slc25a-27

Overview
Nameslc25a-27 (AKN21595.1)
Smed IDSMED30012974
Length (bp)1236
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-27 (SMED30012974) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-27 (SMED30012974) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc25a-27 (SMED30012974) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc25a-27 (SMED30012974) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012974

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30012974SMESG000061901.1 dd_Smed_v4_543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012974SMESG000061901.1 dd_Smed_v4_543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012974SMESG000061901.1 dd_Smed_v4_543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012974SMESG000061901.1 dd_Smed_v4_543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012974SMESG000061901.1 dd_Smed_v4_543_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc25a-27 vs. Ensembl Human
Match: SLC25A3 (solute carrier family 25 member 3 [Source:HGNC Symbol;Acc:HGNC:10989])

HSP 1 Score: 441.425 bits (1134), Expect = 3.335e-154
Identity = 228/311 (73.31%), Postives = 261/311 (83.92%), Query Frame = 1
Query:   94 ASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            A+  +   SC+YGS +F+ LCGLGGIISCGTTHTA+VPLDLVKCR+QVD  KYKGIF GF V++KE+G+RGLAKGWAPTF+GYS+QGL KFG YEVFK  Y+++LGEEN YLWRTSLYLAASASAEFFADI L PMEAAKVRIQT PGYA+TLR+A PKM  +EGL  FYKG+ PLW RQIPYTMMKFACFERT+EALY++VVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +    V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   48 AAAVEEQYSCDYGSGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 358          
BLAST of slc25a-27 vs. Ensembl Human
Match: SLC25A3 (solute carrier family 25 member 3 [Source:HGNC Symbol;Acc:HGNC:10989])

HSP 1 Score: 441.425 bits (1134), Expect = 3.335e-154
Identity = 228/311 (73.31%), Postives = 261/311 (83.92%), Query Frame = 1
Query:   94 ASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            A+  +   SC+YGS +F+ LCGLGGIISCGTTHTA+VPLDLVKCR+QVD  KYKGIF GF V++KE+G+RGLAKGWAPTF+GYS+QGL KFG YEVFK  Y+++LGEEN YLWRTSLYLAASASAEFFADI L PMEAAKVRIQT PGYA+TLR+A PKM  +EGL  FYKG+ PLW RQIPYTMMKFACFERT+EALY++VVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +    V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   48 AAAVEEQYSCDYGSGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 358          
BLAST of slc25a-27 vs. Ensembl Human
Match: SLC25A3 (solute carrier family 25 member 3 [Source:HGNC Symbol;Acc:HGNC:10989])

HSP 1 Score: 441.039 bits (1133), Expect = 4.185e-154
Identity = 227/313 (72.52%), Postives = 260/313 (83.07%), Query Frame = 1
Query:   88 NCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            N A+      SCE+GS K+YALCG GG++SCG THTA+VPLDLVKCR+QVD  KYKGIF GF V++KE+G+RGLAKGWAPTF+GYS+QGL KFG YEVFK  Y+++LGEEN YLWRTSLYLAASASAEFFADI L PMEAAKVRIQT PGYA+TLR+A PKM  +EGL  FYKG+ PLW RQIPYTMMKFACFERT+EALY++VVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +    V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   45 NLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 357          
BLAST of slc25a-27 vs. Ensembl Human
Match: SLC25A3 (solute carrier family 25 member 3 [Source:HGNC Symbol;Acc:HGNC:10989])

HSP 1 Score: 441.039 bits (1133), Expect = 4.185e-154
Identity = 227/313 (72.52%), Postives = 260/313 (83.07%), Query Frame = 1
Query:   88 NCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            N A+      SCE+GS K+YALCG GG++SCG THTA+VPLDLVKCR+QVD  KYKGIF GF V++KE+G+RGLAKGWAPTF+GYS+QGL KFG YEVFK  Y+++LGEEN YLWRTSLYLAASASAEFFADI L PMEAAKVRIQT PGYA+TLR+A PKM  +EGL  FYKG+ PLW RQIPYTMMKFACFERT+EALY++VVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +    V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   45 NLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 357          
BLAST of slc25a-27 vs. Ensembl Human
Match: SLC25A3 (solute carrier family 25 member 3 [Source:HGNC Symbol;Acc:HGNC:10989])

HSP 1 Score: 441.039 bits (1133), Expect = 4.185e-154
Identity = 227/313 (72.52%), Postives = 260/313 (83.07%), Query Frame = 1
Query:   88 NCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            N A+      SCE+GS K+YALCG GG++SCG THTA+VPLDLVKCR+QVD  KYKGIF GF V++KE+G+RGLAKGWAPTF+GYS+QGL KFG YEVFK  Y+++LGEEN YLWRTSLYLAASASAEFFADI L PMEAAKVRIQT PGYA+TLR+A PKM  +EGL  FYKG+ PLW RQIPYTMMKFACFERT+EALY++VVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +    V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   45 NLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 357          
BLAST of slc25a-27 vs. Ensembl Celegans
Match: F01G4.6 (Phosphate carrier protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P40614])

HSP 1 Score: 438.343 bits (1126), Expect = 9.618e-154
Identity = 227/316 (71.84%), Postives = 255/316 (80.70%), Query Frame = 1
Query:   88 NCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKLAGK 1035
            NCAS   +    E+GS K+YA C LGG++SCG THTAIVPLDLVKCRIQV+  KY GI TGF+ +I EEG R L KGWAPT +GYS QGLGKFG YE+FK+ YAD+LGEENAYL+RTSLYLAASASAEFFADILL PMEA KVRIQT PG   TLR   P +   EGL GFYKG+ PLW RQIPYTMMKFACFE+T+EALYQYVVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPADTVVSKLNQ+  A  G + + LG  G+W G+ PRIIMIGTLTALQWFIYD  KVA+N+PRPPPP  P SL+ KLA +
Sbjct:   24 NCASAVSAPGQVEFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRTTIAEEGARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLAASASAEFFADILLAPMEATKVRIQTSPGAPPTLRGCAPMIYKAEGLTGFYKGLPPLWMRQIPYTMMKFACFEKTVEALYQYVVPKPRAECSKAEQLVVTFVAGYIAGVFCAIVSHPADTVVSKLNQDSQATAGGILKKLGFAGVWKGLVPRIIMIGTLTALQWFIYDSVKVALNLPRPPPPEMPASLKAKLAAQ 339          
BLAST of slc25a-27 vs. Ensembl Celegans
Match: F01G4.6 (Phosphate carrier protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P40614])

HSP 1 Score: 438.343 bits (1126), Expect = 9.618e-154
Identity = 227/316 (71.84%), Postives = 255/316 (80.70%), Query Frame = 1
Query:   88 NCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKLAGK 1035
            NCAS   +    E+GS K+YA C LGG++SCG THTAIVPLDLVKCRIQV+  KY GI TGF+ +I EEG R L KGWAPT +GYS QGLGKFG YE+FK+ YAD+LGEENAYL+RTSLYLAASASAEFFADILL PMEA KVRIQT PG   TLR   P +   EGL GFYKG+ PLW RQIPYTMMKFACFE+T+EALYQYVVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPADTVVSKLNQ+  A  G + + LG  G+W G+ PRIIMIGTLTALQWFIYD  KVA+N+PRPPPP  P SL+ KLA +
Sbjct:   24 NCASAVSAPGQVEFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRTTIAEEGARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLAASASAEFFADILLAPMEATKVRIQTSPGAPPTLRGCAPMIYKAEGLTGFYKGLPPLWMRQIPYTMMKFACFEKTVEALYQYVVPKPRAECSKAEQLVVTFVAGYIAGVFCAIVSHPADTVVSKLNQDSQATAGGILKKLGFAGVWKGLVPRIIMIGTLTALQWFIYDSVKVALNLPRPPPPEMPASLKAKLAAQ 339          
BLAST of slc25a-27 vs. Ensembl Celegans
Match: F01G4.6 (Phosphate carrier protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P40614])

HSP 1 Score: 438.343 bits (1126), Expect = 9.618e-154
Identity = 227/316 (71.84%), Postives = 255/316 (80.70%), Query Frame = 1
Query:   88 NCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKLAGK 1035
            NCAS   +    E+GS K+YA C LGG++SCG THTAIVPLDLVKCRIQV+  KY GI TGF+ +I EEG R L KGWAPT +GYS QGLGKFG YE+FK+ YAD+LGEENAYL+RTSLYLAASASAEFFADILL PMEA KVRIQT PG   TLR   P +   EGL GFYKG+ PLW RQIPYTMMKFACFE+T+EALYQYVVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPADTVVSKLNQ+  A  G + + LG  G+W G+ PRIIMIGTLTALQWFIYD  KVA+N+PRPPPP  P SL+ KLA +
Sbjct:   24 NCASAVSAPGQVEFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRTTIAEEGARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLAASASAEFFADILLAPMEATKVRIQTSPGAPPTLRGCAPMIYKAEGLTGFYKGLPPLWMRQIPYTMMKFACFEKTVEALYQYVVPKPRAECSKAEQLVVTFVAGYIAGVFCAIVSHPADTVVSKLNQDSQATAGGILKKLGFAGVWKGLVPRIIMIGTLTALQWFIYDSVKVALNLPRPPPPEMPASLKAKLAAQ 339          
BLAST of slc25a-27 vs. Ensembl Celegans
Match: F01G4.6 (Phosphate carrier protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P40614])

HSP 1 Score: 429.483 bits (1103), Expect = 1.804e-149
Identity = 223/304 (73.36%), Postives = 250/304 (82.24%), Query Frame = 1
Query:  124 EYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKLAGK 1035
            E+GS K+YA C LGG++SCG THTAIVPLDLVKCRIQV+  KY GI TGF+ +I EEG R L KGWAPT +GYS QGLGKFG YE+FK+ YAD+LGEENAYL+RTSLYLAASASAEFFADILL PMEA KVRIQT PG   TLR   P +   EGL GFYKG+ PLW RQIPYTMMKFACFE+T+EALYQYVVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPADTVVSKLNQ+  A  G + + LG  G+W G+ PRIIMIGTLTALQWFIYD  KVA+N+PRPPPP  P SL+ KLA +
Sbjct:   83 EFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRTTIAEEGARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLAASASAEFFADILLAPMEATKVRIQTSPGAPPTLRGCAPMIYKAEGLTGFYKGLPPLWMRQIPYTMMKFACFEKTVEALYQYVVPKPRAECSKAEQLVVTFVAGYIAGVFCAIVSHPADTVVSKLNQDSQATAGGILKKLGFAGVWKGLVPRIIMIGTLTALQWFIYDSVKVALNLPRPPPPEMPASLKAKLAAQ 386          
BLAST of slc25a-27 vs. Ensembl Celegans
Match: F01G4.6 (Phosphate carrier protein, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P40614])

HSP 1 Score: 429.483 bits (1103), Expect = 1.804e-149
Identity = 223/304 (73.36%), Postives = 250/304 (82.24%), Query Frame = 1
Query:  124 EYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKLAGK 1035
            E+GS K+YA C LGG++SCG THTAIVPLDLVKCRIQV+  KY GI TGF+ +I EEG R L KGWAPT +GYS QGLGKFG YE+FK+ YAD+LGEENAYL+RTSLYLAASASAEFFADILL PMEA KVRIQT PG   TLR   P +   EGL GFYKG+ PLW RQIPYTMMKFACFE+T+EALYQYVVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPADTVVSKLNQ+  A  G + + LG  G+W G+ PRIIMIGTLTALQWFIYD  KVA+N+PRPPPP  P SL+ KLA +
Sbjct:   83 EFGSGKYYAYCALGGVLSCGITHTAIVPLDLVKCRIQVNPEKYTGIATGFRTTIAEEGARALVKGWAPTLLGYSAQGLGKFGFYEIFKNVYADMLGEENAYLYRTSLYLAASASAEFFADILLAPMEATKVRIQTSPGAPPTLRGCAPMIYKAEGLTGFYKGLPPLWMRQIPYTMMKFACFEKTVEALYQYVVPKPRAECSKAEQLVVTFVAGYIAGVFCAIVSHPADTVVSKLNQDSQATAGGILKKLGFAGVWKGLVPRIIMIGTLTALQWFIYDSVKVALNLPRPPPPEMPASLKAKLAAQ 386          
BLAST of slc25a-27 vs. Ensembl Fly
Match: Mpcp1 (gene:FBgn0034497 transcript:FBtr0342679)

HSP 1 Score: 447.203 bits (1149), Expect = 1.117e-156
Identity = 227/304 (74.67%), Postives = 261/304 (85.86%), Query Frame = 1
Query:  115 SSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
             SCE+GS  ++ LCGLGGIISCG+THT +VPLDLVKCR+QVD AKYK +FTGF++S+ EEG+RGLAKGWAPTFIGYS+QGL KFGLYEVFK  Y D +GEENA+L+RT LYLAASASAEFFADI L PMEAAKV+IQT PG+A TLREALPKM ++EG+  FYKG++PLW RQIPYTMMKFACFERTLE LY+YVVPKPR  C+KGEQLVVTF+AGYIAGVFCAI+SHPADTVVSKLNQ   A   +VA+ LG  G+W G+ PRI+MIGTLTA QWFIYD  KV + +PRPPPP  PESL+KKL
Sbjct:   65 DSCEFGSNHYFLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAEEGVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKIQTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDVAKQLGWSGLWGGLVPRIVMIGTLTAAQWFIYDAVKVFLRMPRPPPPEMPESLKKKL 368          
BLAST of slc25a-27 vs. Ensembl Fly
Match: Mpcp1 (gene:FBgn0034497 transcript:FBtr0342680)

HSP 1 Score: 447.203 bits (1149), Expect = 1.117e-156
Identity = 227/304 (74.67%), Postives = 261/304 (85.86%), Query Frame = 1
Query:  115 SSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
             SCE+GS  ++ LCGLGGIISCG+THT +VPLDLVKCR+QVD AKYK +FTGF++S+ EEG+RGLAKGWAPTFIGYS+QGL KFGLYEVFK  Y D +GEENA+L+RT LYLAASASAEFFADI L PMEAAKV+IQT PG+A TLREALPKM ++EG+  FYKG++PLW RQIPYTMMKFACFERTLE LY+YVVPKPR  C+KGEQLVVTF+AGYIAGVFCAI+SHPADTVVSKLNQ   A   +VA+ LG  G+W G+ PRI+MIGTLTA QWFIYD  KV + +PRPPPP  PESL+KKL
Sbjct:   65 DSCEFGSNHYFLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAEEGVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKIQTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDVAKQLGWSGLWGGLVPRIVMIGTLTAAQWFIYDAVKVFLRMPRPPPPEMPESLKKKL 368          
BLAST of slc25a-27 vs. Ensembl Fly
Match: Mpcp1 (gene:FBgn0034497 transcript:FBtr0086303)

HSP 1 Score: 447.203 bits (1149), Expect = 1.117e-156
Identity = 227/304 (74.67%), Postives = 261/304 (85.86%), Query Frame = 1
Query:  115 SSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
             SCE+GS  ++ LCGLGGIISCG+THT +VPLDLVKCR+QVD AKYK +FTGF++S+ EEG+RGLAKGWAPTFIGYS+QGL KFGLYEVFK  Y D +GEENA+L+RT LYLAASASAEFFADI L PMEAAKV+IQT PG+A TLREALPKM ++EG+  FYKG++PLW RQIPYTMMKFACFERTLE LY+YVVPKPR  C+KGEQLVVTF+AGYIAGVFCAI+SHPADTVVSKLNQ   A   +VA+ LG  G+W G+ PRI+MIGTLTA QWFIYD  KV + +PRPPPP  PESL+KKL
Sbjct:   65 DSCEFGSNHYFLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAEEGVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAKVKIQTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDVAKQLGWSGLWGGLVPRIVMIGTLTAAQWFIYDAVKVFLRMPRPPPPEMPESLKKKL 368          
BLAST of slc25a-27 vs. Ensembl Fly
Match: Mpcp2 (gene:FBgn0026409 transcript:FBtr0075719)

HSP 1 Score: 442.58 bits (1137), Expect = 4.067e-155
Identity = 226/327 (69.11%), Postives = 272/327 (83.18%), Query Frame = 1
Query:   49 PVI*NMLIKYIKANCASNPQSN--SSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKK 1023
            PV+    ++  +   A+ P +N   SCE+GSTK++ALCG+GGI+SCGTTHT +VPLDLVKCR+QVD+AKYK +  GFKV++ EEG RGLAKGW PT +GYS QGL KFGLYE+FK  YA+++GEENAYL+RTSLYLAASASAEFFADI L P EAAKV+IQT+PGYA+  REA+PKM+ +EG+  FYKG++PLW RQIPYTMMKFACFERT+E LY+YVVPKPR  C+KGEQL+VTF+AGYIAGVFCA++SHPAD VVSKLNQ   A    VA++LG  GMW+G+ PRIIMIGTLTALQWFIYDG KVA+ +PRPPPP  P SL+ K
Sbjct:   28 PVVEPQPVEGRQIAAAATPVANQQDSCEFGSTKYFALCGIGGILSCGTTHTFVVPLDLVKCRLQVDQAKYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKIQTIPGYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGASAISVAKSLGFSGMWNGLTPRIIMIGTLTALQWFIYDGVKVALGIPRPPPPEMPASLKAK 354          
BLAST of slc25a-27 vs. Ensembl Fly
Match: Mpcp2 (gene:FBgn0026409 transcript:FBtr0075718)

HSP 1 Score: 442.58 bits (1137), Expect = 4.067e-155
Identity = 226/327 (69.11%), Postives = 272/327 (83.18%), Query Frame = 1
Query:   49 PVI*NMLIKYIKANCASNPQSN--SSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKK 1023
            PV+    ++  +   A+ P +N   SCE+GSTK++ALCG+GGI+SCGTTHT +VPLDLVKCR+QVD+AKYK +  GFKV++ EEG RGLAKGW PT +GYS QGL KFGLYE+FK  YA+++GEENAYL+RTSLYLAASASAEFFADI L P EAAKV+IQT+PGYA+  REA+PKM+ +EG+  FYKG++PLW RQIPYTMMKFACFERT+E LY+YVVPKPR  C+KGEQL+VTF+AGYIAGVFCA++SHPAD VVSKLNQ   A    VA++LG  GMW+G+ PRIIMIGTLTALQWFIYDG KVA+ +PRPPPP  P SL+ K
Sbjct:   28 PVVEPQPVEGRQIAAAATPVANQQDSCEFGSTKYFALCGIGGILSCGTTHTFVVPLDLVKCRLQVDQAKYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKIQTIPGYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGASAISVAKSLGFSGMWNGLTPRIIMIGTLTALQWFIYDGVKVALGIPRPPPPEMPASLKAK 354          
BLAST of slc25a-27 vs. Ensembl Zebrafish
Match: slc25a3b (solute carrier family 25 member 3b [Source:ZFIN;Acc:ZDB-GENE-040426-1916])

HSP 1 Score: 445.277 bits (1144), Expect = 5.104e-156
Identity = 230/311 (73.95%), Postives = 260/311 (83.60%), Query Frame = 1
Query:   94 ASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            A+   S  SC +GS K+YALCG GGI+SCG THTA+VPLDLVKCR+QVD AKYK IFTGF V+IKE+G+RGLAKGWAPTFIGYS+QGL KFG YEVFK  Y D+LGEENAY+WRTSLYLAASASAEFFADI L PMEA KVRIQT PGYA+TLRE  PKM  +EGL  FYKG++PLW RQIPYTMMKFACFERT+E LY+YVVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +  G+V + LG +G+W G+  RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   42 AAVADSGDSCAFGSGKYYALCGFGGILSCGITHTAVVPLDLVKCRLQVDPAKYKSIFTGFSVTIKEDGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKILYGDMLGEENAYMWRTSLYLAASASAEFFADIALAPMEACKVRIQTQPGYANTLRECAPKMYGEEGLWAFYKGVVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRNECSKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTAGQVLKRLGPMGVWKGLVARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 352          
BLAST of slc25a-27 vs. Ensembl Zebrafish
Match: slc25a3b (solute carrier family 25 member 3b [Source:ZFIN;Acc:ZDB-GENE-040426-1916])

HSP 1 Score: 444.506 bits (1142), Expect = 1.094e-155
Identity = 229/311 (73.63%), Postives = 260/311 (83.60%), Query Frame = 1
Query:   94 ASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            A+      SCE+GS K++ LCG GGI+SCGTTHTA+VPLDLVKCR+QVD AKYK IFTGF V+IKE+G+RGLAKGWAPTFIGYS+QGL KFG YEVFK  Y D+LGEENAY+WRTSLYLAASASAEFFADI L PMEA KVRIQT PGYA+TLRE  PKM  +EGL  FYKG++PLW RQIPYTMMKFACFERT+E LY+YVVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +  G+V + LG +G+W G+  RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   41 AAAVAEGDSCEFGSQKYFVLCGFGGILSCGTTHTAVVPLDLVKCRLQVDPAKYKSIFTGFSVTIKEDGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKILYGDMLGEENAYMWRTSLYLAASASAEFFADIALAPMEACKVRIQTQPGYANTLRECAPKMYGEEGLWAFYKGVVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRNECSKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTAGQVLKRLGPMGVWKGLVARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 351          
BLAST of slc25a-27 vs. Ensembl Zebrafish
Match: slc25a3a (solute carrier family 25 member 3a [Source:ZFIN;Acc:ZDB-GENE-040426-1673])

HSP 1 Score: 442.965 bits (1138), Expect = 8.765e-155
Identity = 225/315 (71.43%), Postives = 258/315 (81.90%), Query Frame = 1
Query:   82 KANCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            K   AS   +  SCEYGS K+YALCG GGI+SCG THTA+VPLDL+KCRIQVD  KYK IF GF V+++E+G RGL KGWAPTFIGYS+QGL KFG YE+FK  Y D+LGEENAYLWRTS+YLAASASAEFFADI L PMEA KVRIQT PGYA+TLRE  PKM ++EGL  FYKG+ PLW RQIPYTMMKFACFERT+E LY+YVVPKPR +CSK EQLVVTF AGYIAGVFCA++SHPAD+VVS LN+   +   EV + LG +G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL++K+
Sbjct:   53 KLAAASYDDAEVSCEYGSNKYYALCGFGGILSCGLTHTAVVPLDLIKCRIQVDPEKYKSIFNGFSVTLREDGFRGLGKGWAPTFIGYSMQGLCKFGFYEIFKALYNDMLGEENAYLWRTSVYLAASASAEFFADIALAPMEACKVRIQTQPGYANTLRECAPKMHAEEGLNAFYKGVYPLWLRQIPYTMMKFACFERTVETLYKYVVPKPRSECSKPEQLVVTFVAGYIAGVFCAVVSHPADSVVSVLNKEKGSSAVEVLKRLGPVGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPDMPESLKRKM 367          
BLAST of slc25a-27 vs. Ensembl Zebrafish
Match: slc25a3a (solute carrier family 25 member 3a [Source:ZFIN;Acc:ZDB-GENE-040426-1673])

HSP 1 Score: 441.425 bits (1134), Expect = 1.715e-154
Identity = 225/315 (71.43%), Postives = 258/315 (81.90%), Query Frame = 1
Query:   82 KANCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            K   AS   +  SCEYGS K+YALCG GGI+SCG THTA+VPLDL+KCRIQVD  KYK IF GF V+++E+G RGL KGWAPTFIGYS+QGL KFG YE+FK  Y D+LGEENAYLWRTS+YLAASASAEFFADI L PMEA KVRIQT PGYA+TLRE  PKM ++EGL  FYKG+ PLW RQIPYTMMKFACFERT+E LY+YVVPKPR +CSK EQLVVTF AGYIAGVFCA++SHPAD+VVS LN+   +   EV + LG +G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL++K+
Sbjct:   36 KLAAASYDDAEVSCEYGSNKYYALCGFGGILSCGLTHTAVVPLDLIKCRIQVDPEKYKSIFNGFSVTLREDGFRGLGKGWAPTFIGYSMQGLCKFGFYEIFKALYNDMLGEENAYLWRTSVYLAASASAEFFADIALAPMEACKVRIQTQPGYANTLRECAPKMHAEEGLNAFYKGVYPLWLRQIPYTMMKFACFERTVETLYKYVVPKPRSECSKPEQLVVTFVAGYIAGVFCAVVSHPADSVVSVLNKEKGSSAVEVLKRLGPVGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPDMPESLKRKM 350          
BLAST of slc25a-27 vs. Ensembl Zebrafish
Match: slc25a3b (solute carrier family 25 member 3b [Source:ZFIN;Acc:ZDB-GENE-040426-1916])

HSP 1 Score: 375.555 bits (963), Expect = 9.478e-130
Identity = 186/238 (78.15%), Postives = 206/238 (86.55%), Query Frame = 1
Query:   94 ASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPAD 807
            A+   S  SC +GS K+YALCG GGI+SCG THTA+VPLDLVKCR+QVD AKYK IFTGF V+IKE+G+RGLAKGWAPTFIGYS+QGL KFG YEVFK  Y D+LGEENAY+WRTSLYLAASASAEFFADI L PMEA KVRIQT PGYA+TLRE  PKM  +EGL  FYKG++PLW RQIPYTMMKFACFERT+E LY+YVVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD
Sbjct:   42 AAVADSGDSCAFGSGKYYALCGFGGILSCGITHTAVVPLDLVKCRLQVDPAKYKSIFTGFSVTIKEDGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKILYGDMLGEENAYMWRTSLYLAASASAEFFADIALAPMEACKVRIQTQPGYANTLRECAPKMYGEEGLWAFYKGVVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRNECSKAEQLVVTFVAGYIAGVFCAIVSHPAD 279          
BLAST of slc25a-27 vs. Ensembl Xenopus
Match: klhl14 (kelch like family member 14 [Source:Xenbase;Acc:XB-GENE-951654])

HSP 1 Score: 442.965 bits (1138), Expect = 1.747e-154
Identity = 229/311 (73.63%), Postives = 261/311 (83.92%), Query Frame = 1
Query:   94 ASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            A+  +   SC YGS KF+ALCG GGIISCGTTHTA+VPLDLVKCRIQVD  KYK IF GF +++KE+G+RGLAKGWAPTFIGYS+QGL KFG YEVFK  YA++LGEEN+Y+WRTSLYLAASASAEFFADI L PMEAAKVRIQT PGYA+TLR+A PKM ++EG+  FYKG+ PLW RQIPYTMMKFACFERT+EALY+YVVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +   EV + LG  G+W G+  RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   67 AAVQEEEYSCAYGSGKFFALCGFGGIISCGTTHTAVVPLDLVKCRIQVDPQKYKSIFNGFSITLKEDGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKILYANMLGEENSYMWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRQAAPKMYAEEGIWAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKYVVPKPRSECSKSEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTALEVLKRLGPKGVWKGLTARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 377          
BLAST of slc25a-27 vs. Ensembl Xenopus
Match: klhl14 (kelch like family member 14 [Source:Xenbase;Acc:XB-GENE-951654])

HSP 1 Score: 435.647 bits (1119), Expect = 5.443e-152
Identity = 225/303 (74.26%), Postives = 256/303 (84.49%), Query Frame = 1
Query:  118 SCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            SCEYGS  FYA CG GGI+SCG THTA+VPLDLVKCR+QVD  KYK IF GF +++KE+G+RGLAKGWAPTFIGYS+QGL KFG YEVFK  YA++LGEEN+Y+WRTSLYLAASASAEFFADI L PMEAAKVRIQT PGYA+TLR+A PKM ++EG+  FYKG+ PLW RQIPYTMMKFACFERT+EALY+YVVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +   EV + LG  G+W G+  RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   54 SCEYGSGTFYAYCGFGGILSCGLTHTAVVPLDLVKCRLQVDPQKYKSIFNGFSITLKEDGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKILYANMLGEENSYMWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRQAAPKMYAEEGIWAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKYVVPKPRSECSKSEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTALEVLKRLGPKGVWKGLTARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 356          
BLAST of slc25a-27 vs. Ensembl Xenopus
Match: klhl14 (kelch like family member 14 [Source:Xenbase;Acc:XB-GENE-951654])

HSP 1 Score: 433.335 bits (1113), Expect = 4.380e-151
Identity = 224/303 (73.93%), Postives = 255/303 (84.16%), Query Frame = 1
Query:  118 SCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            SC YGS  FYA CG GGI+SCG THTA+VPLDLVKCR+QVD  KYK IF GF +++KE+G+RGLAKGWAPTFIGYS+QGL KFG YEVFK  YA++LGEEN+Y+WRTSLYLAASASAEFFADI L PMEAAKVRIQT PGYA+TLR+A PKM ++EG+  FYKG+ PLW RQIPYTMMKFACFERT+EALY+YVVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +   EV + LG  G+W G+  RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   54 SCAYGSGTFYAYCGFGGILSCGLTHTAVVPLDLVKCRLQVDPQKYKSIFNGFSITLKEDGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKILYANMLGEENSYMWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRQAAPKMYAEEGIWAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKYVVPKPRSECSKSEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTALEVLKRLGPKGVWKGLTARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 356          
BLAST of slc25a-27 vs. Ensembl Xenopus
Match: slc25a24 (solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 24 [Source:NCBI gene;Acc:496457])

HSP 1 Score: 76.6406 bits (187), Expect = 1.291e-14
Identity = 74/287 (25.78%), Postives = 123/287 (42.86%), Query Frame = 1
Query:  160 LGGIISCGTTHTAIVPLDLVKCRIQVDKAK-YKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQT-MPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEA--LYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQN------PNAKLGEVARNL----GLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNV 978
            L G ++   + T   PLD +K  +QV  +K    I TG K  +KE GIR L +G     I  + +   KF  YE +K     L   E+  L     ++A S +    A   + PME  K R+     G  S + +   K+M +EG+  FYKG IP     IPY  +  A +E TL+   L  Y         S    ++V    G  +     + S+P   + +++         P   +G + R +    G  G++ GI P  + +    ++ + +Y+  K+ + +
Sbjct:  159 LAGGMAGAVSRTGTAPLDRLKVMMQVHGSKGNANIITGLKQMVKEGGIRSLWRGNGVNVIKIAPETAMKFWAYEQYKK----LFTSESGKLGTAERFIAGSLAGAT-AQTSIYPMEVLKTRLAVGKTGQYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIPYAGIDLAIYE-TLKTFWLQNYATD------SANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQAQASIEGAPQLNMGGLFRKIVAKEGFFGLYRGIAPNFLKVLPAVSISYVVYEKMKIKLGI 433          
BLAST of slc25a-27 vs. Ensembl Xenopus
Match: ENSXETT00000035457.1 (mitochondrial ornithine transporter 1-like [Source:NCBI gene;Acc:100495907])

HSP 1 Score: 75.485 bits (184), Expect = 1.396e-14
Identity = 65/275 (23.64%), Postives = 114/275 (41.45%), Query Frame = 1
Query:  205 PLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQT-----MPGYASTLREALP-----KMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSK---LNQNPNAK-----LGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMN 975
            P D  K ++Q     Y+G       +   EG+RGL  G  P  +  + +    F  Y   ++  +  LG ++           A + A  F+ + LCP E  K RIQT     + G      ++ P      ++S EG+ G ++G+   W R+IP     F  +E +++ L Q    +   +   G  +V        A  + A+  +P D+V S+   L   P++K     L  + R  G L ++SG+ P ++      A  +  Y+  K  + 
Sbjct:   34 PFDTAKVKMQTFPTMYRGFVDCAVRTYHAEGLRGLYHGTTPALVANAAENAVLFACYGFCQNLVSRCLGLQDPSQLSDWHKATAGSLASVFSSLALCPTELVKCRIQTQHEMRLSGNKDIPHKSTPWSVVRAILSSEGIPGLFRGLSSTWLREIPGYFFFFGGYELSIDILSQ----RESSKDPPGALVVTVSGGVGGACFWLAV--YPVDSVKSRVQVLTLTPHSKGFIISLLHILRTEGFLPLYSGLMPTVVRAFPSNAALFLAYEMTKRTLT 302          
BLAST of slc25a-27 vs. Ensembl Mouse
Match: Slc25a3 (solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 3 [Source:MGI Symbol;Acc:MGI:1353498])

HSP 1 Score: 466.463 bits (1199), Expect = 3.206e-164
Identity = 226/311 (72.67%), Postives = 262/311 (84.24%), Query Frame = 1
Query:   94 ASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            A+  +   SCEYGS +F+ LCGLGGIISCGTTHTA+VPLDL+KCR+QVD  KYKGIF GF +++KE+G+RGLAKGWAPT IGYS+QGL KFG YEVFK  Y+++LGEEN YLWRTSLYLA+SASAEFFADI L PMEAAKVRIQT PGYA+TLREA+PKM  +EGL  FYKG+ PLW RQIPYTMMKFACFERT+EALY++VVPKPR +C+K EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +   +V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   44 AAAVEEQYSCEYGSGRFFLLCGLGGIISCGTTHTALVPLDLIKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLASSASAEFFADIALAPMEAAKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTASQVLQRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 354          
BLAST of slc25a-27 vs. Ensembl Mouse
Match: Slc25a3 (solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 3 [Source:MGI Symbol;Acc:MGI:1353498])

HSP 1 Score: 462.996 bits (1190), Expect = 6.386e-163
Identity = 223/303 (73.60%), Postives = 258/303 (85.15%), Query Frame = 1
Query:  118 SCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            SCE+GS K+YALCG GG++SCG THTA+VPLDLVKCR+QVD  KYKGIF GF +++KE+G+RGLAKGWAPT IGYS+QGL KFG YEVFK  Y+++LGEEN YLWRTSLYLA+SASAEFFADI L PMEAAKVRIQT PGYA+TLREA+PKM  +EGL  FYKG+ PLW RQIPYTMMKFACFERT+EALY++VVPKPR +C+K EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +   +V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   51 SCEFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLASSASAEFFADIALAPMEAAKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTASQVLQRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 353          
BLAST of slc25a-27 vs. Ensembl Mouse
Match: Slc25a3 (solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 3 [Source:MGI Symbol;Acc:MGI:1353498])

HSP 1 Score: 462.996 bits (1190), Expect = 6.386e-163
Identity = 223/303 (73.60%), Postives = 258/303 (85.15%), Query Frame = 1
Query:  118 SCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            SCE+GS K+YALCG GG++SCG THTA+VPLDLVKCR+QVD  KYKGIF GF +++KE+G+RGLAKGWAPT IGYS+QGL KFG YEVFK  Y+++LGEEN YLWRTSLYLA+SASAEFFADI L PMEAAKVRIQT PGYA+TLREA+PKM  +EGL  FYKG+ PLW RQIPYTMMKFACFERT+EALY++VVPKPR +C+K EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +   +V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   51 SCEFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLASSASAEFFADIALAPMEAAKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTASQVLQRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 353          
BLAST of slc25a-27 vs. Ensembl Mouse
Match: Slc25a19 (solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [Source:MGI Symbol;Acc:MGI:1914533])

HSP 1 Score: 89.7373 bits (221), Expect = 1.741e-19
Identity = 84/327 (25.69%), Postives = 137/327 (41.90%), Query Frame = 1
Query:   88 NCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVD---------KAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFF--------ADILLCPMEAAKVRI--QTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLN----QNPNAKLGEVARNLGLL-------------GMWSGIFPRIIMIGTLTALQWFIYDGF 960
            +  ++ +SNS  E           + G +S   T   I PLD++K R Q+           AKY GIF   K  ++EEG R   KG  P  I     G  +F  +E           E    L++ +LY     SA F         A + + P++  + R+  Q  P   + LREA+  M   EG   FYKG+ P      PY  ++F+C+ R+L+  Y +++P   +Q    + L+    +G I+  F    ++P D +  +L     ++  +  G+V    GLL             G + G+ P ++     T   +F Y+ F
Sbjct:    5 DAKADVRSNSKLE---------VAVAGSVSGFVTRALISPLDVIKIRFQLQIERLCPSDPNAKYHGIFQAAKQILQEEGPRAFWKGHVPAQILSIGYGAVQFLAFE-----------ELTELLYQANLYQTHQFSAHFVCGGLSAGTATLTVHPVDVLRTRLAAQGEPKIYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIFPYAGLQFSCY-RSLKRAYDWLIPPDGKQTGNLKNLLCGCGSGVISKTF----TYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFMFFWYELF 306          
BLAST of slc25a-27 vs. Ensembl Mouse
Match: Slc25a19 (solute carrier family 25 (mitochondrial thiamine pyrophosphate carrier), member 19 [Source:MGI Symbol;Acc:MGI:1914533])

HSP 1 Score: 89.7373 bits (221), Expect = 1.741e-19
Identity = 84/327 (25.69%), Postives = 137/327 (41.90%), Query Frame = 1
Query:   88 NCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVD---------KAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFF--------ADILLCPMEAAKVRI--QTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLN----QNPNAKLGEVARNLGLL-------------GMWSGIFPRIIMIGTLTALQWFIYDGF 960
            +  ++ +SNS  E           + G +S   T   I PLD++K R Q+           AKY GIF   K  ++EEG R   KG  P  I     G  +F  +E           E    L++ +LY     SA F         A + + P++  + R+  Q  P   + LREA+  M   EG   FYKG+ P      PY  ++F+C+ R+L+  Y +++P   +Q    + L+    +G I+  F    ++P D +  +L     ++  +  G+V    GLL             G + G+ P ++     T   +F Y+ F
Sbjct:    5 DAKADVRSNSKLE---------VAVAGSVSGFVTRALISPLDVIKIRFQLQIERLCPSDPNAKYHGIFQAAKQILQEEGPRAFWKGHVPAQILSIGYGAVQFLAFE-----------ELTELLYQANLYQTHQFSAHFVCGGLSAGTATLTVHPVDVLRTRLAAQGEPKIYNNLREAIRTMYKTEGPFVFYKGLTPTVIAIFPYAGLQFSCY-RSLKRAYDWLIPPDGKQTGNLKNLLCGCGSGVISKTF----TYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKGLSPSLMKAALSTGFMFFWYELF 306          
BLAST of slc25a-27 vs. UniProt/SwissProt
Match: sp|Q8VEM8|MPCP_MOUSE (Phosphate carrier protein, mitochondrial OS=Mus musculus OX=10090 GN=Slc25a3 PE=1 SV=1)

HSP 1 Score: 462.996 bits (1190), Expect = 4.467e-162
Identity = 223/303 (73.60%), Postives = 258/303 (85.15%), Query Frame = 1
Query:  118 SCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            SCE+GS K+YALCG GG++SCG THTA+VPLDLVKCR+QVD  KYKGIF GF +++KE+G+RGLAKGWAPT IGYS+QGL KFG YEVFK  Y+++LGEEN YLWRTSLYLA+SASAEFFADI L PMEAAKVRIQT PGYA+TLREA+PKM  +EGL  FYKG+ PLW RQIPYTMMKFACFERT+EALY++VVPKPR +C+K EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +   +V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   51 SCEFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLASSASAEFFADIALAPMEAAKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTASQVLQRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 353          
BLAST of slc25a-27 vs. UniProt/SwissProt
Match: sp|P12234|MPCP_BOVIN (Phosphate carrier protein, mitochondrial OS=Bos taurus OX=9913 GN=SLC25A3 PE=1 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 3.504e-155
Identity = 231/311 (74.28%), Postives = 261/311 (83.92%), Query Frame = 1
Query:   94 ASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            A+  +   SC+YGS +F+ LCGLGGIISCGTTHTA+VPLDLVKCR+QVD  KYK IF GF V++KE+G RGLAKGWAPTFIGYSLQGL KFG YEVFK  Y+++LGEENAYLWRTSLYLAASASAEFFADI L PMEAAKVRIQT PGYA+TLR+A PKM  +EGL  FYKG+ PLW RQIPYTMMKFACFERT+EALY++VVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +   EV + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   48 AAAVEEQYSCDYGSGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKSIFNGFSVTLKEDGFRGLAKGWAPTFIGYSLQGLCKFGFYEVFKVLYSNMLGEENAYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASEVLKRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 358          
BLAST of slc25a-27 vs. UniProt/SwissProt
Match: sp|P16036|MPCP_RAT (Phosphate carrier protein, mitochondrial OS=Rattus norvegicus OX=10116 GN=Slc25a3 PE=1 SV=1)

HSP 1 Score: 441.425 bits (1134), Expect = 1.176e-153
Identity = 223/303 (73.60%), Postives = 258/303 (85.15%), Query Frame = 1
Query:  118 SCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            SCE+GS K+YALCG GG++SCG THTA+VPLDLVKCR+QVD  KYKGIF GF +++KE+G+RGLAKGWAPT IGYS+QGL KFG YEVFK  Y+++LGEEN YLWRTSLYLAASASAEFFADI L PMEAAKVRIQT PGYA+TLREA+PKM  +EGL  FYKG+ P+W RQIPYTMMKFACFERT+EALY++VVPKPR +C+K EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +   +V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   50 SCEFGSMKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFKALYSNILGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLREAVPKMYKEEGLNAFYKGVAPVWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTASQVLQRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 352          
BLAST of slc25a-27 vs. UniProt/SwissProt
Match: sp|Q00325|MPCP_HUMAN (Phosphate carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=SLC25A3 PE=1 SV=2)

HSP 1 Score: 441.425 bits (1134), Expect = 1.602e-153
Identity = 228/311 (73.31%), Postives = 261/311 (83.92%), Query Frame = 1
Query:   94 ASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            A+  +   SC+YGS +F+ LCGLGGIISCGTTHTA+VPLDLVKCR+QVD  KYKGIF GF V++KE+G+RGLAKGWAPTF+GYS+QGL KFG YEVFK  Y+++LGEEN YLWRTSLYLAASASAEFFADI L PMEAAKVRIQT PGYA+TLR+A PKM  +EGL  FYKG+ PLW RQIPYTMMKFACFERT+EALY++VVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +    V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   48 AAAVEEQYSCDYGSGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 358          
BLAST of slc25a-27 vs. UniProt/SwissProt
Match: sp|Q5R7W2|MPCP_PONAB (Phosphate carrier protein, mitochondrial OS=Pongo abelii OX=9601 GN=SLC25A3 PE=2 SV=1)

HSP 1 Score: 440.654 bits (1132), Expect = 3.432e-153
Identity = 227/313 (72.52%), Postives = 260/313 (83.07%), Query Frame = 1
Query:   88 NCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            N A+      SCE+GS K+YALCG GG++SCG THTA+VPLDLVKCR+QVD  KYKGIF GF V++KE+G+RGLAKGWAPTF+GYS+QGL KFG YEVFK  Y+++LGEEN YLWRTSLYLAASASAEFFADI L PMEAAKVRIQT PGYA+TLR+A PKM  +EGL  FYKG+ PLW RQIPYTMMKFACFERT+EALY++VVPKPR +CSK EQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +    V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   45 NLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 357          
BLAST of slc25a-27 vs. TrEMBL
Match: A0A0H3YF60 (Slc25a-27 OS=Schmidtea mediterranea OX=79327 GN=slc25a-27 PE=2 SV=1)

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 324/324 (100.00%), Postives = 324/324 (100.00%), Query Frame = 1
Query:   64 MLIKYIKANCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKLAGK 1035
            MLIKYIKANCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVPRPPPPAAPESLRKKLAGK
Sbjct:    1 MLIKYIKANCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVPRPPPPAAPESLRKKLAGK 324          
BLAST of slc25a-27 vs. TrEMBL
Match: A0A183TKT4 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS17082 PE=3 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 2.073e-180
Identity = 246/306 (80.39%), Postives = 279/306 (91.18%), Query Frame = 1
Query:  109 SNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            S+ SCEY + KFYALCGLGG+ISCGTTHTAIVPLDLVKCRIQVDK+KY  I  GF+VS++E G R LA+GWAPTF GYS+QGLGKFG YE+FKH Y+ +L EENAYLWRTS+YLAASASAEF ADI+LCPMEAAKVRIQTMPG+A+TLREA+PKM++ EG+GGFYKGI+PLW RQIPYTMMKFACFERT+EALY+YVVPKPR QCSKGEQLVVTF+AGYIAGVFCAI+SHP DT+VSKLN++PNA+L EVA+NLGLLGMWSG+ PRIIMIGTLTALQWFIYDGFKV M +PRPPPP  PESL+ KL
Sbjct:    8 SDYSCEYATPKFYALCGLGGVISCGTTHTAIVPLDLVKCRIQVDKSKYANIRQGFRVSVQEGGFRSLARGWAPTFFGYSMQGLGKFGFYELFKHTYSGMLSEENAYLWRTSVYLAASASAEFLADIMLCPMEAAKVRIQTMPGFATTLREAMPKMIAAEGMGGFYKGIVPLWCRQIPYTMMKFACFERTVEALYKYVVPKPRSQCSKGEQLVVTFTAGYIAGVFCAIVSHPPDTIVSKLNKDPNARLMEVAKNLGLLGMWSGLLPRIIMIGTLTALQWFIYDGFKVVMRLPRPPPPTMPESLKSKL 313          
BLAST of slc25a-27 vs. TrEMBL
Match: A0A0X3NIQ0 (Phosphate carrier protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=MPCP PE=3 SV=1)

HSP 1 Score: 514.227 bits (1323), Expect = 4.477e-180
Identity = 246/306 (80.39%), Postives = 279/306 (91.18%), Query Frame = 1
Query:  109 SNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            S+ SCEY + KFYALCGLGG+ISCGTTHTAIVPLDLVKCRIQVDK+KY  I  GF+VS++E G R LA+GWAPTF GYS+QGLGKFG YE+FKH Y+ +L EENAYLWRTS+YLAASASAEF ADI+LCPMEAAKVRIQTMPG+A+TLREA+PKM++ EG+GGFYKGI+PLW RQIPYTMMKFACFERT+EALY+YVVPKPR QCSKGEQLVVTF+AGYIAGVFCAI+SHP DT+VSKLN++PNA+L EVA+NLGLLGMWSG+ PRIIMIGTLTALQWFIYDGFKV M +PRPPPP  PESL+ KL
Sbjct:   31 SDYSCEYATPKFYALCGLGGVISCGTTHTAIVPLDLVKCRIQVDKSKYANIRQGFRVSVQEGGFRSLARGWAPTFFGYSMQGLGKFGFYELFKHTYSGMLSEENAYLWRTSVYLAASASAEFLADIMLCPMEAAKVRIQTMPGFATTLREAMPKMIAAEGMGGFYKGIVPLWCRQIPYTMMKFACFERTVEALYKYVVPKPRSQCSKGEQLVVTFTAGYIAGVFCAIVSHPPDTIVSKLNKDPNARLMEVAKNLGLLGMWSGLLPRIIMIGTLTALQWFIYDGFKVVMRLPRPPPPTMPESLKSKL 336          
BLAST of slc25a-27 vs. TrEMBL
Match: A0A3P7LCD2 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS6891 PE=3 SV=1)

HSP 1 Score: 508.449 bits (1308), Expect = 3.327e-178
Identity = 236/290 (81.38%), Postives = 265/290 (91.38%), Query Frame = 1
Query:   97 SNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKV 966
            S   S  SCEY + KFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKY  I  GF+V+++E G+R LA+GWAPTF GYS+QGLGKFG YEVFKH Y+ +L EENAYLWRTS+YLAASASAEF ADI+LCPMEAAKVRIQTMPG+A+TLREA+PKM++ EG+GGFYKGI+PLW RQIPYTMMKFACFERT+EALY+YVVPKPR QCSK EQLVVTF+AGYIAGVFCAI+SHP DT+VSKLN++PNA+L EVA+NLGLLGMWSG+FPRIIMIGTLTALQWFIYDGFKV
Sbjct:    4 SAAASEYSCEYATPKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYGNIRQGFRVTLQEGGVRSLARGWAPTFFGYSMQGLGKFGFYEVFKHTYSGMLSEENAYLWRTSVYLAASASAEFLADIMLCPMEAAKVRIQTMPGFANTLREAMPKMIAAEGMGGFYKGIVPLWCRQIPYTMMKFACFERTVEALYKYVVPKPRAQCSKPEQLVVTFTAGYIAGVFCAIVSHPPDTIVSKLNKDPNARLMEVAKNLGLLGMWSGLFPRIIMIGTLTALQWFIYDGFKV 293          
BLAST of slc25a-27 vs. TrEMBL
Match: C1L8V6 (Phosphate carrier protein, mitochondrial OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 494.197 bits (1271), Expect = 1.175e-172
Identity = 247/309 (79.94%), Postives = 281/309 (90.94%), Query Frame = 1
Query:  109 SNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKLAGK 1035
            + SSCEYG+ K+YALCGLGG++SCG THT +VPLDLVKCR+QVD+AKYK I TGFK+++ EEGIRGL KGWAPTF GYSLQGLGKFG YEVFKH Y  LL EENAYLWRTS+YLAASASAEFFADI+LCPMEA KVRIQTMPG+A+TLRE +PKM   EGL GFYKG+ PLWGRQIPYTMMKFACFERT+EALY++VVPKPREQCSKGEQLVVTF+AGYIAGVFCAI+SHP DT+VSKLN++PNA+L EVA+NLGL+GMWSG+ PRIIMIGTLTALQWFIYDGFKVAM +PRPPPP+ PESL++KL  +
Sbjct:    3 TKSSCEYGTPKYYALCGLGGVLSCGLTHTGVVPLDLVKCRLQVDRAKYKNITTGFKITVSEEGIRGLGKGWAPTFFGYSLQGLGKFGFYEVFKHIYNGLLSEENAYLWRTSVYLAASASAEFFADIMLCPMEAVKVRIQTMPGWANTLREGVPKMYKNEGLVGFYKGLPPLWGRQIPYTMMKFACFERTVEALYKHVVPKPREQCSKGEQLVVTFAAGYIAGVFCAIVSHPPDTIVSKLNKDPNARLVEVAKNLGLMGMWSGLGPRIIMIGTLTALQWFIYDGFKVAMQLPRPPPPSMPESLKQKLENQ 311          
BLAST of slc25a-27 vs. Ensembl Cavefish
Match: slc25a3b (solute carrier family 25 member 3 [Source:NCBI gene;Acc:103026707])

HSP 1 Score: 446.817 bits (1148), Expect = 1.017e-156
Identity = 228/311 (73.31%), Postives = 261/311 (83.92%), Query Frame = 1
Query:   94 ASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            AS   +  SCE+GS K+YALCG GGI+SCG THTA+VPLDLVKCR+QVD AKYK IFTGF V+IKE+G+RGLAKGWAPTFIGYS+QGL KFG YEVFK  Y+D+LGEEN Y+WRTSLYLAASASAEFFADI L PMEA KVRIQT PGYA+TLRE  PKM ++EGL  FYKG++PLW RQIPYTMMKFACFERT+E LY+YVVPKPR +CSK EQL+VTF AGYIAGVFCAI+SHPAD+VVS LN+   +   +V + LG +G+W G+  RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   44 ASTADTGDSCEFGSMKYYALCGFGGILSCGITHTAVVPLDLVKCRLQVDPAKYKSIFTGFSVTIKEDGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKILYSDMLGEENTYMWRTSLYLAASASAEFFADIALAPMEACKVRIQTQPGYANTLRECAPKMYAEEGLWAFYKGVVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRSECSKPEQLLVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTAAQVLKRLGPMGVWKGLVARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 354          
BLAST of slc25a-27 vs. Ensembl Cavefish
Match: slc25a3b (solute carrier family 25 member 3 [Source:NCBI gene;Acc:103026707])

HSP 1 Score: 443.351 bits (1139), Expect = 2.544e-155
Identity = 226/311 (72.67%), Postives = 261/311 (83.92%), Query Frame = 1
Query:   94 ASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            A++     SCE+GS K++ LCG GGI+SCGTTHTA+VPLDLVKCR+QVD AKYK IFTGF V+IKE+G+RGLAKGWAPTFIGYS+QGL KFG YEVFK  Y+D+LGEEN Y+WRTSLYLAASASAEFFADI L PMEA KVRIQT PGYA+TLRE  PKM ++EGL  FYKG++PLW RQIPYTMMKFACFERT+E LY+YVVPKPR +CSK EQL+VTF AGYIAGVFCAI+SHPAD+VVS LN+   +   +V + LG +G+W G+  RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   43 AASTAEGDSCEFGSQKYFILCGFGGILSCGTTHTAVVPLDLVKCRLQVDPAKYKSIFTGFSVTIKEDGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKILYSDMLGEENTYMWRTSLYLAASASAEFFADIALAPMEACKVRIQTQPGYANTLRECAPKMYAEEGLWAFYKGVVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRSECSKPEQLLVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTAAQVLKRLGPMGVWKGLVARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 353          
BLAST of slc25a-27 vs. Ensembl Cavefish
Match: slc25a3a (phosphate carrier protein, mitochondrial-like [Source:NCBI gene;Acc:103039923])

HSP 1 Score: 437.958 bits (1125), Expect = 5.104e-153
Identity = 224/310 (72.26%), Postives = 257/310 (82.90%), Query Frame = 1
Query:  100 NPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKLA 1029
            N  ++ SCEYGS K+YALCG GGI+SCG THTA+VPLDLVKCRIQVD  KYK IF GF V+++E+G RGL +GWAPTFIGYS+QGL KFG YE+FK  Y D+LGEENAYLWRTS+YLAASASAEFFADI L PMEA KVRIQT PGYASTLRE  PKM ++EG+  FYKG+ PLW RQIPYTMMKFACFERT+E LY+YVVPKPR +C+K EQLVVTF AGYIAGVFCA++SHPAD+VVS LN+   +   +V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKLA
Sbjct:   51 NDDTSVSCEYGSNKYYALCGFGGILSCGLTHTAVVPLDLVKCRIQVDPDKYKSIFNGFSVTLREDGFRGLGRGWAPTFIGYSMQGLCKFGFYELFKALYNDMLGEENAYLWRTSVYLAASASAEFFADIALAPMEACKVRIQTQPGYASTLRECAPKMHAEEGVWAFYKGVYPLWLRQIPYTMMKFACFERTVETLYKYVVPKPRSECTKPEQLVVTFVAGYIAGVFCAVVSHPADSVVSVLNKEKGSSAAQVLKRLGPKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLA 360          
BLAST of slc25a-27 vs. Ensembl Cavefish
Match: slc25a3a (phosphate carrier protein, mitochondrial-like [Source:NCBI gene;Acc:103039923])

HSP 1 Score: 437.958 bits (1125), Expect = 5.104e-153
Identity = 224/310 (72.26%), Postives = 257/310 (82.90%), Query Frame = 1
Query:  100 NPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKLA 1029
            N  ++ SCEYGS K+YALCG GGI+SCG THTA+VPLDLVKCRIQVD  KYK IF GF V+++E+G RGL +GWAPTFIGYS+QGL KFG YE+FK  Y D+LGEENAYLWRTS+YLAASASAEFFADI L PMEA KVRIQT PGYASTLRE  PKM ++EG+  FYKG+ PLW RQIPYTMMKFACFERT+E LY+YVVPKPR +C+K EQLVVTF AGYIAGVFCA++SHPAD+VVS LN+   +   +V + LG  G+W G+F RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKLA
Sbjct:   51 NDDTSVSCEYGSNKYYALCGFGGILSCGLTHTAVVPLDLVKCRIQVDPDKYKSIFNGFSVTLREDGFRGLGRGWAPTFIGYSMQGLCKFGFYELFKALYNDMLGEENAYLWRTSVYLAASASAEFFADIALAPMEACKVRIQTQPGYASTLRECAPKMHAEEGVWAFYKGVYPLWLRQIPYTMMKFACFERTVETLYKYVVPKPRSECTKPEQLVVTFVAGYIAGVFCAVVSHPADSVVSVLNKEKGSSAAQVLKRLGPKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLA 360          
BLAST of slc25a-27 vs. Ensembl Cavefish
Match: slc25a38a (solute carrier family 25 member 38-A-like [Source:NCBI gene;Acc:103029710])

HSP 1 Score: 75.485 bits (184), Expect = 6.501e-15
Identity = 62/267 (23.22%), Postives = 117/267 (43.82%), Query Frame = 1
Query:  205 PLDLVKCRIQVDKAKYK------GIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKF--GLYEVFKHYYADLLGEENAYLWRTSLYLAA---SASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPN------AKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYD 954
            PLDLVK R+Q  +   +      G+ T     +K E + GL KG +P+F+   + G+G +    + + +H+++D          R+   + A    A +   A + + P+   K R ++      ++ EAL  +   EG  G + G+     R  P++ +    + +    L       P E    G   +  FS G ++GV  ++++ PAD V +++  NP+        +  +    G +G + G  PR +    + A+ W IY+
Sbjct:   29 PLDLVKTRLQTLQNSVQPGSGRVGMVTVILSVVKTEKLLGLWKGVSPSFV-RCIPGVGIYFSTYFSLKQHFFSD----------RSPAPVEAVLLGAGSRSVAGVCMLPVTVIKTRFESGRYNYGSVMEALRSVCRTEGARGLFSGLTATLLRDAPFSGIYVMFYSQAKSTL-------PNEISQSGYAPLANFSCGVVSGVLASLVTQPADVVKTQVQVNPHLFRRTWDAVHYIYMEHGAVGFFRGAVPRSLRRTMMAAMAWTIYE 277          
BLAST of slc25a-27 vs. Ensembl Sea Lamprey
Match: slc25a38b (solute carrier family 25 member 38b [Source:NCBI gene;Acc:571961])

HSP 1 Score: 79.337 bits (194), Expect = 6.537e-17
Identity = 72/299 (24.08%), Postives = 129/299 (43.14%), Query Frame = 1
Query:  130 GSTKFYALCG-LGGIISCGTTHTAIVPLDLVKCRIQVDKA---------KYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPN--AKLGE----VARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNV 978
            GS     LCG L G  SC T    + PLDLVK R+Q+ +A         +   + T     ++ E +RGL KG  P+ +    + +   G+Y    H   +    + A     SL L  SA     + + + P+   K R ++      ++  AL  +   EG+   + G+     R  P++ +    + +    L   V         +  Q    F+ G +AGV  ++++ PADT+ + +   P+  +  G+    + R+ GL G++ G  PR +    +TA+ W +Y+   V + +
Sbjct:    3 GSALRALLCGALSG--SCSTL--LLQPLDLVKTRVQLLRAAGTPRSPRVRMVSVLTHV---VRTESVRGLWKGLGPSLV----RCVPGVGIYFCTLHSLRESFFRDRAPSALDSLLLGLSART--ISAVCMLPVTVVKTRYESGRFKYRSVLGALSSIRKTEGIRALFSGLTATLARDAPFSGIYVMIYTQAKHMLLHGV--------EREGQAPTRFACGVLAGVVASLVTQPADTIKTYMQMEPHRFSHTGQTFVAICRSQGLTGLFHGAVPRCLRRTLVTAMAWTVYERMMVGLGL 280          
BLAST of slc25a-27 vs. Ensembl Sea Lamprey
Match: slc25a23a (solute carrier family 25 member 23a [Source:ZFIN;Acc:ZDB-GENE-121214-154])

HSP 1 Score: 77.7962 bits (190), Expect = 7.672e-16
Identity = 72/286 (25.17%), Postives = 126/286 (44.06%), Query Frame = 1
Query:  160 LGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGI--FTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQ-TMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLG----------EVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNV 978
            + G  +   + T   PLD +K  +QV  +K   I   TGFK  IKE GI  L +G     I  + +   KF  YE  K +    +G  N  L     ++A S +    A  ++ PME  K R+     G  S + +   K+  KEG+  FYKG +P     IPY  +  A +E TL+    ++    ++    G  ++V  + G ++     + S+P   + +++    + + G           + +N G LG++ GI P  + +    ++ + +Y+  K  + V
Sbjct:  215 MAGGAAGAVSRTGTAPLDRMKVFMQVHGSKSNNISILTGFKQMIKEGGIASLWRGNGVNVIKIAPETAIKFMAYEQIKKF----IGSNNVSLGIHERFMAGSLAGA-TAQTIIYPMEVMKTRLTLRKTGQYSGMMDCAKKIFMKEGVIAFYKGYVPNIIGIIPYAGIDLAIYE-TLKN--TWLTKYAKDTADPG--ILVLLACGTVSSSCGQVASYPLALIRTRMQAQASMEGGPQLSMVGLFRNIVKNDGPLGLYRGIAPNFMKVIPAVSISYVVYENLKRVLGV 490          
BLAST of slc25a-27 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008980.1 (pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 gene:ENSPMAG00000008118.1 transcript:ENSPMAT00000008980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.645e-11
Identity = 57/226 (25.22%), Postives = 97/226 (42.92%), Query Frame = 1
Query:  193 TAIVPLDLVKCRIQVDKAK--------YKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYAD------LLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLN 828
            TA+ P+DLVK R+Q  ++         YK  F  FK  ++ EG+ GL +G  P  +G + +   K  + ++ +  +        L+GE           + A   A     I   P+E  K+R+Q      +  R +   ++   G  G YKG    + R IP++ + F  +  T  +          E+   G   ++T  AG IAG+  A +  PAD + ++L 
Sbjct:    5 TAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVVRYEGVFGLYRGLIPQLLGVAPEKAIKLTMNDLIRDKFTKRDKSIPLIGE-----------IIAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGFLGLYKGAKACFLRDIPFSAIYFPVYAHTKSSFAD-------EKGHVGPLHLLT--AGAIAGMPAASLVTPADVIKTRLQ 210          
BLAST of slc25a-27 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004577.1 (pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gene:ENSPMAG00000004140.1 transcript:ENSPMAT00000004577.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 2.391e-11
Identity = 68/279 (24.37%), Postives = 118/279 (42.29%), Query Frame = 1
Query:  187 THTAIVPLDLVKCRIQVDKAKYK--GIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQT-MPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQ-----NPNAK-------LGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNV 978
            + T   PLD +K  +QV  +++   G+  G    I+E G+R L +G     I  + +   KF  YE  K     L+G     +      L A + A   A  ++ PME  K R+     G  S++ +   K+  +EGL  F+KG +P     IPY  +  A +E TL+    ++     E  + G  + V       +     + S+P   V +++        P A        +  + +  GLLG++ GI P  + +     + + +Y+  K A+ V
Sbjct:   38 SRTCTAPLDRLKVIMQVKASRHNTIGVVGGLAHMIREGGVRSLWRGNGVNVIKIAPETAIKFMAYEQIKK----LIGMRQEQIG-VQERLVAGSLAGATAQTVIYPMEVVKTRLALGKTGQYSSMVDCARKIAKREGLRAFFKGYLPNVLGIIPYAGIDLATYE-TLKNW--WLQKHGAEGANPG--IAVLLCCATTSSTCGQLASYPLALVRTRMQAAASIGGPGASQPGMVGLMRSIVQQDGLLGLYRGIAPNFMKVIPAVGISYVVYENLKGALGV 306          
BLAST of slc25a-27 vs. Ensembl Sea Lamprey
Match: ucp2 (uncoupling protein 2 [Source:NCBI gene;Acc:555812])

HSP 1 Score: 61.2326 bits (147), Expect = 8.596e-11
Identity = 40/163 (24.54%), Postives = 71/163 (43.56%), Query Frame = 1
Query:  205 PLDLVKCRIQVD------KAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVR-IQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFER 672
            P D+VK R Q          +Y G    +K   +EEG+RGL KG  P     ++    +   Y++ K    D + +          +  ++  A F   ++  P++  K R + + PG   +       M++KEG   FYKG +P + R   + ++ F  +E+
Sbjct:  138 PTDVVKVRFQAQVNMLGTSKRYSGTMNAYKTIAREEGVRGLWKGTGPNITRNAIVNCAELVTYDIIK----DTILKYKLLTDNLPCHFVSAFGAGFCTTVVASPVDVVKTRYMNSAPGQYRSAFNCAYLMLTKEGAMAFYKGFVPSFLRLGSWNVVMFVTYEQ 296          

HSP 2 Score: 52.7582 bits (125), Expect = 5.722e-8
Identity = 61/281 (21.71%), Postives = 104/281 (37.01%), Query Frame = 1
Query:  205 PLDLVKCRIQVD-------------KAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQ-------TMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFC-AIISHPADTVVSK-LNQNPNAKLGE------VARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFK 963
            PLD  K R+QV                +Y+G+F      ++ EG R L  G              + GLY+  K++Y +  G E+A +      L A  +    A     P +  KVR Q       T   Y+ T+  A   +  +EG+ G +KG  P   R       +   ++   + + +Y +      C      V  F AG     FC  +++ P D V ++ +N  P            +    G +  + G  P  + +G+   + +  Y+  K
Sbjct:   33 PLDTAKVRLQVQGECQRGEGAARSAGVQYRGVFGTIAAMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKNFYTN--GAEHAGI---GCRLLAGCTTGAMAVTFAQPTDVVKVRFQAQVNMLGTSKRYSGTM-NAYKTIAREEGVRGLWKGTGPNITRNAIVNCAELVTYDIIKDTILKYKLLTDNLPC----HFVSAFGAG-----FCTTVVASPVDVVKTRYMNSAPGQYRSAFNCAYLMLTKEGAMAFYKGFVPSFLRLGSWNVVMFVTYEQLK 298          
BLAST of slc25a-27 vs. Ensembl Yeast
Match: PIC2 (Mitochondrial copper and phosphate carrier; imports copper and inorganic phosphate into mitochondria; functionally redundant with Mir1p but less abundant than Mir1p under normal conditions; expression is induced at high temperature [Source:SGD;Acc:S000000855])

HSP 1 Score: 272.707 bits (696), Expect = 6.182e-90
Identity = 136/285 (47.72%), Postives = 187/285 (65.61%), Query Frame = 1
Query:  133 STKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQ-TMPGYASTLREALPKMMSKE-GLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLG------EVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFK 963
            + +FYA C LGGII+CG TH++I PLDLVKCR+QV+   Y     GF+  I  EG + +  G+  TF+GYSLQG GK+G YE FKH Y+  L          ++YL ASA+AEF ADI+LCP EA KV+ Q TMP + + + +   KM ++  G+  FYKGI+PLW RQIPYTM KF  FE+ ++ +Y  V+PK +E+ +  +Q+ V+F  GY+AG+ CA +SHPAD +VSK+N    A          + + +G  G+W+G+  RI+MIGTLT+ QW IYD FK
Sbjct:   14 TKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPG------VTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYS-VLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFK 291          
BLAST of slc25a-27 vs. Ensembl Yeast
Match: MIR1 (Mitochondrial phosphate carrier; imports inorganic phosphate into mitochondria; functionally redundant with Pic2p but more abundant than Pic2p under normal conditions; phosphorylated [Source:SGD;Acc:S000003838])

HSP 1 Score: 228.024 bits (580), Expect = 2.195e-72
Identity = 117/288 (40.62%), Postives = 176/288 (61.11%), Query Frame = 1
Query:  133 STKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKY-KGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAK-------LGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAM 972
            S   Y    L G I CG+TH+++VP+D+VK RIQ++   Y KG+   FK  I  EG   L  G+ PT +GYS+QG  KFG YEVFK ++ D LG + A  ++ S+Y+ ++A AEF ADI LCP+EA ++R+ + P +A+ L     +++ +EG+G FY G  P+  +QIPY + KF  FER  E  Y +  PK  E+ S     ++   +G  AG+  AI+S PADT++SK+N+   A        L ++A+ LG  G ++G+  R++M+GTLT+LQ+ IY   K  +
Sbjct:   13 SVSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFKQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYDTASRYKNSVYMGSAAMAEFLADIALCPLEATRIRLVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPILFKQIPYNIAKFLVFERASEFYYGFAGPK--EKLSSTSTTLLNLLSGLTAGLAAAIVSQPADTLLSKVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKSTL 298          
BLAST of slc25a-27 vs. Ensembl Yeast
Match: AGC1 (Mitochondrial amino acid transporter; acts both as a glutamate uniporter and as an aspartate-glutamate exchanger; involved in nitrogen metabolism and nitrogen compound biosynthesis; human homolog SLC25A13 complements yeast null mutant [Source:SGD;Acc:S000006225])

HSP 1 Score: 76.6406 bits (187), Expect = 1.734e-15
Identity = 68/272 (25.00%), Postives = 117/272 (43.01%), Query Frame = 1
Query:  157 GLGGIISCGTTHTAIVPLDLVKCRIQVDK--AKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLY--LAASASAEFFADILLCPMEAAKVRIQTMPGYA----STLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGE-QLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWF 945
             LG I  C    T + P+D +K R+Q  +  A+YK         I  EGI+GL  G  P  IG + +   K  + +  ++   D  G       + SL+  + + ASA     I   P+E  K+R+Q    Y         E   +++ K GL G Y G+     R +P++ + F  +    + L+ +    P ++  +   +     +AG IAG+  A ++ P D + ++L  +P  + GE          ++GIF  I  I    + + F
Sbjct:  535 SLGSIAGC-IGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGPQLIGVAPEKAIKLTVNDFMRNRLTDKNG-------KLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDF---DPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDP--RKGETK--------YNGIFHAIRTILKEESFRSF 785          
BLAST of slc25a-27 vs. Ensembl Yeast
Match: MRS3 (Iron transporter, mediates Fe2+ transport across inner mito membrane; mitochondrial carrier family member; active under low-iron conditions; may transport other cations; MRS3 has a paralog, MRS4, that arose from the whole genome duplication [Source:SGD;Acc:S000003669])

HSP 1 Score: 68.5514 bits (166), Expect = 2.418e-13
Identity = 67/276 (24.28%), Postives = 106/276 (38.41%), Query Frame = 1
Query:  190 HTAIVPLDLVKCRIQVDKAKY---KGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLG-EVARNL--------------GLLGMWSGIFPRIIMIGTLTALQWFIYDGFK 963
            H+ + P+D +K RIQ   AK    K + +        EG   L KG     +G        FG YE  K    D    +  + ++T++  A + +A   +D L+ P +  K RIQ     ++++ +   ++   EGL  FY          IP+    F  +E + + L       P   C            G I+G  CA I+ P D + + L    +  +  E+ R                G  G W G  PRI+     TA+ W  Y+  K
Sbjct:   48 HSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTA---SDALMNPFDTIKQRIQL--NTSASVWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEYNPLIHCL----------CGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAK 308          
BLAST of slc25a-27 vs. Ensembl Yeast
Match: MME1 (Transporter of the mitochondrial inner membrane that exports magnesium; involved in mitochondrial Mg2+ homeostasis; has similarity to human mitochondrial ATP-Mg/Pi carriers [Source:SGD;Acc:S000004776])

HSP 1 Score: 68.1662 bits (165), Expect = 3.803e-13
Identity = 73/307 (23.78%), Postives = 129/307 (42.02%), Query Frame = 1
Query:  157 GLGGIISCGTTHTAIVPLDLVKCRIQ--VDKAKYKGIFTGFKVSIKEEGIR-GLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTM---------PGYA-STLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPRE-QCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLN-QNPNAK---------------------------LGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIY 951
            G+GG I     H+    LD VK R Q   +  KY+ + + ++    EEG+R GL  G+    +G        FG YE  K         E+  +  T  +L+A    +F +  +  P E  K R+Q            GY  S LR A+  ++ +EG    + G      R +P++ ++FA +E+  +  ++      R+ + S   +++    AG +AG    II+ P D V +++  Q P ++                           L  V ++ G+LG +SG+ PR +     +++   +Y
Sbjct:   61 GIGGKIGDSAMHS----LDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMI-----EDWQINDTITHLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEILTGACAGGLAG----IITTPMDVVKTRVQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWTSVQSSIMLLLY 354          
BLAST of slc25a-27 vs. Ensembl Nematostella
Match: EDO31806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWV8])

HSP 1 Score: 435.647 bits (1119), Expect = 1.181e-152
Identity = 225/315 (71.43%), Postives = 264/315 (83.81%), Query Frame = 1
Query:   94 ASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESL-RKKLAGK 1035
            AS      SCE+GS K+YALCG GGI+SCG THTA+VPLDLVKCRIQVD  KY  +  GFK+++KE+G+RGLA+GWAPTFIGYS+QGLGKFG YEVFK  Y ++LGEE +YL+RTSLYLAASASAEFFADI L PMEA KVRIQT PG+A TLRE +PK+M +EG+ GFYKG+ PLW RQIPYTMMKFACFERT+EALY+YVVPKPR +C+K EQLVVTF+AGYIAGVFCAI+SHPADTVVSKLN +  +   + AR+LG+ G+W G+ PRI+MIGTLTALQWFIYD  KV   +PRPPPP  PESL RK+LA +
Sbjct:   38 ASAAGEQHSCEFGSAKYYALCGFGGILSCGLTHTAVVPLDLVKCRIQVDPKKYGSMVNGFKITLKEDGVRGLARGWAPTFIGYSMQGLGKFGFYEVFKIMYGNMLGEEYSYLYRTSLYLAASASAEFFADIALAPMEAVKVRIQTQPGWAGTLREGVPKLMKEEGIRGFYKGLPPLWMRQIPYTMMKFACFERTVEALYKYVVPKPRSECTKPEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNNDVGSTPIQAARDLGMKGLWKGLGPRIVMIGTLTALQWFIYDSVKVFFRLPRPPPPEEPESLKRKRLAAQ 352          
BLAST of slc25a-27 vs. Ensembl Nematostella
Match: EDO45549 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE2])

HSP 1 Score: 81.6481 bits (200), Expect = 1.918e-17
Identity = 62/261 (23.75%), Postives = 117/261 (44.83%), Query Frame = 1
Query:  205 PLDLVKCRIQVDK--AKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYT---MMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNP------NAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYD 954
            PLDLVK R+Q     +   G+F  F    + + + GL +G  P+      + +    +Y    H  +  + E+ + L    L     A+A   A + + P+   K R ++     +++R+AL  + + EG  G Y G++    R  P++   +M +   +R  + L Q          + G+     F  G +AG   ++++ PAD V ++L  NP       A +  +    G+ G++ G+ PR +    ++A+ W IY+
Sbjct:   27 PLDLVKTRLQTRAIASGNGGMFYTFYTVFRADHVAGLWRGLTPSI----YRCVPGVAMYFTSLHGLSSFVSEDPSPLQSIVL----GATARTIAGVCMMPVTVVKTRYESGNFNYTSMRQALVSIWTNEGGRGLYSGLVATVARDAPFSGLYLMFYTQIKRRAKGLLQV------GDLTSGQN----FICGIMAGAMASVVTQPADVVKTRLQMNPYMYPSNRAAVVAIIEAGGIEGLFRGLVPRTVRRTLMSAMAWTIYE 269          
BLAST of slc25a-27 vs. Ensembl Nematostella
Match: EDO34326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPL4])

HSP 1 Score: 81.2629 bits (199), Expect = 2.962e-17
Identity = 76/305 (24.92%), Postives = 124/305 (40.66%), Query Frame = 1
Query:  160 LGGIISCGTTHTAIVPLDLVKCRIQVD-----KAKYKGIF----------TGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEEN---AYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQ------TMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLG-------------EVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFK 963
            LGG+ SC T  T   P+++VK R+Q+D     K   K IF          TG     +EEG+RGL +G  P  +  ++    + G YE  K    +LLG  +   A LW+    + A  S+      +  P +  K+R Q      T+P     +  A  K+  KEG  G + G+ P        T+ + AC   T    Y +            E + +  ++  +AG     ++ P D V ++    P    G             +  R+ G+L ++ G FP     G  T + +F+Y+  +
Sbjct:   14 LGGL-SCMTATTVTNPIEVVKIRMQLDNELGSKHNSKDIFRERYYKGLIRTGLSRVYREEGVRGLYRGIFPALLRQAIYSSTRLGAYEPIK----NLLGATDSTSAALWKK---IVAGVSSGVIGSAIATPTDLVKIRFQAVKIGETIP--YKNMFHAFYKIAKKEGFLGLWTGMKP--------TVKRAACISGTQIPTYDHTKHLLLNAELMREGVALHLASALVAGFVATCVASPVDIVRTRFMTQPKDTKGRPLVYQGTLDCIYKTVRHEGILALYKGFFPNWTRTGLDTIIIFFVYERLR 300          
BLAST of slc25a-27 vs. Ensembl Nematostella
Match: EDO32185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVT7])

HSP 1 Score: 72.7886 bits (177), Expect = 5.919e-14
Identity = 71/279 (25.45%), Postives = 119/279 (42.65%), Query Frame = 1
Query:  187 THTAIVPLDLVKCRIQVDKAKYK--GIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMP-GYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALY-QYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNL-----------GLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNV 978
            + TA  PLD +K  +QV  +     GI +GFK+ ++E GI+ L +G     I  + +   KF  YE  K     L+G +   L  T   LA S  A   +   + P+E  K R+     G    L  A   +  KEG+  FY+G+ P     IPY  +  A +E TL+  Y  Y      +  S    ++V  + G  +     + S+P   V ++L      K G    N+           G  G++ G+ P  + +    ++ + +Y+  ++ + V
Sbjct:  203 SRTATAPLDRLKVLLQVQASSTNRFGIVSGFKMMLREGGIKSLWRGNGANVIKIAPESGIKFFAYEKAKK----LVGSDTKALGVTDRLLAGSM-AGVASQTSIYPLEVLKTRLAIRKTGQYRGLLHAASVIYQKEGIRSFYRGLFPSLLGIIPYAGIDLAVYE-TLKNFYLNY-----HKNQSADPGVLVLLACGTASSTCGQLASYPLSLVRTRLQAQAREKGGGQGDNMVSVLRKIITEDGFKGLYRGLAPNFLKVAPAVSISYVVYENLRLGLGV 470          
BLAST of slc25a-27 vs. Ensembl Nematostella
Match: EDO35704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKV2])

HSP 1 Score: 71.2478 bits (173), Expect = 7.685e-14
Identity = 64/217 (29.49%), Postives = 88/217 (40.55%), Query Frame = 1
Query:  205 PLDLVKCRIQVDKAK-YKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWR-----TSLYLAASASAEFFADILLCPMEAAKVRIQT------MPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVS 819
            P D VK R+Q      Y G+F  FK  IK E + GL KG A    G  L                A + G +   L R     T     + A A     I+ CPME AK R+Q       +  Y  +L + L K+   EGL G ++G+     R IP   + F  F+   E L       P+ +       +  F +G IAG    I+++P D V S
Sbjct:   25 PFDTVKVRLQTQTNNVYNGVFDCFKQIIKRESVLGLYKGMASPLAGLGL--------------INAIIFGVQGETLRRLNGSGTMAQAISGAIAGGVQSIVCCPMELAKTRVQVQGQGQKLMAYTGSL-DCLKKVFHSEGLRGCFRGMAITTTRDIPAFALYFGSFQYVCELL------TPKGEHVDNLSPIRLFFSGGIAGTLSWILTYPVDMVKS 220          
BLAST of slc25a-27 vs. Ensembl Medaka
Match: slc25a3b (solute carrier family 25 member 3 [Source:NCBI gene;Acc:101156294])

HSP 1 Score: 429.869 bits (1104), Expect = 2.093e-150
Identity = 221/304 (72.70%), Postives = 255/304 (83.88%), Query Frame = 1
Query:  115 SSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
             SCE+GS K+  LCG GGI+SCGTTHTA+VPLDLVKCR+QV+  KYK I  GF V+++E+G+RGLAKGWAPTFIGYS+QGL KFG YEVFK  Y+DLLGEEN YLWRTSLYLAASASAEFFADI L PMEA KVRIQT PGYA+TLR+ +PKM ++EG+  FYKG++PLW RQIPYTMMKFACFERT+E LY+YVVPKPR +CSKGEQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +   +V + LG  G+W G+  RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   18 DSCEFGSQKYLVLCGFGGILSCGTTHTAVVPLDLVKCRMQVNPDKYKSIGNGFAVTVREDGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKIMYSDLLGEENTYLWRTSLYLAASASAEFFADIALAPMEAVKVRIQTQPGYANTLRQCVPKMYAEEGIWAFYKGVVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRSECSKGEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTAAQVLKKLGPKGVWKGLVARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 321          
BLAST of slc25a-27 vs. Ensembl Medaka
Match: slc25a3b (solute carrier family 25 member 3 [Source:NCBI gene;Acc:101156294])

HSP 1 Score: 430.639 bits (1106), Expect = 2.701e-150
Identity = 221/307 (71.99%), Postives = 255/307 (83.06%), Query Frame = 1
Query:  106 QSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
                SCE+GS K+  LCG GGI+SCGTTHTA+VPLDLVKCR+QV+  KYK I  GF V+++E+G+RGLAKGWAPTFIGYS+QGL KFG YEVFK  Y+DLLGEEN YLWRTSLYLAASASAEFFADI L PMEA KVRIQT PGYA+TLR+ +PKM ++EG+  FYKG++PLW RQIPYTMMKFACFERT+E LY+YVVPKPR +CSKGEQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +   +V + LG  G+W G+  RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:   49 DEGDSCEFGSQKYLVLCGFGGILSCGTTHTAVVPLDLVKCRMQVNPDKYKSIGNGFAVTVREDGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKIMYSDLLGEENTYLWRTSLYLAASASAEFFADIALAPMEAVKVRIQTQPGYANTLRQCVPKMYAEEGIWAFYKGVVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRSECSKGEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTAAQVLKKLGPKGVWKGLVARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 355          
BLAST of slc25a-27 vs. Ensembl Medaka
Match: slc25a3b (solute carrier family 25 member 3 [Source:NCBI gene;Acc:101156294])

HSP 1 Score: 363.614 bits (932), Expect = 3.649e-125
Identity = 192/267 (71.91%), Postives = 221/267 (82.77%), Query Frame = 1
Query:  226 RIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKL 1026
            R  V+  KYK I  GF V+++E+G+RGLAKGWAPTFIGYS+QGL KFG YEVFK  Y+DLLGEEN YLWRTSLYLAASASAEFFADI L PMEA KVRIQT PGYA+TLR+ +PKM ++EG+  FYKG++PLW RQIPYTMMKFACFERT+E LY+YVVPKPR +CSKGEQLVVTF AGYIAGVFCAI+SHPAD+VVS LN+   +   +V + LG  G+W G+  RIIMIGTLTALQWFIYD  KV   +PRPPPP  PESL+KKL
Sbjct:    7 RTTVNPDKYKSIGNGFAVTVREDGVRGLAKGWAPTFIGYSMQGLCKFGFYEVFKIMYSDLLGEENTYLWRTSLYLAASASAEFFADIALAPMEAVKVRIQTQPGYANTLRQCVPKMYAEEGIWAFYKGVVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRSECSKGEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSTAAQVLKKLGPKGVWKGLVARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKL 273          
BLAST of slc25a-27 vs. Ensembl Medaka
Match: slc25a38a (solute carrier family 25 member 38-A [Source:NCBI gene;Acc:101164809])

HSP 1 Score: 88.9669 bits (219), Expect = 9.711e-20
Identity = 69/263 (26.24%), Postives = 117/263 (44.49%), Query Frame = 1
Query:  205 PLDLVKCRIQVDKAKYK------GIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKF--GLYEVFKHYYAD-LLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNL----GLLGMWSGIFPRIIMIGTLTALQWFIYD 954
            PLDLVK R+Q  ++  +      G+ T     ++ E + GL KG +P+F   ++ G+G +    Y + +H+Y D   G   A L            A   A +L+ P+   K R +       ++  AL  +   EG    Y G++P   R +P++ +    + +T  AL       P E  +     +  FS G +AGV  ++I+ PAD V + +  NP  +  E  R +    G  G + G  PR +    + A+ W +Y+
Sbjct:   16 PLDLVKTRLQTLQSTVQPGSGRVGMMTVLLSVVRTERLLGLWKGVSPSF-ARTIPGVGIYFSTYYSLKQHFYQDDRPGPLPAVLL--------GGGARTVAGVLMLPVTVIKTRFECGRYSYVSVSGALRSVCQTEGPAALYSGLMPTLLRDVPFSAIYVMFYSQTKAAL-------PSEVGASPSAPLANFSCGILAGVLASLITQPADVVKTHVQVNPQLRTAEAIRYIYTEHGAQGFFRGALPRSLRRTMMAAMAWTVYE 262          
BLAST of slc25a-27 vs. Ensembl Medaka
Match: slc25a38a (solute carrier family 25 member 38-A [Source:NCBI gene;Acc:101164809])

HSP 1 Score: 88.9669 bits (219), Expect = 1.220e-19
Identity = 69/263 (26.24%), Postives = 117/263 (44.49%), Query Frame = 1
Query:  205 PLDLVKCRIQVDKAKYK------GIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKF--GLYEVFKHYYAD-LLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNL----GLLGMWSGIFPRIIMIGTLTALQWFIYD 954
            PLDLVK R+Q  ++  +      G+ T     ++ E + GL KG +P+F   ++ G+G +    Y + +H+Y D   G   A L            A   A +L+ P+   K R +       ++  AL  +   EG    Y G++P   R +P++ +    + +T  AL       P E  +     +  FS G +AGV  ++I+ PAD V + +  NP  +  E  R +    G  G + G  PR +    + A+ W +Y+
Sbjct:   29 PLDLVKTRLQTLQSTVQPGSGRVGMMTVLLSVVRTERLLGLWKGVSPSF-ARTIPGVGIYFSTYYSLKQHFYQDDRPGPLPAVLL--------GGGARTVAGVLMLPVTVIKTRFECGRYSYVSVSGALRSVCQTEGPAALYSGLMPTLLRDVPFSAIYVMFYSQTKAAL-------PSEVGASPSAPLANFSCGILAGVLASLITQPADVVKTHVQVNPQLRTAEAIRYIYTEHGAQGFFRGALPRSLRRTMMAAMAWTVYE 275          
BLAST of slc25a-27 vs. Planmine SMEST
Match: SMESG000061901.1 (SMESG000061901.1)

HSP 1 Score: 641.343 bits (1653), Expect = 0.000e+0
Identity = 323/324 (99.69%), Postives = 323/324 (99.69%), Query Frame = 1
Query:   64 MLIKYIKANCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVXXXXXXXXXESLRKKLAGK 1035
            MLIKYIKANCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMM KEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVPRPPPPAAPESLRKKLAGK
Sbjct:    1 MLIKYIKANCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLDLVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYASTLREALPKMMCKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFKVAMNVPRPPPPAAPESLRKKLAGK 324          
BLAST of slc25a-27 vs. Planmine SMEST
Match: SMESG000016412.1 (SMESG000016412.1)

HSP 1 Score: 73.559 bits (179), Expect = 2.417e-14
Identity = 63/282 (22.34%), Postives = 107/282 (37.94%), Query Frame = 1
Query:  205 PLDLVKCRIQVDK-------------AKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYA--STLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLNQNPNAK--------------LGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFK 963
            P+D  K R+Q+                +Y G+   F V IK+EGI  L +G +   I  +  G  K GLY+  K      +  +N      S  +A +  A   +  +  P +  K+R+Q+   Y   S+  +   + +SKEG  G YK +IP   R         A     L   Y +   K   +    + +   F++  +A  F   +S P + + ++L    N                L +  RN  +  +W G  P    IG    + +  ++  K
Sbjct:   23 PIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKLKR-----ISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNYTQNSSFLKEFTQTISKEGFKGLYKAVIPTAARS--------ALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIK 291          
BLAST of slc25a-27 vs. Planmine SMEST
Match: SMESG000047064.1 (SMESG000047064.1)

HSP 1 Score: 66.6254 bits (161), Expect = 5.680e-12
Identity = 76/286 (26.57%), Postives = 118/286 (41.26%), Query Frame = 1
Query:  112 NSSCEYGSTKFYALCGLGGIISCGTTHTAIV-PLDLVKCRIQ--------VDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEE----NAYLWRTSLYLAASASAEFFADILLCPMEAAKVRI--QTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQYVVPKPRE----QCSKGEQLVVTFSAGYIAGVFCAIISHPADTVVSKLN----QNPNAKLGEVARNLGLLGMWSGIF 900
            N S    S   YA+ G  G    G    A+V PLD+VK R Q        +   KYKGI    K   KEEG++   KG   + I      L +F  YE+ K Y+  L+ E      + L  +  +L  S +    A I   P +  + R   Q  P     L  A+  ++  EGL G ++G+IP      P T  +F  +  +   L ++   K ++    +  K   L    S G IAG    I  +P D +  ++     +   +K G++  + G++     IF
Sbjct:    6 NLSNSQHSQIDYAIAGASG----GFVSRAVVQPLDVVKIRFQLQVEPIQTITDGKYKGIAQAIKCIYKEEGLKAFWKGHLSSQIQAVSFSLVQFSTYELCKVYFWPLISESPSTGKSVLKSSKTFLLGSLAGS-TATIFTQPFDVFRTRFAAQGEPKTYPNLSNAIIMIIKTEGLRGLFRGLIPSLLLVAPQTGFQFFFYNLSNNVLTKFFKTKGKQDNLFEIHKIGILQSALSGG-IAGSMAKICVYPVDIIKKRMQVQGFEKARSKFGKLHVSKGVVKCIKVIF 285          
BLAST of slc25a-27 vs. Planmine SMEST
Match: SMESG000074820.1 (SMESG000074820.1)

HSP 1 Score: 63.929 bits (154), Expect = 8.299e-11
Identity = 43/175 (24.57%), Postives = 81/175 (46.29%), Query Frame = 1
Query:  160 LGGIISCGTTHTAIVPLDLVKCRIQVDKA-KYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAKVRIQTMPGYAS--TLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERT 675
            + G ++  T  T I P++++K R+ + K+ +Y  IF   K     EGI+   +G+ P  +G          LYE FK+ Y   +  + +      + L + A +     +   P+   + ++Q M       +++     ++  EG+ GFY+GI P   + IP   + +A FE+T
Sbjct:  287 VAGAMAGATAQTLIYPMEVLKTRMCLRKSGQYSSIFDCAKKVYINEGIQVFFRGYVPNILGIIPYAGIDLALYETFKNLYLKSINHDKSASTPIYVSLCSGAVSSVCGQVATYPLALVRTKLQAMSKSDGKISMKNVSRDIIKNEGVLGFYRGIGPNMLKVIPAVSISYAVFEQT 461          
BLAST of slc25a-27 vs. Planmine SMEST
Match: SMESG000009142.1 (SMESG000009142.1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.419e-10
Identity = 58/187 (31.02%), Postives = 86/187 (45.99%), Query Frame = 1
Query:  166 GIISCGTTHTAIVPLDLVKCRIQVDKA-----KYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGKFGLYEVFKHYYADLL---GEENAYLWRTSLYLAASASAEFFADILLC-PMEAAKVRIQTMP--GYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFACFERTLEALYQ 693
            G++S   T   + P + VKC +QV  A     KYKG     K   KE GIR + KG A T     L+ +   G Y +   +  + L   G + A+L      +A   +     + L+C P +  K R+QT P   Y + LR    +MM+ EGL G Y+G+ P+  R  P     F  +E  L+ L +
Sbjct:  115 GMLSGVFTTAIMTPGERVKCLLQVQGASSGPPKYKGPADVVKQLYKEGGIRSIYKGTAATL----LRDIPATGTYFMSYEWLKESLTPEGGDKAHLSAGRTLIAGGFAG--MCNWLVCIPPDTLKSRLQTAPEGKYPNGLRSVFREMMANEGLIGLYRGVSPVLIRAFPANAACFLGYEMALKLLNK 295          
The following BLAST results are available for this feature:
BLAST of slc25a-27 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A33.335e-15473.31solute carrier family 25 member 3 [Source:HGNC Sym... [more]
SLC25A33.335e-15473.31solute carrier family 25 member 3 [Source:HGNC Sym... [more]
SLC25A34.185e-15472.52solute carrier family 25 member 3 [Source:HGNC Sym... [more]
SLC25A34.185e-15472.52solute carrier family 25 member 3 [Source:HGNC Sym... [more]
SLC25A34.185e-15472.52solute carrier family 25 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc25a-27 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F01G4.69.618e-15471.84Phosphate carrier protein, mitochondrial [Source:... [more]
F01G4.69.618e-15471.84Phosphate carrier protein, mitochondrial [Source:... [more]
F01G4.69.618e-15471.84Phosphate carrier protein, mitochondrial [Source:... [more]
F01G4.61.804e-14973.36Phosphate carrier protein, mitochondrial [Source:... [more]
F01G4.61.804e-14973.36Phosphate carrier protein, mitochondrial [Source:... [more]
back to top
BLAST of slc25a-27 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mpcp11.117e-15674.67gene:FBgn0034497 transcript:FBtr0342679[more]
Mpcp11.117e-15674.67gene:FBgn0034497 transcript:FBtr0342680[more]
Mpcp11.117e-15674.67gene:FBgn0034497 transcript:FBtr0086303[more]
Mpcp24.067e-15569.11gene:FBgn0026409 transcript:FBtr0075719[more]
Mpcp24.067e-15569.11gene:FBgn0026409 transcript:FBtr0075718[more]
back to top
BLAST of slc25a-27 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a3b5.104e-15673.95solute carrier family 25 member 3b [Source:ZFIN;Ac... [more]
slc25a3b1.094e-15573.63solute carrier family 25 member 3b [Source:ZFIN;Ac... [more]
slc25a3a8.765e-15571.43solute carrier family 25 member 3a [Source:ZFIN;Ac... [more]
slc25a3a1.715e-15471.43solute carrier family 25 member 3a [Source:ZFIN;Ac... [more]
slc25a3b9.478e-13078.15solute carrier family 25 member 3b [Source:ZFIN;Ac... [more]
back to top
BLAST of slc25a-27 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klhl141.747e-15473.63kelch like family member 14 [Source:Xenbase;Acc:XB... [more]
klhl145.443e-15274.26kelch like family member 14 [Source:Xenbase;Acc:XB... [more]
klhl144.380e-15173.93kelch like family member 14 [Source:Xenbase;Acc:XB... [more]
slc25a241.291e-1425.78solute carrier family 25 (mitochondrial carrier; p... [more]
ENSXETT00000035457.11.396e-1423.64mitochondrial ornithine transporter 1-like [Source... [more]
back to top
BLAST of slc25a-27 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc25a33.206e-16472.67solute carrier family 25 (mitochondrial carrier, p... [more]
Slc25a36.386e-16373.60solute carrier family 25 (mitochondrial carrier, p... [more]
Slc25a36.386e-16373.60solute carrier family 25 (mitochondrial carrier, p... [more]
Slc25a191.741e-1925.69solute carrier family 25 (mitochondrial thiamine p... [more]
Slc25a191.741e-1925.69solute carrier family 25 (mitochondrial thiamine p... [more]
back to top
BLAST of slc25a-27 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VEM8|MPCP_MOUSE4.467e-16273.60Phosphate carrier protein, mitochondrial OS=Mus mu... [more]
sp|P12234|MPCP_BOVIN3.504e-15574.28Phosphate carrier protein, mitochondrial OS=Bos ta... [more]
sp|P16036|MPCP_RAT1.176e-15373.60Phosphate carrier protein, mitochondrial OS=Rattus... [more]
sp|Q00325|MPCP_HUMAN1.602e-15373.31Phosphate carrier protein, mitochondrial OS=Homo s... [more]
sp|Q5R7W2|MPCP_PONAB3.432e-15372.52Phosphate carrier protein, mitochondrial OS=Pongo ... [more]
back to top
BLAST of slc25a-27 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF600.000e+0100.00Slc25a-27 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A183TKT42.073e-18080.39Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0X3NIQ04.477e-18080.39Phosphate carrier protein (Fragment) OS=Schistocep... [more]
A0A3P7LCD23.327e-17881.38Uncharacterized protein OS=Dibothriocephalus latus... [more]
C1L8V61.175e-17279.94Phosphate carrier protein, mitochondrial OS=Schist... [more]
back to top
BLAST of slc25a-27 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a3b1.017e-15673.31solute carrier family 25 member 3 [Source:NCBI gen... [more]
slc25a3b2.544e-15572.67solute carrier family 25 member 3 [Source:NCBI gen... [more]
slc25a3a5.104e-15372.26phosphate carrier protein, mitochondrial-like [Sou... [more]
slc25a3a5.104e-15372.26phosphate carrier protein, mitochondrial-like [Sou... [more]
slc25a38a6.501e-1523.22solute carrier family 25 member 38-A-like [Source:... [more]
back to top
BLAST of slc25a-27 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a38b6.537e-1724.08solute carrier family 25 member 38b [Source:NCBI g... [more]
slc25a23a7.672e-1625.17solute carrier family 25 member 23a [Source:ZFIN;A... [more]
ENSPMAT00000008980.11.645e-1125.22pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 ... [more]
ENSPMAT00000004577.12.391e-1124.37pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gen... [more]
ucp28.596e-1124.54uncoupling protein 2 [Source:NCBI gene;Acc:555812][more]
back to top
BLAST of slc25a-27 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PIC26.182e-9047.72Mitochondrial copper and phosphate carrier; import... [more]
MIR12.195e-7240.63Mitochondrial phosphate carrier; imports inorganic... [more]
AGC11.734e-1525.00Mitochondrial amino acid transporter; acts both as... [more]
MRS32.418e-1324.28Iron transporter, mediates Fe2+ transport across i... [more]
MME13.803e-1323.78Transporter of the mitochondrial inner membrane th... [more]
back to top
BLAST of slc25a-27 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO318061.181e-15271.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455491.918e-1723.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343262.962e-1724.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321855.919e-1425.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357047.685e-1429.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc25a-27 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a3b2.093e-15072.70solute carrier family 25 member 3 [Source:NCBI gen... [more]
slc25a3b2.701e-15071.99solute carrier family 25 member 3 [Source:NCBI gen... [more]
slc25a3b3.649e-12571.91solute carrier family 25 member 3 [Source:NCBI gen... [more]
slc25a38a9.711e-2026.24solute carrier family 25 member 38-A [Source:NCBI ... [more]
slc25a38a1.220e-1926.24solute carrier family 25 member 38-A [Source:NCBI ... [more]
back to top
BLAST of slc25a-27 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061901.10.000e+099.69SMESG000061901.1[more]
SMESG000016412.12.417e-1422.34SMESG000016412.1[more]
SMESG000047064.15.680e-1226.57SMESG000047064.1[more]
SMESG000074820.18.299e-1124.57SMESG000074820.1[more]
SMESG000009142.12.419e-1031.02SMESG000009142.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012974
GenBankAKN21595.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012974 ID=SMED30012974|Name=slc25a-27|organism=Schmidtea mediterranea sexual|type=transcript|length=1236bp
TGTTTTAATTTGCAAATATAAAACTTATACTTTCAATTTCCTAATTTTCC
AGTAATTTGAAATATGCTGATTAAGTATATTAAAGCCAATTGTGCCTCAA
ATCCTCAAAGTAACAGTAGTTGTGAATATGGTTCAACGAAGTTCTATGCT
CTATGTGGTCTTGGAGGGATTATCAGTTGTGGAACGACACACACAGCCAT
TGTTCCATTAGATTTAGTAAAATGTAGAATACAAGTGGATAAAGCTAAGT
ACAAGGGGATTTTTACTGGATTTAAAGTATCAATCAAAGAAGAAGGAATT
CGAGGATTAGCTAAAGGCTGGGCACCTACTTTTATTGGCTATTCTTTACA
GGGATTAGGAAAATTTGGCCTCTATGAAGTATTTAAGCATTACTATGCTG
ACCTTTTAGGAGAAGAAAATGCATATCTGTGGCGTACTAGTTTGTATCTG
GCTGCAAGTGCAAGTGCGGAATTTTTTGCAGATATTCTTCTTTGTCCAAT
GGAAGCAGCTAAAGTTAGAATACAAACAATGCCCGGATATGCTTCTACTT
TGCGTGAAGCCTTACCTAAGATGATGTCTAAAGAAGGCTTAGGGGGATTT
TACAAAGGAATCATTCCTCTTTGGGGTCGACAAATTCCATATACAATGAT
GAAATTCGCATGTTTTGAAAGAACTTTGGAAGCTTTATATCAATACGTTG
TGCCAAAACCAAGAGAACAGTGTTCGAAAGGTGAACAGCTAGTAGTTACA
TTTAGTGCTGGATATATTGCTGGAGTTTTCTGTGCTATAATTTCGCATCC
AGCAGATACAGTTGTGTCAAAATTGAATCAGAATCCAAATGCAAAACTTG
GTGAGGTCGCTAGAAATCTTGGATTATTAGGAATGTGGAGTGGTATTTTC
CCGAGGATAATTATGATTGGTACTCTCACAGCATTGCAGTGGTTCATTTA
TGATGGATTTAAAGTTGCGATGAATGTTCCACGGCCACCTCCTCCAGCTG
CTCCTGAATCATTGAGAAAGAAACTAGCGGGGAAATAATAATGATTTTAG
ATTTATTATATATCACTTATAGTTTTTTAATGTAAATATAAATGTTATTA
CTGAATCGAAAGGAAAAATTTGAAATGGAAGTGTAACATTTATCTAATAA
TTATTAATCATTTAACTGTAGGTGTTTTTCGAATGTTTGCTTCTTAATAA
TAAATAGTGTTTTCGCTTATTATTTGTCTTGTATAT
back to top

protein sequence of SMED30012974-orf-1

>SMED30012974-orf-1 ID=SMED30012974-orf-1|Name=SMED30012974-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=325bp
MLIKYIKANCASNPQSNSSCEYGSTKFYALCGLGGIISCGTTHTAIVPLD
LVKCRIQVDKAKYKGIFTGFKVSIKEEGIRGLAKGWAPTFIGYSLQGLGK
FGLYEVFKHYYADLLGEENAYLWRTSLYLAASASAEFFADILLCPMEAAK
VRIQTMPGYASTLREALPKMMSKEGLGGFYKGIIPLWGRQIPYTMMKFAC
FERTLEALYQYVVPKPREQCSKGEQLVVTFSAGYIAGVFCAIISHPADTV
VSKLNQNPNAKLGEVARNLGLLGMWSGIFPRIIMIGTLTALQWFIYDGFK
VAMNVPRPPPPAAPESLRKKLAGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR018108Mitochondrial_sb/sol_carrier
IPR023395Mt_carrier_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006810transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 15..211
e-value: 3.6E-38
score: 132.9
coord: 212..307
e-value: 9.2E-11
score: 42.9
IPR023395Mitochondrial carrier domain superfamilySUPERFAMILYSSF103506Mitochondrial carriercoord: 29..297
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 226..303
e-value: 4.4E-8
score: 32.9
coord: 32..112
e-value: 1.3E-18
score: 66.7
coord: 128..210
e-value: 7.9E-15
score: 54.6
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 224..302
score: 19.295
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 123..207
score: 20.582
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 26..110
score: 24.315
NoneNo IPR availablePANTHERPTHR45671FAMILY NOT NAMEDcoord: 13..322
NoneNo IPR availablePANTHERPTHR45671:SF2coord: 13..322
NoneNo IPR availableTMHMMTMhelixcoord: 226..245
NoneNo IPR availableTMHMMTMhelixcoord: 277..296