEGTTVDCSNQKLTKIPDHIPQYTAELRLNNNEFTVLEATGIFKKLPH-------LRKINLSNNRITDIEEGTFEGASGVNELILTSNKLENIHHSMLKGLGGLRTLMLRSNRISCVSNSSFVGLSSVRL------------------------LSLYDNQVTSMTPGAFDTL-HSLSTLNLLANPFNCNCHLAWLGDWL--RRKR---------IVTGNPRCQNPYFLKEIPIQDVAVQDFACE 665          

HSP 2 Score: 70.8626 bits (172), Expect = 3.013e-12
Identity = 74/274 (27.01%), Postives = 121/274 (44.16%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISC 1011
            +CPE C    C   ++ C   GL +IP N P  I ++ L  QN                             ++  I + AFS    L+ +DLS+N++  +  + F+ L SL +LVL  N+  +++K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  LQ      DN  + S  R     C  P+ L    I  +    F+C   +  R   K+  +  A+++C
Sbjct:  232 QCPESC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------AIKVIPAGAFSPYKRLRRIDLSNNQISELASDAFQGLRSLNSLVLYGNKITEISKGLFEGLFSLQLLLLNANKIACLRVDAFQDLHN-LNLLSLYDNKLQTIAKGTFSSLRAIQTLHLAQNPFICDCHLKWLADYLQ------DNPIETSGAR-----CTSPRRLANKRIGQIKSKKFRCSGTEDYR--SKLGGDCFADLAC 458          
BLAST of slit-2 vs. Ensembl Medaka
Match: slit2 (slit guidance ligand 2 [Source:NCBI gene;Acc:101173607])

HSP 1 Score: 78.1814 bits (191), Expect = 1.425e-14
Identity = 79/257 (30.74%), Postives = 115/257 (44.75%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLT--YTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ 948
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F     T  +  L         L+K+ +SN  +T IE   F     + EL L+SN+L  I+ +  K L  L+TL+L SNR   ++  SF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I+++++  F C+
Sbjct:  515 DLACPEKCR---CEGTTVDCSNQKLTKIPDHIPQYTAELRLNNNEFTVLEATGIFKKLPH-------LRKINLSNNRITDIEEGTFEGASGVNELILTSNKLENIHHSMLKGLGGLRTLMLRSNRISCVSNSSFVGLSSVRL------------------------LSLYDNQVTSMTPGAFDTLHS-LSTLNLLANPFNCNCHLAWLGDWL--RRKR---------IVTGNPRCQNPYFLKEIPIQDVAVQDFACE 725          

HSP 2 Score: 73.1738 bits (178), Expect = 4.895e-13
Identity = 75/280 (26.79%), Postives = 122/280 (43.57%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDIKVTSEITAEISC 1011
            +CPE C    C   ++ C   GL +IP N P  I ++ L  QN                             ++  I + AFS    L+ +DLS+N++  +  + F+ L SL +LVL  N+  +++K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  LQ      DN  + S  R     C  P+ L    I  +    F+C       IP  +    K+  +  A+++C
Sbjct:  284 QCPESC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------AIKVIPAGAFSPYKRLRRIDLSNNQISELASDAFQGLRSLNSLVLYGNKITEISKGLFEGLFSLQLLLLNANKIACLRVDAFQDLHN-LNLLSLYDNKLQTIAKGTFSSLRAIQTLHLAQNPFICDCHLKWLADYLQ------DNPIETSGAR-----CTSPRRLANKRIGQIKSKKFRCSAREQYFIPGTEDYRSKLGGDCFADLAC 518          

HSP 3 Score: 56.6102 bits (135), Expect = 6.750e-8
Identity = 64/255 (25.10%), Postives = 113/255 (44.31%), Query Frame = 1
Query:  199 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLS--RYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNT--FKSLSLKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            CP  C   +C  T + C   GL  +P N PR  +++ L+  N    ++T  + +  R+      L+ L +    +T+IE  AF  L  L+ L L+ N L  ++P      +  L  L L  N+   + + +FRG V +++L +   H+  +   + + +   L  L L +N +  LS   F+ + + L    L +N   C C + WL+  L+ R       P+  L       C  P +L+G ++  +    F C
Sbjct:   36 CPTQC---SCTGTTVDCHGQGLRSVPRNIPRNTERLDLNANNLT--KITKADFAGLRH------LRVLQLMENKITTIERGAFQDLKELERLRLNRNNLA-VFPELLFLGTTKLHRLDLSENQIQGVPRKAFRGAVEIKNLQLDYNHISCIEDGAFRALRD-LEVLTLNNNNISRLSVASFNHMPK-LRTFRLHSNNLQCDCHVAWLSEWLRQR-------PRLGLYT----QCMSPPHLRGHNVAEVQKKEFVC 265          
BLAST of slit-2 vs. Ensembl Medaka
Match: slit2 (slit guidance ligand 2 [Source:NCBI gene;Acc:101173607])

HSP 1 Score: 78.1814 bits (191), Expect = 1.483e-14
Identity = 79/257 (30.74%), Postives = 115/257 (44.75%), Query Frame = 1
Query:  190 DSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLT--YTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ 948
            D  CPE C    C+ T + C    L +IP + P+   ++ L+N  F     T  +  L         L+K+ +SN  +T IE   F     + EL L+SN+L  I+ +  K L  L+TL+L SNR   ++  SF GL    L                        L+L DN++  ++   FD L   L  LNL  NPFNC+C L WL   L  R KR         +   NP C+ P  LK   I+++++  F C+
Sbjct:  515 DLACPEKCR---CEGTTVDCSNQKLTKIPDHIPQYTAELRLNNNEFTVLEATGIFKKLPH-------LRKINLSNNRITDIEEGTFEGASGVNELILTSNKLENIHHSMLKGLGGLRTLMLRSNRISCVSNSSFVGLSSVRL------------------------LSLYDNQVTSMTPGAFDTLHS-LSTLNLLANPFNCNCHLAWLGDWL--RRKR---------IVTGNPRCQNPYFLKEIPIQDVAVQDFACE 725          

HSP 2 Score: 73.1738 bits (178), Expect = 5.005e-13
Identity = 75/280 (26.79%), Postives = 122/280 (43.57%), Query Frame = 1
Query:  196 ECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSL-SLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCH-LKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQ------IPKLQRIDIKVTSEITAEISC 1011
            +CPE C    C   ++ C   GL +IP N P  I ++ L  QN                             ++  I + AFS    L+ +DLS+N++  +  + F+ L SL +LVL  N+  +++K  F GL    L + + + +  L  ++ + +   L  L+L DN+L+ ++       R +  L+L  NPF C C LKWLA  LQ      DN  + S  R     C  P+ L    I  +    F+C       IP  +    K+  +  A+++C
Sbjct:  284 QCPESC---TCSNNIVDCRGKGLTEIPTNLPETITEIRLE-QN-----------------------------AIKVIPAGAFSPYKRLRRIDLSNNQISELASDAFQGLRSLNSLVLYGNKITEISKGLFEGLFSLQLLLLNANKIACLRVDAFQDLHN-LNLLSLYDNKLQTIAKGTFSSLRAIQTLHLAQNPFICDCHLKWLADYLQ------DNPIETSGAR-----CTSPRRLANKRIGQIKSKKFRCSAREQYFIPGTEDYRSKLGGDCFADLAC 518          

HSP 3 Score: 56.9954 bits (136), Expect = 6.129e-8
Identity = 64/255 (25.10%), Postives = 113/255 (44.31%), Query Frame = 1
Query:  199 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLS--RYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNT--FKSLSLKTLVLDSNRNLQLAKDSFRGLV-VQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLS-NDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQC 945
            CP  C   +C  T + C   GL  +P N PR  +++ L+  N    ++T  + +  R+      L+ L +    +T+IE  AF  L  L+ L L+ N L  ++P      +  L  L L  N+   + + +FRG V +++L +   H+  +   + + +   L  L L +N +  LS   F+ + + L    L +N   C C + WL+  L+ R       P+  L       C  P +L+G ++  +    F C
Sbjct:   36 CPTQC---SCTGTTVDCHGQGLRSVPRNIPRNTERLDLNANNLT--KITKADFAGLRH------LRVLQLMENKITTIERGAFQDLKELERLRLNRNNLA-VFPELLFLGTTKLHRLDLSENQIQGVPRKAFRGAVEIKNLQLDYNHISCIEDGAFRALRD-LEVLTLNNNNISRLSVASFNHMPK-LRTFRLHSNNLQCDCHVAWLSEWLRQR-------PRLGLYT----QCMSPPHLRGHNVAEVQKKEFVC 265          
BLAST of slit-2 vs. Planmine SMEST
Match: SMESG000033458.1 (SMESG000033458.1)

HSP 1 Score: 997.268 bits (2577), Expect = 0.000e+0
Identity = 504/506 (99.60%), Postives = 505/506 (99.80%), Query Frame = 1
Query:   97 MYIFRCIYRXXXXXXXXXXXXXVCLSIRPTKDSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQEIKATW 1614
            MYIFRCIYRLLLTLIIELLTIEVCLSIRPTKDSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSG+NQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPI SPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQEIKATW
Sbjct:    1 MYIFRCIYRLLLTLIIELLTIEVCLSIRPTKDSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGLNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPIKSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQEIKATW 506          
BLAST of slit-2 vs. Planmine SMEST
Match: SMESG000033458.1 (SMESG000033458.1)

HSP 1 Score: 942.184 bits (2434), Expect = 0.000e+0
Identity = 481/506 (95.06%), Postives = 483/506 (95.45%), Query Frame = 1
Query:   97 MYIFRCIYRXXXXXXXXXXXXXVCLSIRPTKDSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQEIKATW 1614
            MYIFRCIYRLLLTLIIELLTIEVCLSIRPTKDSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLS                      +SNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSG+NQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPI SPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQEIKATW
Sbjct:    1 MYIFRCIYRLLLTLIIELLTIEVCLSIRPTKDSECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLS----------------------NSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGLNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPIKSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQEIKATW 484          
BLAST of slit-2 vs. Planmine SMEST
Match: SMESG000026986.1 (SMESG000026986.1)

HSP 1 Score: 329.331 bits (843), Expect = 1.556e-106
Identity = 192/474 (40.51%), Postives = 288/474 (60.76%), Query Frame = 1
Query:  193 SECPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKN--ILKGYEVGVYSESQTYDVPQMSPYHES--NTGRLLDFKTQQEI 1602
            + CP LCNQ +C    L C   GL  IP NPP    +VI+ NQ F  P L Y NLSRYG+EEI+LK LTI NC LT IESE+FSHL++L E+DLS N+L  IYP TFK+L+LK+L L+ NR L+L  +SF+GLVV SLS+ +C L  L  +SIK+I+G+L   +L+ N L+ L+  F LLF+ L+ + L  N   C C++KWL   L  ++K +  +   SL++     C  P  ++G +I  L    F C  P L+ I + +++  +A + C S   S++QV W  R  ++   ++  D       ASI V+K S+ D +SC++ NENGN +VD+ IKWP    E     +    + +  F+  +N + +S+I +       NYL+IKQ+TF+EM+++I  TF++T +TF L+Y+ ++ R   S  K      GY+ G+YS++Q YD P+ S  +++   + +L+DFKTQ+ I
Sbjct:   19 ANCPVLCNQNSCTYGFLFCVDIGLEMIPENPPPKTTQVIVKNQIFKNPILGYKNLSRYGTEEILLKVLTIQNCGLTEIESESFSHLVHLMEMDLSFNQLQMIYPRTFKALNLKSLKLNGNRLLKLTGNSFQGLVVSSLSLANCGLDSLEFDSIKEIAGHLIRFDLSQNDLKSLNFRFYLLFKRLEEIQLGGNQLKCDCRIKWLNRIL--KSKNQSKASIESLIK-----CSQPYEIRGKAISQLEESQFLCSKPNLKAISVDISTR-SAILYCSSSPNSDTQVSWHLRNAVNYSLHKLEDLIETPFNASIKVNKNSQSDMFSCIVKNENGNVSVDLNIKWP----ENTSETLTDKGHPILLFSTPSNNSSTSIIPQT-----TNYLYIKQFTFLEMIISIGSTFVVTTITFSLIYLCLSRRLNISIGKQSPCKIGYQGGIYSDTQIYDSPRYSTPNKTFQQSAQLIDFKTQRLI 475          
BLAST of slit-2 vs. Planmine SMEST
Match: SMESG000026559.1 (SMESG000026559.1)

HSP 1 Score: 267.314 bits (682), Expect = 2.367e-82
Identity = 171/453 (37.75%), Postives = 243/453 (53.64%), Query Frame = 1
Query:  199 CPELCNQGACKLTMLLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPV-CEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNS--QVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINS---PPNTVNQFNLRNNITKSSVILKEFDKLHV-NYLWIKQYTFIEMVLAICGTFIITLVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVP 1536
            CP +C++ AC+  +L C   GLLQIP    +   K+I+SNQ F  P LTY+N S YG     ++K+ +  C L SI S  FSHL  L+ LDLS N L  I P+TFK+L L+ L LD N+ +Q  + SFRGL V  LS+ DC+L  L  E   +IS  L  L L +N+L  +   F +LF  L +L +  NPFNC+C L+WL   L +R K  + S   S  R+ N   C YP  +KG  I +L +  F C  P+L+ ID+ +TS  +A+++CIS+  ++S   V W   +  +      P+  S  N AS+ V +KS  D Y C+I N N   TV I I WP          +N+    PN +  +    N T           LHV +  + KQ+T +EM+  I GTF IT++ F+ +Y  +    K +  K     YE  + S+SQTYD+P
Sbjct:   26 CPSVCHEMACQTGVLACTDGGLLQIPPVLHQKTHKIIVSNQRFSSPHLTYSNFSNYGPPNYKIEKIALQFCELVSIASNCFSHLTDLRVLDLSHNLLGEIPPDTFKALHLQFLRLDDNKMIQFHRFSFRGLNVAELSLFDCNLTELDFEVFSEISERLKKLILTNNKLNVIDKRFRILFENLPDLQINENPFNCTCNLRWLNSVLVSRKKAINLS---SSKRIPNQAQCNYPDRVKGKQIADLDLKDFDCDSPRLKLIDVFMTSTSSAKLTCISEPKAHSSPDVIWMAEHRNT----YVPEIQSSEN-ASLSVLRKSRIDKYKCVIKNNNDYVTVVISIHWPVKRVNNASQSLNTLGVSPNDMIPYLPNANST-----------LHVRSVFYEKQFTLLEMIGGIVGTFTITMILFLCIYRHLAMTMKRNDKKKWYLSYETAIGSDSQTYDIP 459          
BLAST of slit-2 vs. Planmine SMEST
Match: SMESG000002157.1 (SMESG000002157.1)

HSP 1 Score: 262.307 bits (669), Expect = 6.535e-80
Identity = 165/471 (35.03%), Postives = 262/471 (55.63%), Query Frame = 1
Query:  193 SECPELCNQGACKLTMLLCETPG-LLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILKKLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLVLDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLADNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDNSPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSEITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKSEFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRNNITKSSVILKEFDKLHVNYLWI-KQYTFIEMVLAICGTFIIT-LVTFILLYVVINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPYHESNTGRLLDFKTQQ 1596
            + CP  C Q  C    L+C  P  L  +P+N P+ I  + +S QNF+   L+Y  LS YG E+I L+ L ++  ++ +IE EAFSHLI L+ LDLS+NRL  ++   FK LSL  L LD+N NL L + SFRGLVV SLS+K C+LK L++E IK++SG+LT L L+ N+L  +   F+LLF  L+ ++L+ NPF C+CQL+WL  +L+ R   ++ +   S LR TN     PK L G ++ +LS  +  C+ P ++ IDI +    +  +SC + +   + VKWR++   S  +YR+ D +  + ++ I +  ++  D YSC + N  G   +D+ I WPT N       I+S     N+       T     L   +   +   ++ KQ++  E+++++  T I+T L++ +   +   +R   +  +      +  V SE Q +++ Q     E    +LLDFKTQQ
Sbjct:   83 AGCPSYCQQQPCLSGKLVCIEPNKLTALPLNIPKIIYHISISGQNFINTTLSYNALSHYGPEQINLRILQLTFTNIENIEPEAFSHLIALKSLDLSNNRLRILHSGIFKGLSLDYLRLDNNENLILLEGSFRGLVVSSLSLKSCYLKNLSYEIIKEVSGHLTKLYLSHNQLSGIDKKFELLFERLELIDLKENPFFCTCQLRWLTKSLKARQHAKEKA-LMSELRCTN-----PKELSGQTLISLSESNLICKPPGVKEIDIFLHGNNSGRLSCEAINALETNVKWRHKLFASENYYRFQDYSPALGRSLISIESRNNVDHYSCYVQNSKGKVNIDVNIMWPTNN-------ISSFIYNSNEVRYIYPETFDDNQLNLNNDNPIEKFFMRKQFSLFELLISMVATLIVTSLLSTLCFCLFFRHRFLPNLFQKSQPMTDSAVTSEVQMHNMSQFPSSQELKANQLLDFKTQQ 540          
The following BLAST results are available for this feature:
BLAST of slit-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLIT23.562e-1633.07slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT23.845e-1633.07slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT23.884e-1633.07slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT23.893e-1633.07slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT23.949e-1633.07slit guidance ligand 2 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of slit-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slt-11.434e-1128.36Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
lron-93.128e-824.64ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
lron-93.128e-824.64ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
lron-93.455e-824.64ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
lron-111.421e-728.57ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
back to top
BLAST of slit-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kek32.920e-1630.54gene:FBgn0028370 transcript:FBtr0300848[more]
kek32.920e-1630.54gene:FBgn0028370 transcript:FBtr0080752[more]
sli8.419e-1327.95gene:FBgn0264089 transcript:FBtr0330730[more]
sli8.957e-1327.95gene:FBgn0264089 transcript:FBtr0330729[more]
sli8.957e-1327.95gene:FBgn0264089 transcript:FBtr0330732[more]
back to top
BLAST of slit-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4cb3.832e-1629.03leucine rich repeat containing 4C, genome duplicat... [more]
lrrc4cb3.832e-1629.03leucine rich repeat containing 4C, genome duplicat... [more]
slit29.118e-1531.37slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
slit29.242e-1531.37slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
slit29.262e-1531.37slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of slit-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atad3a4.590e-1632.68ATPase family, AAA domain containing 3A [Source:Xe... [more]
atad3a4.671e-1632.68ATPase family, AAA domain containing 3A [Source:Xe... [more]
atad3a4.761e-1632.68ATPase family, AAA domain containing 3A [Source:Xe... [more]
atad3a5.092e-1632.68ATPase family, AAA domain containing 3A [Source:Xe... [more]
atad3a5.226e-1632.68ATPase family, AAA domain containing 3A [Source:Xe... [more]
back to top
BLAST of slit-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slit23.920e-1733.07slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit28.390e-1733.07slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit28.504e-1733.07slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit28.964e-1733.07slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
Slit29.055e-1733.07slit guidance ligand 2 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of slit-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WVC1|SLIT2_RAT7.758e-1732.02Slit homolog 2 protein (Fragment) OS=Rattus norveg... [more]
sp|Q9R1B9|SLIT2_MOUSE5.948e-1633.07Slit homolog 2 protein OS=Mus musculus OX=10090 GN... [more]
sp|O94813|SLIT2_HUMAN1.865e-1533.07Slit homolog 2 protein OS=Homo sapiens OX=9606 GN=... [more]
sp|O88279|SLIT1_RAT5.741e-1428.79Slit homolog 1 protein OS=Rattus norvegicus OX=101... [more]
sp|Q8C031|LRC4C_MOUSE6.024e-1425.81Leucine-rich repeat-containing protein 4C OS=Mus m... [more]
back to top
BLAST of slit-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIL50.000e+099.80Slit-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A5P8I4L02.416e-7937.09PXDN-like protein OS=Schmidtea mediterranea OX=793... [more]
A0A0R3SAT81.257e-5031.21Ig-like domain-containing protein OS=Hymenolepis d... [more]
A0A0R3TNY62.918e-4930.27Ig-like domain-containing protein OS=Rodentolepis ... [more]
A0A068YC115.723e-4731.76Variable lymphocyte receptor OS=Echinococcus multi... [more]
back to top
BLAST of slit-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4cb8.063e-1626.63leucine-rich repeat-containing protein 4C-like [So... [more]
lrrc4.28.457e-1426.33leucine rich repeat containing 4.2 [Source:ZFIN;Ac... [more]
lrrc4ca1.189e-1325.08leucine-rich repeat-containing protein 4C [Source:... [more]
slit21.321e-1329.80slit homolog 2 (Drosophila) [Source:ZFIN;Acc:ZDB-G... [more]
lrrc4ba7.512e-1325.52leucine-rich repeat-containing protein 4B-like [So... [more]
back to top
BLAST of slit-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4ba1.464e-1224.42leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
pxdn1.667e-1124.10peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
islr23.972e-1123.00immunoglobulin superfamily containing leucine-rich... [more]
LGI15.810e-1129.26leucine rich glioma inactivated 1 [Source:HGNC Sym... [more]
flrt32.043e-927.08fibronectin leucine rich transmembrane 3 [Source:Z... [more]
back to top
BLAST of slit-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slit-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO481791.772e-823.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471091.565e-727.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slit-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4cb6.748e-1526.01leucine rich repeat containing 4C [Source:NCBI gen... [more]
slit21.388e-1430.74slit guidance ligand 2 [Source:NCBI gene;Acc:10117... [more]
slit21.393e-1430.74slit guidance ligand 2 [Source:NCBI gene;Acc:10117... [more]
slit21.425e-1430.74slit guidance ligand 2 [Source:NCBI gene;Acc:10117... [more]
slit21.483e-1430.74slit guidance ligand 2 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of slit-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033458.10.000e+099.60SMESG000033458.1[more]
SMESG000033458.10.000e+095.06SMESG000033458.1[more]
SMESG000026986.11.556e-10640.51SMESG000026986.1[more]
SMESG000026559.12.367e-8237.75SMESG000026559.1[more]
SMESG000002157.16.535e-8035.03SMESG000002157.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012984
GenBankAFJ24869.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012984 ID=SMED30012984|Name=slit-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1774bp
TGAAAATCTGATGCTGAGTGTTTTTTGATTACTGGATAAAAATTAGATGA
TTTTTATGTAAAAATGGATATTTCATGATTGTGGAACGTTATGAAGATGT
ATATATTCAGATGTATTTATCGCCTTCTTTTGACTCTTATTATCGAGCTA
CTAACTATTGAAGTTTGCCTATCTATCAGACCAACAAAAGATTCGGAATG
TCCGGAATTATGTAATCAAGGTGCATGTAAATTGACAATGCTTCTGTGTG
AAACTCCAGGACTCTTACAAATTCCTATGAATCCACCTCGAGGAATTCAA
AAGGTTATATTATCAAATCAGAACTTTCTCTATCCAAGATTGACATATAC
GAATCTCTCTCGCTATGGTTCAGAGGAAATAATTCTAAAAAAGTTAACTA
TTAGCAACTGCAGTCTGACGAGTATAGAATCAGAAGCATTTTCTCATTTG
ATTTATCTTCAGGAACTTGACCTATCTAGTAATAGATTGCTTTTTATCTA
TCCAAACACATTTAAAAGTTTATCGTTGAAAACCCTTGTTTTAGATTCCA
ATAGAAATCTTCAGTTGGCAAAAGACTCATTCAGAGGTTTGGTTGTTCAA
TCCTTGTCAATGAAAGACTGTCATTTAAAGATACTAACTCACGAAAGTAT
CAAACAGATTTCCGGTTACTTAACTACTCTCAATCTCGCTGATAACCGAC
TGGAATACTTAAGCAACGATTTTGATTTGTTGTTTCGAGGTCTTGACAAT
TTAAATTTGGAAAACAATCCATTTAATTGTTCATGTCAATTGAAATGGTT
AGCATTAACATTGCAAACGAGAACAAAACGACGAGACAATTCTCCCAAAC
ATAGTTTACTTCGACTCACCAATCCTGTCTGTGAATATCCCAAAAACTTG
AAAGGTTCCTCAATTGAAAACCTCTCAATCGTTTCATTTCAATGTCAAAT
TCCAAAATTGCAACGAATAGACATCAAGGTAACGTCTGAAATAACCGCGG
AAATCTCTTGTATTTCAGACGATATGTCAAATTCTCAAGTAAAATGGCGA
TACAGGTACAACTTGTCGCCTCTTTTCTATAGATATCCCGATCAGAATTC
TGGTGTAAATCAAGCATCAATTATTGTTAGTAAAAAATCGGAATTTGATT
TCTACTCCTGTTTGATTATTAATGAGAACGGCAACGCAACCGTTGACATA
AAGATCAAATGGCCAACTTTGAATAAAGAATATGTTGAGTCCCCTATAAA
CTCACCACCGAATACTGTCAATCAGTTTAATTTGAGAAATAATATTACAA
AATCTTCAGTAATTTTGAAAGAATTTGATAAACTTCATGTTAATTATTTG
TGGATAAAACAGTATACGTTCATCGAGATGGTACTGGCCATCTGTGGAAC
TTTCATTATTACTCTGGTAACGTTTATTTTACTGTATGTCGTGATTAATT
ATCGGAGAAAGAATAGTCGTTCAAAAAATATCTTAAAAGGTTATGAAGTA
GGAGTTTATTCAGAATCTCAGACTTATGACGTTCCACAAATGTCTCCATA
TCATGAATCAAACACAGGACGATTACTGGATTTCAAAACTCAGCAAGAAA
TCAAGGCAACTTGGTGATAATTTCAACTGTTGCTCTTGATATCAAAGATG
TATTTTATTTGGAATGATAACTCAAAGTTGAAAATGATATTCTGTTTATT
CATTTATTATTTGAATTTTATCAAATGTGATGTTTTTTTTCAAAAATAGA
TATAATTTTAAAAAATTATTGAGG
back to top

protein sequence of SMED30012984-orf-1

>SMED30012984-orf-1 ID=SMED30012984-orf-1|Name=SMED30012984-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=509bp
MKMYIFRCIYRLLLTLIIELLTIEVCLSIRPTKDSECPELCNQGACKLTM
LLCETPGLLQIPMNPPRGIQKVILSNQNFLYPRLTYTNLSRYGSEEIILK
KLTISNCSLTSIESEAFSHLIYLQELDLSSNRLLFIYPNTFKSLSLKTLV
LDSNRNLQLAKDSFRGLVVQSLSMKDCHLKILTHESIKQISGYLTTLNLA
DNRLEYLSNDFDLLFRGLDNLNLENNPFNCSCQLKWLALTLQTRTKRRDN
SPKHSLLRLTNPVCEYPKNLKGSSIENLSIVSFQCQIPKLQRIDIKVTSE
ITAEISCISDDMSNSQVKWRYRYNLSPLFYRYPDQNSGVNQASIIVSKKS
EFDFYSCLIINENGNATVDIKIKWPTLNKEYVESPINSPPNTVNQFNLRN
NITKSSVILKEFDKLHVNYLWIKQYTFIEMVLAICGTFIITLVTFILLYV
VINYRRKNSRSKNILKGYEVGVYSESQTYDVPQMSPYHESNTGRLLDFKT
QQEIKATW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000483Cys-rich_flank_reg_C
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000483Cysteine-rich flanking region, C-terminalSMARTSM00082lrrct1coord: 226..286
e-value: 2.5E-6
score: 37.0
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 169..295
e-value: 3.5E-16
score: 61.1
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 41..168
e-value: 4.6E-15
score: 56.8
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 99..155
e-value: 2.5E-12
score: 46.3
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 217..238
score: 5.132
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 122..143
score: 6.449
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 98..119
score: 5.848
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 193..214
score: 7.442
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 145..166
score: 5.009
NoneNo IPR availablePANTHERPTHR45842FAMILY NOT NAMEDcoord: 17..321
NoneNo IPR availablePANTHERPTHR45842:SF11coord: 17..321
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..28
score: 0.86
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 43..285
NoneNo IPR availableTMHMMTMhelixcoord: 430..452
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 288..373
score: 6.923