Neuronal acetylcholine receptor subunit alpha-2

Overview
NameNeuronal acetylcholine receptor subunit alpha-2
Smed IDSMED30012957
Length (bp)2127
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuronal acetylcholine receptor subunit alpha-2 (SMED30012957) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-2 (SMED30012957) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012957

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30012957h1SMcG0000618 dd_Smed_v4_18201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012957h1SMcG0000618 dd_Smed_v4_18201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012957h1SMcG0000618 dd_Smed_v4_18201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30012957h1SMcG0000618 dd_Smed_v4_18201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30012957h1SMcG0000618 dd_Smed_v4_18201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012957h1SMcG0000618 dd_Smed_v4_18201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Human
Match: CHRNA4 (cholinergic receptor nicotinic alpha 4 subunit [Source:HGNC Symbol;Acc:HGNC:1958])

HSP 1 Score: 240.35 bits (612), Expect = 2.387e-69
Identity = 130/351 (37.04%), Postives = 199/351 (56.70%), Query Frame = 3
Query:  132 HLES-GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIK 1181
            H+E+    E+ L++ +   Y+K SRPV  N++ V+            V FGL +  ++D++E  Q++TT+V +   W D  L WDP +YEN+  + IPS LIW PDI LYN AD          A +  DG V+W P AIYKS+C +++ +FPFD Q C +KFG WTYD  +  I   N  S +D      S EW I+ +   +   +Y CC E YPDI++   IRR P+FYT  LI+PC L+S LT+++F++P E   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R      +P W++++  +   + L +   S +K
Sbjct:   29 HVETRAHAEERLLKKLFSGYNKWSRPV-ANISDVV-----------LVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYD--KAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVK 365          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Human
Match: CHRNA2 (cholinergic receptor nicotinic alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:1956])

HSP 1 Score: 236.113 bits (601), Expect = 5.326e-69
Identity = 126/350 (36.00%), Postives = 197/350 (56.29%), Query Frame = 3
Query:  114 GSNSEVHLESGWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCIN 1163
            GS++E        E  L + + + Y++ +RPV +    VI            V FGL +  ++D++E  Q++TT+V L   W D  L W+PT++ NI  + +PS +IWIPDI LYN AD          A + S GTV W P AIYKS+C +++ +FPFD Q C +KFG WTYD  +  I     E  +DL     S EW I+ +   +   +Y CC E YPD+++   IRR P+FYT  LI+PC L+S LT+++F++P +   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R  +   +P+W++  +     ++L +N
Sbjct:   31 GSHTET-------EDRLFKHLFRGYNRWARPVPNTSDVVI------------VRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYD--KAKIDLEQMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHTMPHWVRGALLGCVPRWLLMN 359          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 234.187 bits (596), Expect = 2.194e-68
Identity = 112/334 (33.53%), Postives = 197/334 (58.98%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFL 1154
            +++L + ++++Y+   RPV ++             Q +TV F L L+ I+D++E  QVLTT++ L   W D +L+W+ +EY  ++ V  P   IW PDI LYN ADER +        ++S G  ++ P  I+KS+C++++++FPFD+Q C LKFG W+Y G+ +++         D+S  +P+ EW ++      +E  Y CC EPYPD++F V +RR  ++Y   L++PC L+S+L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ LS  ++ IV+  H    +  ++P W + ++ N+   FL
Sbjct:   26 QRKLYKELVKNYNPLERPVANDS------------QPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEA----DISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFL 343          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Human
Match: AC243734.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 234.187 bits (596), Expect = 2.194e-68
Identity = 112/334 (33.53%), Postives = 197/334 (58.98%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFL 1154
            +++L + ++++Y+   RPV ++             Q +TV F L L+ I+D++E  QVLTT++ L   W D +L+W+ +EY  ++ V  P   IW PDI LYN ADER +        ++S G  ++ P  I+KS+C++++++FPFD+Q C LKFG W+Y G+ +++         D+S  +P+ EW ++      +E  Y CC EPYPD++F V +RR  ++Y   L++PC L+S+L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ LS  ++ IV+  H    +  ++P W + ++ N+   FL
Sbjct:   26 QRKLYKELVKNYNPLERPVANDS------------QPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEA----DISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFL 343          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Human
Match: CHRNA2 (cholinergic receptor nicotinic alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:1956])

HSP 1 Score: 234.958 bits (598), Expect = 2.226e-68
Identity = 126/350 (36.00%), Postives = 197/350 (56.29%), Query Frame = 3
Query:  114 GSNSEVHLESGWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCIN 1163
            GS++E        E  L + + + Y++ +RPV +    VI            V FGL +  ++D++E  Q++TT+V L   W D  L W+PT++ NI  + +PS +IWIPDI LYN AD          A + S GTV W P AIYKS+C +++ +FPFD Q C +KFG WTYD  +  I     E  +DL     S EW I+ +   +   +Y CC E YPD+++   IRR P+FYT  LI+PC L+S LT+++F++P +   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R  +   +P+W++  +     ++L +N
Sbjct:   53 GSHTET-------EDRLFKHLFRGYNRWARPVPNTSDVVI------------VRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYD--KAKIDLEQMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHTMPHWVRGALLGCVPRWLLMN 381          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Celegans
Match: unc-63 (Acetylcholine receptor subunit alpha-type unc-63 [Source:UniProtKB/Swiss-Prot;Acc:Q9N587])

HSP 1 Score: 232.261 bits (591), Expect = 4.308e-68
Identity = 126/359 (35.10%), Postives = 197/359 (54.87%), Query Frame = 3
Query:  159 ELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNN------------------------ESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCIN 1163
             L + ++ DY+K  RPV +N  T++            V F L+L  +LD++E  Q++TT+V L + W D  L WDP EY  +E +++PS  IW+PD+ LYN AD   +      AK++ +GTVEW P AIYKS C +++++FPFD Q C +KFG WTY G  V++   +                         +  +DLS   PS EW IL         RYPCC+ P+ DI++ + +RR  +FYT  LI P   +S LT ++F++P +   K+ L ++I ++  +  LLL +  PS S   PLIG Y    M ++TLS  ++ + +N+H+R      +P W+K+L  ++  K+L + 
Sbjct:   29 RLFEDLIADYNKLVRPVSENGETLV------------VTFKLKLSQLLDVHEKNQIMTTNVWLQHSWMDYKLRWDPVEYGGVEVLYVPSDTIWLPDVVLYNNADGNYQVTIMTKAKLTYNGTVEWAPPAIYKSMCQIDVEFFPFDRQQCEMKFGSWTYGGLEVDLQHRDKHLEKEIEEDVEGVDGPTKEIVWVVDRGIDLSDYYPSVEWDILNVPGKRHSKRYPCCESPFIDITYEIHLRRKTLFYTVNLIFPSVGISFLTALVFYLPSDGGEKISLCISILISLTVFFLLLVEIIPSTSLVIPLIGKYLLFTMVLVTLSVVVTVVTLNVHYRSPTTHTMPKWMKRLFVDFLPKYLLMT 375          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Celegans
Match: unc-38 (Acetylcholine receptor subunit alpha-type unc-38 [Source:UniProtKB/Swiss-Prot;Acc:Q23022])

HSP 1 Score: 224.172 bits (570), Expect = 5.409e-65
Identity = 125/363 (34.44%), Postives = 189/363 (52.07%), Query Frame = 3
Query:  138 ESGWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYD----------------------GFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCC--DEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFL 1154
            E     K L   ++ +Y++  RP          T  N   + +T++  LRL  I+D++E++Q++T SV L   W D  L WDP  Y  +  +++P  +IW+PDI LYN AD          A +   G V W+P AI+KS C +++++FPFD Q C LKFG WT+                       G   N+T    E  +DLS   PS EW I+   A      YP C     Y D+++Y+++RR P+FYT  L+ PC  +S LT+++F++P +S  K+ L ++I VA  +  LLL +  P+ S   PLIG Y    M ++TLS  ++ I +NLHFR      +P W+KK+   +  K L
Sbjct:   22 EGNEDAKRLYDDLMVNYNRHRRP---------STSPN---KPLTIKLKLRLSQIIDVHEIDQIMTCSVWLKQTWIDRKLSWDPVNYGGVNVLYVPYEMIWVPDIVLYNNADSNYNITISTKATLHYTGEVTWEPPAIFKSMCQIDVRWFPFDEQQCHLKFGSWTFSENLLSVELNEPSLRYEEEIDEKGIIDNVTV--AEDGIDLSDYYPSVEWDIMSRVAKRRAKNYPSCCPQSAYIDVTYYLQLRRKPLFYTVNLVFPCVGISFLTILVFYLPSDSGEKVTLCISILVALTIFFLLLTEIIPATSITLPLIGKYLLFTMVMVTLSVVVTVISLNLHFRTPTTHLMPNWVKKVFLKWLPKLL 370          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Celegans
Match: acr-21 (pep chromosome:WBcel235:III:6583461:6586549:1 gene:WBGene00000060.1 transcript:F27B3.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:acr-21)

HSP 1 Score: 218.394 bits (555), Expect = 4.941e-62
Identity = 113/332 (34.04%), Postives = 183/332 (55.12%), Query Frame = 3
Query:  174 ILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADER-LEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINL 1166
            +L DY+   RP        + +K     + I V F   L  I+D++E  Q+LTT+  +   W D  L WDP  Y+N+  + IPS  IW PDI LYN AD + ++        +   G + W   AI+ S+C +++K++PFD QTC LK+  W YDG ++++   + +   DL++ + + EW+++   A   +V Y CC EPYP I  +V I R  MFY + LILPC L+S + L+ F+MP +S  K+ LG+   ++  + L+++ +  P  +   PLIG Y+ V + ++ L T ++   VN+H  G +   VP +L+   F Y  K L + +
Sbjct:    7 LLYDYNNEVRPS-------VHSK-----EPINVTFVFSLTQIIDVDERNQILTTNSWIRLHWVDYKLVWDPRLYQNVTRIHIPSDKIWKPDIILYNNADAQYMKSVMSTDVIVDYLGNIHWPLSAIFTSSCPLDVKHYPFDRQTCILKYASWAYDGTKIDLLLKSEQG--DLTNYITNTEWSLIGIRAEKNQVIYSCCPEPYPFIDVHVTIERRAMFYVFNLILPCVLISLIALMGFYMPTDSGEKVTLGITSLLSTTVFLMMVAEGMPPTAEALPLIGIYFGVTIMLVALGTAMTVFTVNIHHTGVHGYPVPPFLQIFAFRYLSKILFVRI 324          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Celegans
Match: acr-21 (pep chromosome:WBcel235:III:6581927:6586549:1 gene:WBGene00000060.1 transcript:F27B3.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:acr-21)

HSP 1 Score: 219.164 bits (557), Expect = 5.103e-62
Identity = 123/382 (32.20%), Postives = 199/382 (52.09%), Query Frame = 3
Query:   24 MCWIYRMSLFLTILIQGCFEAENLIAEDSEGSNSEVHLESGWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADER-LEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINL 1166
            +  IY +SLFL                 + G N E+   +      L + +L DY+   RP        + +K     + I V F   L  I+D++E  Q+LTT+  +   W D  L WDP  Y+N+  + IPS  IW PDI LYN AD + ++        +   G + W   AI+ S+C +++K++PFD QTC LK+  W YDG ++++   + +   DL++ + + EW+++   A   +V Y CC EPYP I  +V I R  MFY + LILPC L+S + L+ F+MP +S  K+ LG+   ++  + L+++ +  P  +   PLIG Y+ V + ++ L T ++   VN+H  G +   VP +L+   F Y  K L + +
Sbjct:    2 LTAIYNISLFL-------------FFNGAHGGN-ELSSRADQNVMRLYRDLLYDYNNEVRPS-------VHSK-----EPINVTFVFSLTQIIDVDERNQILTTNSWIRLHWVDYKLVWDPRLYQNVTRIHIPSDKIWKPDIILYNNADAQYMKSVMSTDVIVDYLGNIHWPLSAIFTSSCPLDVKHYPFDRQTCILKYASWAYDGTKIDLLLKSEQG--DLTNYITNTEWSLIGIRAEKNQVIYSCCPEPYPFIDVHVTIERRAMFYVFNLILPCVLISLIALMGFYMPTDSGEKVTLGITSLLSTTVFLMMVAEGMPPTAEALPLIGIYFGVTIMLVALGTAMTVFTVNIHHTGVHGYPVPPFLQIFAFRYLSKILFVRI 355          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Celegans
Match: acr-21 (pep chromosome:WBcel235:III:6583461:6586549:1 gene:WBGene00000060.1 transcript:F27B3.2d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:acr-21)

HSP 1 Score: 218.009 bits (554), Expect = 5.722e-62
Identity = 113/332 (34.04%), Postives = 183/332 (55.12%), Query Frame = 3
Query:  174 ILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADER-LEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINL 1166
            +L DY+   RP        + +K     + I V F   L  I+D++E  Q+LTT+  +   W D  L WDP  Y+N+  + IPS  IW PDI LYN AD + ++        +   G + W   AI+ S+C +++K++PFD QTC LK+  W YDG ++++   + +   DL++ + + EW+++   A   +V Y CC EPYP I  +V I R  MFY + LILPC L+S + L+ F+MP +S  K+ LG+   ++  + L+++ +  P  +   PLIG Y+ V + ++ L T ++   VN+H  G +   VP +L+   F Y  K L + +
Sbjct:    7 LLYDYNNEVRPS-------VHSK-----EPINVTFVFSLTQIIDVDERNQILTTNSWIRLHWVDYKLVWDPRLYQNVTRIHIPSDKIWKPDIILYNNADAQYMKSVMSTDVIVDYLGNIHWPLSAIFTSSCPLDVKHYPFDRQTCILKYASWAYDGTKIDLLLKSEQG--DLTNYITNTEWSLIGIRAEKNQVIYSCCPEPYPFIDVHVTIERRAMFYVFNLILPCVLISLIALMGFYMPTDSGEKVTLGITSLLSTTVFLMMVAEGMPPTAEALPLIGIYFGVTIMLVALGTAMTVFTVNIHHTGVHGYPVPPFLQIFAFRYLSKILFVRI 324          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084639)

HSP 1 Score: 249.595 bits (636), Expect = 1.493e-73
Identity = 127/349 (36.39%), Postives = 201/349 (57.59%), Query Frame = 3
Query:  156 KELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNN--------ESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNI 1178
            K L   +L +Y++  RPV +N  TV+            V+ GLRL  ++DLN  +Q+LTT+V L + W+D   +WDP+EY  +  +++PS  IW+PDI LYN AD          A +   G V W P AI+KS+C ++++YFPFD QTC++KFG WTYDG ++++   +         E  +DL    PS EW IL   A   E  YPCC EPYPDI F + +RR  +FYT  LI+PC  +S L++++F++P +S  K+ L ++I ++  +  LL+ +  PS S   PL+G Y    M ++ LS  ++ I++N+H+R  +  ++  W++        K L + +  ++
Sbjct:   46 KRLYDDLLSNYNRLIRPVSNNTDTVL------------VKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDL 382          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084640)

HSP 1 Score: 249.595 bits (636), Expect = 1.493e-73
Identity = 127/349 (36.39%), Postives = 201/349 (57.59%), Query Frame = 3
Query:  156 KELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNN--------ESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNI 1178
            K L   +L +Y++  RPV +N  TV+            V+ GLRL  ++DLN  +Q+LTT+V L + W+D   +WDP+EY  +  +++PS  IW+PDI LYN AD          A +   G V W P AI+KS+C ++++YFPFD QTC++KFG WTYDG ++++   +         E  +DL    PS EW IL   A   E  YPCC EPYPDI F + +RR  +FYT  LI+PC  +S L++++F++P +S  K+ L ++I ++  +  LL+ +  PS S   PL+G Y    M ++ LS  ++ I++N+H+R  +  ++  W++        K L + +  ++
Sbjct:   46 KRLYDDLLSNYNRLIRPVSNNTDTVL------------VKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDL 382          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Fly
Match: nAChRalpha4 (gene:FBgn0266347 transcript:FBtr0332872)

HSP 1 Score: 243.432 bits (620), Expect = 3.590e-72
Identity = 129/343 (37.61%), Postives = 198/343 (57.73%), Query Frame = 3
Query:  156 KELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNES-------FLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCIN 1163
            K L   +L +Y+K  RPV  N T V++           V   L+L  ++D+N   Q++TT++ +   W D  L W+P EY  +  + +PS  IW PDI LYN AD   E      A I S+G VEW+P AIYKS+C ++++YFPFD QTC LKFG WTYDGF+V++   + +         +DLS    S EW IL+  A   E  Y CCDEPY DI+F + +RR  +FYT  +I+PC  +S LT++ F++P +S  K+ L ++I ++  +  LL+ +  P  S   PL+G Y    M ++++S  ++ +V+N+HFR     ++  W+K++  ++   FL I 
Sbjct:   13 KRLYDDLLSNYNKLVRPVV-NTTDVLK-----------VCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATIYSEGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQQGSNVVAVGVDLSEFYMSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVKRVFIDFLPAFLFIK 343          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Fly
Match: nAChRalpha4 (gene:FBgn0266347 transcript:FBtr0300118)

HSP 1 Score: 244.202 bits (622), Expect = 5.175e-72
Identity = 129/343 (37.61%), Postives = 198/343 (57.73%), Query Frame = 3
Query:  156 KELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNES-------FLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCIN 1163
            K L   +L +Y+K  RPV  N T V++           V   L+L  ++D+N   Q++TT++ +   W D  L W+P EY  +  + +PS  IW PDI LYN AD   E      A I S+G VEW+P AIYKS+C ++++YFPFD QTC LKFG WTYDGF+V++   + +         +DLS    S EW IL+  A   E  Y CCDEPY DI+F + +RR  +FYT  +I+PC  +S LT++ F++P +S  K+ L ++I ++  +  LL+ +  P  S   PL+G Y    M ++++S  ++ +V+N+HFR     ++  W+K++  ++   FL I 
Sbjct:   13 KRLYDDLLSNYNKLVRPVV-NTTDVLK-----------VCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATIYSEGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQQGSNVVAVGVDLSEFYMSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVKRVFIDFLPAFLFIK 343          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Fly
Match: nAChRalpha4 (gene:FBgn0266347 transcript:FBtr0346707)

HSP 1 Score: 237.654 bits (605), Expect = 1.600e-69
Identity = 124/343 (36.15%), Postives = 197/343 (57.43%), Query Frame = 3
Query:  156 KELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNES-------FLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCIN 1163
            K L   +L +Y+K  RPV  N T V++           V   L+L  ++D+N   Q++TT++ +   W D  L W+P EY  +  + +PS  IW PDI LYN AD   E      A + ++G V WQP A+YKS+C ++++YFP+D+QTC LK G WTYDGF+V++   + +         +DLS    S EW IL+  A   E  Y CCDEPY DI+F + +RR  +FYT  +I+PC  +S LT++ F++P +S  K+ L ++I ++  +  LL+ +  P  S   PL+G Y    M ++++S  ++ +V+N+HFR     ++  W+K++  ++   FL I 
Sbjct:   13 KRLYDDLLSNYNKLVRPVV-NTTDVLK-----------VCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNADGHYEVTLMTKAIVYNNGLVIWQPPAVYKSSCSIDVEYFPYDVQTCILKLGSWTYDGFKVDLRHMDEQQGSNVVAVGVDLSEFYMSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVKRVFIDFLPAFLFIK 343          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Zebrafish
Match: chrna4b (cholinergic receptor, nicotinic, alpha 4b [Source:ZFIN;Acc:ZDB-GENE-090505-3])

HSP 1 Score: 240.736 bits (613), Expect = 8.481e-70
Identity = 129/358 (36.03%), Postives = 205/358 (57.26%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCI---------NLGSNIKMKNEET 1199
            E+ L+Q +  +Y+K SRPV  N++ V+            V FGL +  ++D++E  Q++TT+V +   W D  L W+P EYEN+  + IPS +IW PDI LYN AD          A++  +G ++W+P AIYKS+C +++ +FPFD Q C +KFG WTYD  R  I   +  S +D      S EW I+ +   +   +Y CC E YPDI++   IRR P+FYT  LI+PC L+S LT+++F++P E   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R      +P+W+++L  +   ++L +         N G  I+M +++ 
Sbjct:   31 EERLLQSLFINYNKLSRPV-ANISDVV-----------LVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWNDYKLRWNPEEYENVTSIRIPSEIIWRPDIVLYNNADGDFAVTHLTKAQVFYNGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYD--RAKIDLISMASDVDQMDYWESGEWVIINAVGTYNIKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECAEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSSRTHSMPHWVRQLFLHLVPRYLFMKRPPASGKRNCGKLIEMMHKQA 374          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Zebrafish
Match: FO907089.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101882451])

HSP 1 Score: 237.654 bits (605), Expect = 2.465e-69
Identity = 112/337 (33.23%), Postives = 195/337 (57.86%), Query Frame = 3
Query:  144 GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFL 1154
            G  ++ L + ++++Y+   RPV+++               +TV F   L+ I+D++E  QVLTT++ L   W D +L W+ ++Y  +  V  P  LIW PDI LYN ADER +        ++S G  ++ P  I+KSTC++++++FPFD+Q C LKFG WTY G+ +++   N     D++  + + EW +++      E  Y CC EPYPD++F V +RR  ++Y   L++PC L+S+L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ LS   + +V+  H+   +  ++P W + L+ N+   FL
Sbjct:   54 GEHQRRLYRDLMKNYNPLERPVYNDS------------HSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWTDYYLRWNMSDYPGVNTVRFPDSLIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWALDLQMINA----DITGYIANGEWDLVEVPGRRNEKFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVLVLQYHYHDPDGAKMPKWTRVLLLNWCAWFL 374          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Zebrafish
Match: chrna7 (cholinergic receptor, nicotinic, alpha 7 (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-3])

HSP 1 Score: 236.113 bits (601), Expect = 4.081e-69
Identity = 118/366 (32.24%), Postives = 205/366 (56.01%), Query Frame = 3
Query:  144 GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPT-ENSPVKSSI 1238
            G  ++ L + +++DY+   RPVF++               +TV F + L+ I+D++E  QVLTT++ L   W D +L+W+ +EY  +  V  P   IW PDI LYN ADER +        ++S G  ++ P  I+KSTC++++++FPFD+Q C LKFG WTY G+ +++   +     D++  + + EW +++      E  Y CC EPYPD++F V +RR  ++Y   L++PC L+S+L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ LS   +  V+  H+      ++P W + ++ N+   FL       +K   E+ + P   N   +SS+
Sbjct:   24 GEHQRRLYRDLMKDYNPLERPVFNDT------------HSLTVYFSMSLMQIMDVDEKNQVLTTNIWLQLYWYDYYLQWNASEYPGVTNVRFPDSQIWKPDILLYNSADERFDATFHTNVLVNSSGACQYLPPGIFKSTCYIDVRWFPFDLQRCDLKFGSWTYGGWSLDLQMIDA----DITGYIANGEWDLVEVPGRRNERFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPEGGKMPKWTRVVLLNWCAWFL------RMKRPGEDKVRPACHNKQPRSSL 367          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Zebrafish
Match: chrna7 (cholinergic receptor, nicotinic, alpha 7 (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-3])

HSP 1 Score: 234.958 bits (598), Expect = 9.972e-69
Identity = 118/366 (32.24%), Postives = 205/366 (56.01%), Query Frame = 3
Query:  144 GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPT-ENSPVKSSI 1238
            G  ++ L + +++DY+   RPVF++               +TV F + L+ I+D++E  QVLTT++ L   W D +L+W+ +EY  +  V  P   IW PDI LYN ADER +        ++S G  ++ P  I+KSTC++++++FPFD+Q C LKFG WTY G+ +++   +     D++  + + EW +++      E  Y CC EPYPD++F V +RR  ++Y   L++PC L+S+L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ LS   +  V+  H+      ++P W + ++ N+   FL       +K   E+ + P   N   +SS+
Sbjct:   23 GEHQRRLYRDLMKDYNPLERPVFNDT------------HSLTVYFSMSLMQIMDVDEKNQVLTTNIWLQLYWYDYYLQWNASEYPGVTNVRFPDSQIWKPDILLYNSADERFDATFHTNVLVNSSGACQYLPPGIFKSTCYIDVRWFPFDLQRCDLKFGSWTYGGWSLDLQMIDA----DITGYIANGEWDLVEVPGRRNERFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPEGGKMPKWTRVVLLNWCAWFL------RMKRPGEDKVRPACHNKQPRSSL 366          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Zebrafish
Match: si:ch211-39a7.1 (si:ch211-39a7.1 [Source:ZFIN;Acc:ZDB-GENE-060503-606])

HSP 1 Score: 236.498 bits (602), Expect = 1.617e-68
Identity = 116/337 (34.42%), Postives = 199/337 (59.05%), Query Frame = 3
Query:  144 GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFL 1154
            G  ++ L++ +L+DY++  RPV ++             Q +TV   + LI I+D++E  QVLTT++ L   W D +L+W+ +EY  ++ +   +  +W PDI LYN AD++ +        ++S G   + P  I+ STC V++++FPFDIQ C LKFG WT+DG+ +++    NE+  D+S  +P+ EW ++       E+ Y CC EPYPD++F V IRR  ++Y   L++PC LLSS+TL++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLIG Y+   M I+ +S   + +V+  H    N   +P W++ ++  +   FL
Sbjct:   22 GPYQRTLLKNLLKDYNRMERPVANDS------------QPLTVFLSMSLIQIMDVDEKNQVLTTNIWLNMHWYDHYLQWNQSEYPGVKNLRFTTDQVWTPDILLYNSADDKFDSTFKSNVVVNSSGYCNYLPPGIFMSTCNVDVRWFPFDIQKCELKFGSWTFDGWLLDLQM--NEA--DISGYMPNGEWDLVGVPGTRNELFYDCCKEPYPDVTFVVTIRRRTLYYALNLLIPCVLLSSMTLLIFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSIPLIGQYFASIMIIVGMSVIATVVVLQYHHHDPNGGNMPKWVQLVLLQWVAWFL 342          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 234.572 bits (597), Expect = 1.104e-68
Identity = 121/334 (36.23%), Postives = 197/334 (58.98%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFL 1154
            E+ L + +   Y++ SRPV +    VI            V+FGL +  ++D++E  Q++TT+V L   W D  L W+P +Y+N+  + +PS +IWIPDI LYN AD          A +  +G V+W P AIYKS+C +++ +FPFD Q+C +KFG WTYD   +++   + E  +DL     S EW I+ +   +   +Y CC E YPDI++Y  IRR P+FYT  LI+PC L+S LT+++F++P +   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R  +  ++P W++ +  ++  ++L
Sbjct:   32 EERLFKRLFTGYNRWSRPVPNTSDVVI------------VKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDLE--SMERNVDLKDYWESGEWAIVNAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPLWVRSVFLDHIPRWL 351          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 234.572 bits (597), Expect = 1.717e-68
Identity = 121/334 (36.23%), Postives = 197/334 (58.98%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFL 1154
            E+ L + +   Y++ SRPV +    VI            V+FGL +  ++D++E  Q++TT+V L   W D  L W+P +Y+N+  + +PS +IWIPDI LYN AD          A +  +G V+W P AIYKS+C +++ +FPFD Q+C +KFG WTYD   +++   + E  +DL     S EW I+ +   +   +Y CC E YPDI++Y  IRR P+FYT  LI+PC L+S LT+++F++P +   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R  +  ++P W++ +  ++  ++L
Sbjct:   32 EERLFKRLFTGYNRWSRPVPNTSDVVI------------VKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDLE--SMERNVDLKDYWESGEWAIVNAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPLWVRSVFLDHIPRWL 351          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 230.72 bits (587), Expect = 1.640e-67
Identity = 113/334 (33.83%), Postives = 193/334 (57.78%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFL 1154
            E++L Q +L  Y++  RPV             +V   + V F + +  +++++E+ Q+L T++ L + W D  L+W+P EY+ IEF+ IP+  IW PDI LYN A    +      A +  +G + W P AI+KS+C ++I +FPFD Q C +KFG W+YD  ++++    ++  +D+     + EW I+ +     +++Y CC+E Y DI++   IRR PMFYT  LI+PC  LS LT+++F++P +   K+ L +++ ++  + LL++ +T PS S   PL+G Y    M  +TLS  ++  V+N+H+R     ++P W+K +      K L
Sbjct:   27 EEKLFQKLLARYNQHIRPV------------ENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYNNAVGDFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSWSYDKAKIDLAIIGSK--VDMKDFWENSEWEIVDASGFKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHKMPMWVKDVFLKRLPKLL 346          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 230.335 bits (586), Expect = 1.929e-67
Identity = 113/334 (33.83%), Postives = 193/334 (57.78%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFL 1154
            E++L Q +L  Y++  RPV             +V   + V F + +  +++++E+ Q+L T++ L + W D  L+W+P EY+ IEF+ IP+  IW PDI LYN A    +      A +  +G + W P AI+KS+C ++I +FPFD Q C +KFG W+YD  ++++    ++  +D+     + EW I+ +     +++Y CC+E Y DI++   IRR PMFYT  LI+PC  LS LT+++F++P +   K+ L +++ ++  + LL++ +T PS S   PL+G Y    M  +TLS  ++  V+N+H+R     ++P W+K +      K L
Sbjct:   16 EEKLFQKLLARYNQHIRPV------------ENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYNNAVGDFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSWSYDKAKIDLAIIGSK--VDMKDFWENSEWEIVDASGFKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHKMPMWVKDVFLKRLPKLL 335          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Xenopus
Match: ncaph (non-SMC condensin I complex subunit H [Source:Xenbase;Acc:XB-GENE-5738397])

HSP 1 Score: 229.95 bits (585), Expect = 3.052e-67
Identity = 113/334 (33.83%), Postives = 193/334 (57.78%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFL 1154
            E++L Q +L  Y++  RPV             +V   + V F + +  +++++E+ Q+L T++ L + W D  L+W+P EY+ IEF+ IP+  IW PDI LYN A    +      A +  +G + W P AI+KS+C ++I +FPFD Q C +KFG W+YD  ++++    ++  +D+     + EW I+ +     +++Y CC+E Y DI++   IRR PMFYT  LI+PC  LS LT+++F++P +   K+ L +++ ++  + LL++ +T PS S   PL+G Y    M  +TLS  ++  V+N+H+R     ++P W+K +      K L
Sbjct:   21 EEKLFQKLLARYNQHIRPV------------ENVSDPVMVHFEVAITQLVNVDEVNQILETNLWLRHIWNDYKLQWNPKEYDGIEFMRIPADKIWKPDIVLYNNAVGDFQVEGKSKALVKYNGLITWSPPAIFKSSCPMDITFFPFDHQNCSMKFGSWSYDKAKIDLAIIGSK--VDMKDFWENSEWEIVDASGFKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIMPCLFLSFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHKMPMWVKDVFLKRLPKLL 340          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 235.343 bits (599), Expect = 8.147e-69
Identity = 124/338 (36.69%), Postives = 191/338 (56.51%), Query Frame = 3
Query:  150 KEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCIN 1163
             E  L + +   Y++ +RPV +    VI            V FGL +  ++D++E  Q++TT+V L   W D  L WDP E+ NI  + +PS +IWIPDI LYN AD          A +   GTV W P AIYKS+C +++ +FPFD Q C +KFG WTYD  ++++     E  +DL     S EW I+ +   +   +Y CC E YPD+++Y  IRR P+FYT  LI+PC L+S LT+++F++P E   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R  +   +P W++  +     ++L +N
Sbjct:   35 AEDRLFKHLFGGYNRWARPVPNTSDVVI------------VRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE--QMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMN 358          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 235.343 bits (599), Expect = 8.147e-69
Identity = 124/338 (36.69%), Postives = 191/338 (56.51%), Query Frame = 3
Query:  150 KEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCIN 1163
             E  L + +   Y++ +RPV +    VI            V FGL +  ++D++E  Q++TT+V L   W D  L WDP E+ NI  + +PS +IWIPDI LYN AD          A +   GTV W P AIYKS+C +++ +FPFD Q C +KFG WTYD  ++++     E  +DL     S EW I+ +   +   +Y CC E YPD+++Y  IRR P+FYT  LI+PC L+S LT+++F++P E   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R  +   +P W++  +     ++L +N
Sbjct:   35 AEDRLFKHLFGGYNRWARPVPNTSDVVI------------VRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE--QMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALLGRVPRWLMMN 358          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Mouse
Match: Chrna4 (cholinergic receptor, nicotinic, alpha polypeptide 4 [Source:MGI Symbol;Acc:MGI:87888])

HSP 1 Score: 238.039 bits (606), Expect = 1.029e-68
Identity = 129/351 (36.75%), Postives = 199/351 (56.70%), Query Frame = 3
Query:  132 HLES-GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIK 1181
            H+E+    E+ L++ +   Y+K SRPV  N++ V+            V FGL +  ++D++E  Q++TT+V +   W D  L WDP +YEN+  + IPS LIW PDI LYN AD          A +  DG V+W P AIYKS+C +++ +FPFD Q C +KFG WTYD  +  I   +  S +D      S EW I+ +   +   +Y CC E YPDI++   IRR P+FYT  LI+PC L+S LT+++F++P E   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R      +P W++++  +   + L +   S +K
Sbjct:   31 HIETRAHAEERLLKRLFSGYNKWSRPV-ANISDVV-----------LVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYD--KAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKRPSVVK 367          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 233.417 bits (594), Expect = 1.532e-68
Identity = 112/328 (34.15%), Postives = 192/328 (58.54%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFN 1136
            E  L Q++ +DY++  RPV             +V   + ++F + +  ++ ++E+ Q++ T++ L   W D  L+W P++Y+ +EF+ +P+  IW PDI LYN AD   +      A +   G V W P AI+KS+C +++ YFPFD Q C +KFG W+YD  ++++      S ++L     S EW I+++     E++Y CC+E Y DI++ + IRR P+FYT  LI+PC L+S LT+++F++P +   K+ L +++ ++  + LL++ +T PS S   PLIG Y    M  +TLS  ++  V+N+H+R      +P W+K +  N
Sbjct:   29 EHRLFQYLFEDYNEIIRPV------------ANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG--SSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLN 342          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Mouse
Match: Chrna4 (cholinergic receptor, nicotinic, alpha polypeptide 4 [Source:MGI Symbol;Acc:MGI:87888])

HSP 1 Score: 237.654 bits (605), Expect = 1.868e-68
Identity = 129/351 (36.75%), Postives = 199/351 (56.70%), Query Frame = 3
Query:  132 HLES-GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIK 1181
            H+E+    E+ L++ +   Y+K SRPV  N++ V+            V FGL +  ++D++E  Q++TT+V +   W D  L WDP +YEN+  + IPS LIW PDI LYN AD          A +  DG V+W P AIYKS+C +++ +FPFD Q C +KFG WTYD  +  I   +  S +D      S EW I+ +   +   +Y CC E YPDI++   IRR P+FYT  LI+PC L+S LT+++F++P E   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R      +P W++++  +   + L +   S +K
Sbjct:   31 HIETRAHAEERLLKRLFSGYNKWSRPV-ANISDVV-----------LVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYD--KAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKRPSVVK 367          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. UniProt/SwissProt
Match: sp|P23414|ACH1_SCHGR (Acetylcholine receptor subunit alpha-L1 OS=Schistocerca gregaria OX=7010 PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 2.481e-73
Identity = 128/344 (37.21%), Postives = 199/344 (57.85%), Query Frame = 3
Query:  156 KELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNN-------ESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINL 1166
            K L   +L +Y++  RPV +N  TV+            V+ GLRL  ++DLN  +Q+LTT+V L + W+D    WDP EY  +  +++PS  IW+PDI LYN AD          A +   G V W P AI+KS+C ++++YFPFD QTC++KFG WTYDG ++++   N        +  +DL    PS EW IL   A   E  YPCC EPYPDI F + +RR  +FYT  LI+PC  +S L++++F++P +S  K+ L ++I ++  +  LL+ +  PS S   PL+G Y    M ++ LS  ++ +V+N+H+R  +  ++  W++K+      K L + +
Sbjct:   28 KRLYDDLLSNYNRLIRPVSNNTDTVL------------VKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFRWDPAEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAVLHHTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHINQKYDDNKVKVGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIVPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMVLVGLSVVITIMVLNVHYRKPSTHKMAPWVRKVFIRRLPKLLLMRV 359          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. UniProt/SwissProt
Match: sp|P17644|ACH2_DROME (Acetylcholine receptor subunit alpha-like 2 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha2 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.496e-72
Identity = 127/349 (36.39%), Postives = 201/349 (57.59%), Query Frame = 3
Query:  156 KELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNN--------ESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNI 1178
            K L   +L +Y++  RPV +N  TV+            V+ GLRL  ++DLN  +Q+LTT+V L + W+D   +WDP+EY  +  +++PS  IW+PDI LYN AD          A +   G V W P AI+KS+C ++++YFPFD QTC++KFG WTYDG ++++   +         E  +DL    PS EW IL   A   E  YPCC EPYPDI F + +RR  +FYT  LI+PC  +S L++++F++P +S  K+ L ++I ++  +  LL+ +  PS S   PL+G Y    M ++ LS  ++ I++N+H+R  +  ++  W++        K L + +  ++
Sbjct:   46 KRLYDDLLSNYNRLIRPVSNNTDTVL------------VKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDL 382          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. UniProt/SwissProt
Match: sp|P09480|ACHA2_CHICK (Neuronal acetylcholine receptor subunit alpha-2 OS=Gallus gallus OX=9031 GN=CHRNA2 PE=2 SV=1)

HSP 1 Score: 246.514 bits (628), Expect = 6.656e-72
Identity = 131/370 (35.41%), Postives = 206/370 (55.68%), Query Frame = 3
Query:  111 EGSNSEVHLESGWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENS 1220
            + +  E     G+ E  L + +   Y++ SRPV +    VI            V+FGL +  ++D++E  Q++TT+V L   W D  L W+P +++N+  + +PS +IWIPDI LYN AD          A + S+G V+W P AIYKS+C +++ YFPFD Q C +KFG WTYD  ++++   N E  +DL     S EW I+ +   +   +Y CC E YPDI+FY  IRR P+FYT  LI+PC L+S LT+++F++P +   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R  +   +P+W++     +  ++L         MK    L P E +
Sbjct:   20 QAATREQKQPHGFAEDRLFKHLFTGYNRWSRPVPNTSDVVI------------VKFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPEDFDNVTSIRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSNGKVKWVPPAIYKSSCSIDVTYFPFDQQNCKMKFGSWTYDKAKIDLE--NMEHHVDLKDYWESGEWAIINAIGRYNSKKYDCCTEIYPDITFYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPSTHTMPHWVRSFFLGFIPRWLF--------MKRPPLLLPAEGT 367          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. UniProt/SwissProt
Match: sp|P09482|ACHA4_CHICK (Neuronal acetylcholine receptor subunit alpha-4 OS=Gallus gallus OX=9031 GN=CHRNA4 PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 5.893e-70
Identity = 134/368 (36.41%), Postives = 209/368 (56.79%), Query Frame = 3
Query:  132 HLES-GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIK---MKNEETLFPTENSP 1223
            H+E+    E+ L++ +   Y+K SRPV  N++ V+            V FGL +  ++D++E  Q++TT+V +   W D  L WDP EYEN+  + IPS LIW PDI LYN AD          A +  DG ++W P AIYKS+C +++ +FPFD Q C +KFG WTYD  ++++   +  S +D      S EW I+ +  N+   +Y CC E YPDI++   IRR P+FYT  LI+PC L+S LT+++F++P E   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R      +P W++++  +   + L +   S +K    K  E++    NSP
Sbjct:   24 HVETRAHAEERLLKKLFSGYNKWSRPV-ANISDVV-----------LVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPQEYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRIKWMPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLV--SMHSHVDQLDYWESGEWVIINAVGNYNSKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPRTHTMPDWVRRVFLDIVPRLLFMKRPSTVKDNCKKLIESMHKLTNSP 377          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. UniProt/SwissProt
Match: sp|P22770|ACHA7_CHICK (Neuronal acetylcholine receptor subunit alpha-7 OS=Gallus gallus OX=9031 GN=CHRNA7 PE=1 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 6.562e-69
Identity = 116/334 (34.73%), Postives = 197/334 (58.98%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFL 1154
            +++L + +L++Y+   RPV ++             Q +TV F L L+ I+D++E  QVLTT++ L   W D +L+W+ +EY  ++ V  P  LIW PDI LYN ADER +        ++S G  ++ P  I+KS+C++++++FPFD+Q C LKFG WTY G+ +++         D+S  + + EW ++      TE  Y CC EPYPDI+F V +RR  ++Y   L++PC L+S+L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ LS  ++ IV+  H    +  ++P W + ++ N+   FL
Sbjct:   26 QRKLYKELLKNYNPLERPVANDS------------QPLTVYFTLSLMQIMDVDEKNQVLTTNIWLQMYWTDHYLQWNVSEYPGVKNVRFPDGLIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQKCNLKFGSWTYGGWSLDLQMQEA----DISGYISNGEWDLVGIPGKRTESFYECCKEPYPDITFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFL 343          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. TrEMBL
Match: A0A1I8H1Z4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 475.707 bits (1223), Expect = 6.138e-158
Identity = 229/349 (65.62%), Postives = 268/349 (76.79%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFD-----NVTTVIRTKDNDV------IQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINL 1166
            EK LI+ +LQ YDK+SRPV D         + R K+         IQQ+TVEFGLRL+ ILDL+EMEQVLTTS+  LY W D HL W+P + + I FV IP+  IW+PDIALYNYADERLEERR  AAK+   G VEW PMAIYKS C + IK+FPFD Q CWLKFGPWTYDG+RVNI++Y+N +  DL  ++ SPEWTIL   A + E  YPCC EPY DI+F++ IRRS  FYT+ILILPCFLLSSLTLVLFW+PPE+PAKMVLGMNIFVAFFL++LLL+  TPSAS +FPLIG YYC+NMGIITLSTFLS IVVN HFRGDNRQEVPYWLKKL   +  + L +NL
Sbjct:   38 EKNLIKQLLQHYDKKSRPVIDADPPYGTPKIERRKEKHANSSTIPIQQVTVEFGLRLVQILDLDEMEQVLTTSMISLYEWTDYHLRWEPEDEDGIMFVHIPTKDIWLPDIALYNYADERLEERRDVAAKVHYTGLVEWHPMAIYKSACEIKIKFFPFDKQVCWLKFGPWTYDGWRVNISYYHNMTKFDLEEMIDSPEWTILSHKAKYNEEVYPCCPEPYVDITFWIWIRRSTAFYTFILILPCFLLSSLTLVLFWLPPETPAKMVLGMNIFVAFFLLMLLLEKQTPSASDSFPLIGQYYCLNMGIITLSTFLSVIVVNFHFRGDNRQEVPYWLKKLAIQHGSRLLFVNL 386          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. TrEMBL
Match: A0A267E180 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032313g2 PE=3 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 8.312e-157
Identity = 229/349 (65.62%), Postives = 268/349 (76.79%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFD-----NVTTVIRTKDNDV------IQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINL 1166
            EK LI+ +LQ YDK+SRPV D         + R K+         IQQ+TVEFGLRL+ ILDL+EMEQVLTTS+  LY W D HL W+P + + I FV IP+  IW+PDIALYNYADERLEERR  AAK+   G VEW PMAIYKS C + IK+FPFD Q CWLKFGPWTYDG+RVNI++Y+N +  DL  ++ SPEWTIL   A + E  YPCC EPY DI+F++ IRRS  FYT+ILILPCFLLSSLTLVLFW+PPE+PAKMVLGMNIFVAFFL++LLL+  TPSAS +FPLIG YYC+NMGIITLSTFLS IVVN HFRGDNRQEVPYWLKKL   +  + L +NL
Sbjct:   38 EKNLIKQLLQHYDKKSRPVIDADPPYGTPKIERRKEKHANSSTIPIQQVTVEFGLRLVQILDLDEMEQVLTTSMISLYEWTDYHLRWEPEDEDGIMFVHIPTKDIWLPDIALYNYADERLEERRDVAAKVHYTGLVEWHPMAIYKSACEIKIKFFPFDKQVCWLKFGPWTYDGWRVNISYYHNMTKFDLEEMIDSPEWTILSHKAKYNEEVYPCCPEPYVDITFWIWIRRSTAFYTFILILPCFLLSSLTLVLFWLPPETPAKMVLGMNIFVAFFLLMLLLEKQTPSASDSFPLIGQYYCLNMGIITLSTFLSVIVVNFHFRGDNRQEVPYWLKKLAIQHGSRLLFVNL 386          

HSP 2 Score: 72.4034 bits (176), Expect = 2.635e-9
Identity = 30/53 (56.60%), Postives = 41/53 (77.36%), Query Frame = 3
Query: 1905 SLKYIQKLQENKENVARIFSEWRSVGLVLDRIFFYCYLFTVIFSIIMYFPKTN 2063
            +L+YIQKL EN+E V ++  EWRSV LVLDR+FF  Y+ T++ SII +FPK+ 
Sbjct:  576 ALRYIQKLHENREKVNKVVQEWRSVALVLDRLFFLIYVLTIMLSIIFFFPKSG 628          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. TrEMBL
Match: A0A267F2A9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032313g1 PE=3 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 8.578e-157
Identity = 229/349 (65.62%), Postives = 268/349 (76.79%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFD-----NVTTVIRTKDNDV------IQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINL 1166
            EK LI+ +LQ YDK+SRPV D         + R K+         IQQ+TVEFGLRL+ ILDL+EMEQVLTTS+  LY W D HL W+P + + I FV IP+  IW+PDIALYNYADERLEERR  AAK+   G VEW PMAIYKS C + IK+FPFD Q CWLKFGPWTYDG+RVNI++Y+N +  DL  ++ SPEWTIL   A + E  YPCC EPY DI+F++ IRRS  FYT+ILILPCFLLSSLTLVLFW+PPE+PAKMVLGMNIFVAFFL++LLL+  TPSAS +FPLIG YYC+NMGIITLSTFLS IVVN HFRGDNRQEVPYWLKKL   +  + L +NL
Sbjct:   38 EKNLIKQLLQHYDKKSRPVIDADPPYGTPKIERRKEKHANSSTIPIQQVTVEFGLRLVQILDLDEMEQVLTTSMISLYEWTDYHLRWEPEDEDGIMFVHIPTKDIWLPDIALYNYADERLEERRDVAAKVHYTGLVEWHPMAIYKSACEIKIKFFPFDKQVCWLKFGPWTYDGWRVNISYYHNMTKFDLEEMIDSPEWTILSHKAKYNEEVYPCCPEPYVDITFWIWIRRSTAFYTFILILPCFLLSSLTLVLFWLPPETPAKMVLGMNIFVAFFLLMLLLEKQTPSASDSFPLIGQYYCLNMGIITLSTFLSVIVVNFHFRGDNRQEVPYWLKKLAIQHGSRLLFVNL 386          

HSP 2 Score: 72.4034 bits (176), Expect = 2.639e-9
Identity = 30/53 (56.60%), Postives = 41/53 (77.36%), Query Frame = 3
Query: 1905 SLKYIQKLQENKENVARIFSEWRSVGLVLDRIFFYCYLFTVIFSIIMYFPKTN 2063
            +L+YIQKL EN+E V ++  EWRSV LVLDR+FF  Y+ T++ SII +FPK+ 
Sbjct:  577 ALRYIQKLHENREKVNKVVQEWRSVALVLDRLFFLIYVLTIMLSIIFFFPKSG 629          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. TrEMBL
Match: A0A267FTB2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018759g1 PE=3 SV=1)

HSP 1 Score: 470.315 bits (1209), Expect = 1.549e-155
Identity = 228/378 (60.32%), Postives = 281/378 (74.34%), Query Frame = 3
Query:   84 AENLIAEDSEG--SNSEVHLESGWKEKELIQWILQDYDKRSRPVFDN------VTTVIRTKDNDV------IQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNN--ESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLG 1169
            A + +A+D+ G        L     EK LI+ +L +YDK+SRPV D+         + R K+         IQQ+TVEFGLRL+ ILDL+EMEQVLTTS+ +LY W D HL WDP     IE + IP+  IW+PDIALYNYADERLEERR  AAK+ S+GTVEW PMAIYKS C + I+YFPFD+QTC LKFGPWTYDG+RVNIT+Y+   +S  DL  ++PSPEW IL   A +  V YPCC EP+ DI+F + ++RS +FY++ILILPCFLLSSLTLVLFW+PPE+PAKMVLGMNIFVAFFL++LLL+  TP+AS +FP IG YYC+NMGIITLSTFL  I+VN HFRGDNRQEVP+WLKKL  ++  + LC+NL 
Sbjct:   35 AASEVADDAGGRIGTWTRPLVMNMSEKNLIKALLSEYDKKSRPVIDDDPADGGTPKIDRPKEKGKNAPTIPIQQVTVEFGLRLVQILDLDEMEQVLTTSMIVLYEWTDYHLRWDPKNESGIEVLHIPTKDIWLPDIALYNYADERLEERREVAAKVHSNGTVEWHPMAIYKSACEIRIEYFPFDVQTCDLKFGPWTYDGWRVNITYYHRTMKSAFDLDEMIPSPEWKILNYSAVYNSVVYPCCPEPFVDITFRIYMKRSTLFYSFILILPCFLLSSLTLVLFWLPPETPAKMVLGMNIFVAFFLLMLLLEKQTPAASDSFPRIGQYYCLNMGIITLSTFLCVIIVNFHFRGDNRQEVPFWLKKLAIHHGARVLCVNLA 412          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. TrEMBL
Match: A0A267GNZ6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004863g2 PE=3 SV=1)

HSP 1 Score: 472.626 bits (1215), Expect = 2.188e-154
Identity = 228/387 (58.91%), Postives = 280/387 (72.35%), Query Frame = 3
Query:   75 CFEAENLIAEDSEGSNSEVHLESGW--------KEKELIQWILQDYDKRSRPVFDN------VTTVIRTKDNDV------IQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNN--ESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLG 1169
            CF    +    SE ++        W         EK LI+ +L +YDK+SRPV D+         + R K+         IQQ+TVEFGLRL+ ILDL+EMEQVLTTS+ +LY W D HL WDP     IE + IP+  IW+PDIALYNYADERLEERR  AAK+ S+GTVEW PMAIYKS C + I+YFPFD+QTC LKFGPWTYDG+RVNIT+Y+   +S  DL  ++PSPEW IL   A +  V YPCC EP+ DI+F + ++RS +FY++ILILPCFLLSSLTLVLFW+PPE+PAKMVLGMNIFVAFFL++LLL+  TP+AS +FP IG YYC+NMGIITLSTFL  I+VN HFRGDNRQEVP+WLKKL  ++  + LC+NL 
Sbjct:   26 CFAMFTIAVAASEAADDAGGRIGTWTRPLVMNMSEKNLIKALLSEYDKKSRPVIDDDPADGGTPKIDRPKEKGKNAPTIPIQQVTVEFGLRLVQILDLDEMEQVLTTSMIVLYEWTDYHLRWDPKNESGIEVLHIPTKDIWLPDIALYNYADERLEERREVAAKVHSNGTVEWHPMAIYKSACEIRIEYFPFDVQTCDLKFGPWTYDGWRVNITYYHRTMKSAFDLDEMIPSPEWKILNYSAVYNSVVYPCCPEPFVDITFRIYMKRSTLFYSFILILPCFLLSSLTLVLFWLPPETPAKMVLGMNIFVAFFLLMLLLEKQTPAASDSFPRIGQYYCLNMGIITLSTFLCVIIVNFHFRGDNRQEVPFWLKKLAIHHGARVLCVNLA 412          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 246.128 bits (627), Expect = 4.576e-73
Identity = 125/382 (32.72%), Postives = 214/382 (56.02%), Query Frame = 3
Query:  144 GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPVKSSIGK-KTSREIPRYLNCNF 1286
            G  ++ L Q ++++Y+   RPVF++             Q +TV F   L+ I+D++E  QVLT+++ L   W D +L+W+ ++Y  +  V  P + IW PDI LYN ADER +        +S+DG+  + P  I+KSTC++++K+FPFD+Q C LKFG WTY G+ +++         D+S  + + EW +++      E  Y CC EPYPD++F V +RR  ++Y   L++PC L+S+L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ LS   +  V+  H+   +  ++P W + ++ N+   FL       +K   E+ + P  N   +SSI   + S  +P+  N N 
Sbjct:   23 GEHQRRLYQDLMKNYNPLERPVFNDS------------QSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMMEA----DISGYIANGEWDLVEVQGQRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLLNWCAWFL------RMKRPGEDRVRPCHNKQPRSSISSVELSTGVPQSTNGNM 382          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 243.047 bits (619), Expect = 5.929e-72
Identity = 125/382 (32.72%), Postives = 213/382 (55.76%), Query Frame = 3
Query:  144 GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPVKSSIGK-KTSREIPRYLNCNF 1286
            G  ++ L Q ++++Y+   RPVF++             Q +TV F   L+ I+D++E  QVLT+++ L   W D +L+W+ ++Y  +  V  P + IW PDI LYN ADER +        +S+DG+  + P  I+KSTC++++K+FPFD+Q C LKFG WTY G+ +++         D+S  + + EW ++       E  Y CC EPYPD++F V +RR  ++Y   L++PC L+S+L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ LS   +  V+  H+   +  ++P W + ++ N+   FL       +K   E+ + P  N   +SSI   + S  +P+  N N 
Sbjct:   10 GEHQRRLYQDLMKNYNPLERPVFNDS------------QSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMMEA----DISGYIANGEWDLVGK-GQRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLLNWCAWFL------RMKRPGEDRVRPCHNKQPRSSISSVELSTGVPQSTNGNM 368          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 242.276 bits (617), Expect = 6.874e-72
Identity = 122/371 (32.88%), Postives = 208/371 (56.06%), Query Frame = 3
Query:  177 LQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPVKSSIGK-KTSREIPRYLNCNF 1286
            +++Y+   RPVF++             Q +TV F   L+ I+D++E  QVLT+++ L   W D +L+W+ ++Y  +  V  P + IW PDI LYN ADER +        +S+DG+  + P  I+KSTC++++K+FPFD+Q C LKFG WTY G+ +++         D+S  + + EW +++      E  Y CC EPYPD++F V +RR  ++Y   L++PC L+S+L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ LS   +  V+  H+   +  ++P W + ++ N+   FL       +K   E+ + P  N   +SSI   + S  +P+  N N 
Sbjct:    1 MKNYNPLERPVFNDS------------QSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMMEA----DISGYIANGEWDLVEVQGQRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLLNWCAWFL------RMKRPGEDRVRPCHNKQPRSSISSVELSTGVPQSTNGNM 349          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Cavefish
Match: chrna4b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:103025036])

HSP 1 Score: 244.588 bits (623), Expect = 9.983e-72
Identity = 128/358 (35.75%), Postives = 204/358 (56.98%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPV 1226
            E+ L+Q +   Y+K SRPV  N++ V+            V FGL +  ++D++E  Q++TT+V +   W D  L W+P EYEN+  + IPS LIW PDI LYN AD          A++  DG ++W+P AIYKS+C +++ +FPFD Q C +KFG WTYD  ++++   +++  +D      S EW I+ +   +   +Y CC E YPDI++   IRR P+FYT  LI+PC L+S LT+++F++P E   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R      +P+W+++L      ++L +        +N   L    + PV
Sbjct:   28 EERLLQVLFSRYNKLSRPV-ANISDVV-----------LVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWSDYKLRWNPEEYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAQLFHDGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDRAKIDLVSMDDD--VDQMDYWESGEWVIINAVGKYNTKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECAEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSSRTHRMPHWVRQLFLQLVPRYLFMKRPPASGKRNCRKLIEMMHKPV 371          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Cavefish
Match: chrna4b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:103025036])

HSP 1 Score: 244.202 bits (622), Expect = 3.764e-71
Identity = 128/358 (35.75%), Postives = 204/358 (56.98%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPV 1226
            E+ L+Q +   Y+K SRPV  N++ V+            V FGL +  ++D++E  Q++TT+V +   W D  L W+P EYEN+  + IPS LIW PDI LYN AD          A++  DG ++W+P AIYKS+C +++ +FPFD Q C +KFG WTYD  ++++   +++  +D      S EW I+ +   +   +Y CC E YPDI++   IRR P+FYT  LI+PC L+S LT+++F++P E   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R      +P+W+++L      ++L +        +N   L    + PV
Sbjct:   31 EERLLQVLFSRYNKLSRPV-ANISDVV-----------LVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWSDYKLRWNPEEYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAQLFHDGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDRAKIDLVSMDDD--VDQMDYWESGEWVIINAVGKYNTKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECAEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSSRTHRMPHWVRQLFLQLVPRYLFMKRPPASGKRNCRKLIEMMHKPV 374          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 231.876 bits (590), Expect = 1.743e-68
Identity = 111/335 (33.13%), Postives = 192/335 (57.31%), Query Frame = 3
Query:  159 ELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCIN 1163
             L + +   Y+   RPVF+            V   + V F + +  ++ L+E+ Q++ T++ L + W D   +W+P ++E +E++ +PS  IW PDI LYN AD   +      A +  DGTV W P AI+KS+C +++ YFPFD Q C +KFG WTYD  ++++     +  ++L     S EW I+       +++Y CC++ YPDI++ V +RR P+FYT  LI+PC L+S LT+++F++P +   K+ L +++ ++  + LL++ +T PS S   PLIG Y    M  +TLS  ++  V+N+H+R      +P W++++  +   K + + 
Sbjct:   10 RLYKTLFTSYNPYIRPVFN------------VSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLVGTK--INLKDFWESGEWVIIDVPGYKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRRVFLDTLPKIMLLQ 330          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 222.246 bits (565), Expect = 2.200e-65
Identity = 121/338 (35.80%), Postives = 194/338 (57.40%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQE-VPYWLKKLVFNYAVKFLCIN 1163
            E  L++ +L+DY K  RPV          K +D ++   V+FGL +  ++D++E  Q++TT+V L   W D++L W+P +Y  I  + +P+  IW+PDI LY+ AD R E      A +  DG ++W P AIYKS+C +++ +FPFD Q C +KFG WTYDG  V++   N++  +D      + EW  L +  N   VR       YP I++   IRR P+FYT  LI+PC  LS LT+ +F++P +   K+ L  ++ V+  + LL++++  PS+S+  PLIG Y    M  +TLS  ++  V+N+H R  +    +  W+++L  +   K LC+ 
Sbjct:   35 EDRLLKRMLKDYQKWVRPV---------DKLSDTVE---VKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDLIMVNSD--VDRGEYFDNGEWEFLNATGNKG-VRLD-GHRFYPYITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKILCMR 356          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 223.402 bits (568), Expect = 1.046e-64
Identity = 115/325 (35.38%), Postives = 185/325 (56.92%), Query Frame = 3
Query:  294 HILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPVKSSIGKKTSREIPR 1268
            H+ D +E  Q++TT+V L   W D  L+WDP EYEN+  + +PS LIW+PDI LYN AD          A +   G V W+P AIYKS+C +++ +FPFD Q C +KFG WTYD  ++++     +  +DL     S EW I+ +   +   +Y CC + YPDI++   IRR P+FYT  LI+PC L+S LT+++F++P +   K+ L +++ ++  + LLL+ +  PS S   PLIG Y    M  +TLS  ++  V+N+H R      +P W++++  +   ++L +      + ++E  L      P   ++G + +   PR
Sbjct:    9 HLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMARD--VDLKDYWESGEWAIVHAVGTYNTKKYDCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVRRVFLDRVPRWLVMRRPPPQQRRSELLLARAARPP--CALGGQRNHHKPR 329          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.348 bits (477), Expect = 3.032e-53
Identity = 83/255 (32.55%), Postives = 151/255 (59.22%), Query Frame = 3
Query:  390 EYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFL 1154
            E+  ++ +    H IW PDI LYN ADER +        ++  G  +  P  + KSTC++++++FPFD+Q C LKFG WT+DG+ +++         D S  + + EW +++      E+ Y CC EPYPD+++ + IRR  ++Y   L++PC L+S+L+L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLIG Y+   M I+  S  ++ IV+  H    + +++P W++ ++ ++   FL
Sbjct:    2 EHPGVKNLRFQPHQIWTPDILLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQMLEA----DTSGYIANGEWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGKKMPQWVRVILLDWCAWFL 252          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 168.318 bits (425), Expect = 1.916e-45
Identity = 106/338 (31.36%), Postives = 171/338 (50.59%), Query Frame = 3
Query:  171 WILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNES-------FLDLSSLVPSPEWTILQSWA-NHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCI 1160
            +++Q Y    RP         RT       ++TV  G+ L  ++ L   +  +T S  +   W+D  L WDP  Y+N+  + +    +W+PDIAL N  D   +        +   G V W P +IY+S+C + +KYFPFD Q C + F  +TYD   +N+ +  +E         +D S+   S EW I    +  +T  R P     Y DI+FY+ + R P+FY   +++PC L++   +  F++PP++  KM L +++ +A  + LLLL D  P  S   P+I  Y    M I+T    L+ IV+NLHFR      +PYW++++  +   K+L I
Sbjct:   32 FVVQQYKTLVRPA--------RTATG----RVTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSNNNDGNFDFGLYVHVLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLEYALDEHRQEIRHIIIDESTFPVSGEWQIKHKPSRKNTNPRDPL----YQDITFYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVIVLNLHFRSPATHIMPYWVRRIFIHSLPKYLWI 353          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 250.366 bits (638), Expect = 1.644e-75
Identity = 130/350 (37.14%), Postives = 203/350 (58.00%), Query Frame = 3
Query:  108 SEGSNSEVHLESGWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLE---ERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVK 1148
            SE S           EK L+  + ++YD   RPVF+         D+D   ++ VEF L LI I+ +N   Q++T SV +  +W +  L W+ ++Y  IE V +    +WIPDI LYN ADE      E+   +   SSDGT EW   A + STC +N++YFPFD Q C LKFG WTY G R+ +T  ++ +  DLS  V + EW +L   A    V Y CC  P+ D++ Y++I+R P++Y + LI+PC L+++LTL+ F++PPES  K+ LG+ + +A  + LLL+ +T PS S + PL+G Y+   M +  +S   +C+++N   R  +   +P+W+K ++ +Y  +
Sbjct:   23 SESSRKRRGASRETAEKRLLADLFRNYDSEVRPVFN---------DSD---KVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRLTMTSTSDSA--DLSKYVNNGEWHLLAMPAKLNRVFYNCCKYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRNPSTSPMPHWVKVIILDYMAR 358          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 213.386 bits (542), Expect = 3.129e-63
Identity = 111/343 (32.36%), Postives = 186/343 (54.23%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERL---EERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQ---EVPYWLKKLVFNYAVKFLCIN 1163
            E+ LI  +LQ Y + +RPV ++  T            + V FG+ ++ I+++    Q++ T+V +  RW +  L W P+ YE ++ V + +  +WIPDI LY+ AD       E+      IS DG+  W   A ++STC +++ YFPFD QTC++KFG WTY    V+I    + + +  S  + S EW ++ +  +     Y CC EP  D++  + IRR P+FY + LI PC ++ ++ L+ F++PPES  ++ L + + +A  + L L+ +T P  S + PL+G +Y   M  I +S   +C V+N+H R        E+P W+  +V  +    LC+ 
Sbjct:    1 EQRLISDLLQGYSRNARPVLNSNHT------------LKVFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHEKYKTHVIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDIQ--ASPAPVKSSKYLKSAEWDLMSATTSRKSQIYACCPEPISDVTIAMTIRRKPLFYAFNLITPCMIMLTMILLGFFLPPESGERITLSITVLLAMAVFLQLVAETLPRNSESIPLLGRFYITIMTEIAVSLMATCWVLNIHHRNSGTTLVVEMPKWVDVIVLRWLAVVLCVR 329          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Nematostella
Match: EDO44896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG1])

HSP 1 Score: 207.994 bits (528), Expect = 2.027e-59
Identity = 122/397 (30.73%), Postives = 204/397 (51.39%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLE---ERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFR--GDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTEN------SPVKSSIGKKTSREIPRYLNCNFRDSGRQLN 1310
            E  L+  +L+ Y+K + PV       I  K      Q  V FGL L+ ++++++  Q++TT+V +  RW +L L+WDP +Y  I  V I +  IWIPDI LYN AD       E+      ++ DG   W   A ++STC +++ +FPFD QTC++KFG WT++   V++  + ++S L  S  + S EW ++ +        Y CC  P+ D++     RR P+FY + LI+PC +++ + L+ F +PPES  ++ L + + +A  + L L  +  P  S N P++G +Y   M  + LS   +C V+++H +  G     VP+W++  +  Y  K L +      K   E+T   +        S +K  + +       R+   N   SGR+L 
Sbjct:   12 EHTLLGDLLKGYNKDAHPV------PILNK-----TQYMVTFGLELVQLVNVDDKNQIITTNVWVRQRWTNLLLKWDPDKYGGITRVRIDASKIWIPDIVLYNSADSEFSGGLEKYKTRVILNHDGVNAWYSPASFRSTCQIDVTFFPFDQQTCFMKFGSWTFE--VVDLDIFADKSPLHSSQYMKSAEWDLIAASKKRNVEYYACCTYPFSDVTVTWVFRRKPLFYVFNLIVPCLIITGMVLLGFMLPPESGERITLSITVLLAMAVFLQLAAENLPRNSDNVPVLGIFYITVMVEVALSLIATCYVLHIHHKNSGIAVVPVPHWVQVYMLGYLGKILGVK-----KPITEDTYDASSKLDFKRLSMMKRDMERAVGDGKRRFGLSNGGKSGRRLG 390          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Nematostella
Match: EDO39537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9T8])

HSP 1 Score: 201.83 bits (512), Expect = 2.583e-58
Identity = 113/341 (33.14%), Postives = 175/341 (51.32%), Query Frame = 3
Query:  309 NEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYA-DERLEERRPCAAK--ISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPVKSSIGKKTSREIPRYLNCNFRDSGRQLNPPTD 1322
            +E  Q+LTT+V +   W D  L+WDP ++  I  + +    +W PD+ LYN   DE   E+     K  I S G +EW    I K+ C ++I+YFPFD QTC L FG WTY+G ++++TF+   +  D+S+   + EW ++ + A    V+Y CC EPY D+++ +KI+R  MFY   LILPC LL+ LT + F  PPE+  ++ L + + +   + +++  +  P+ S   PLIG Y+   +  I+L    +C+ + LH       EVP W K ++F+      C   G   K K        E    K   G+ T        N   R+   Q +P  D
Sbjct:    1 DERNQILTTNVWVRQTWTDAWLKWDPAKHGGITAINVDPSFLWKPDMVLYNNVNDEDRGEQYLFNTKVIIYSTGDIEWYSPNILKTHCKIDIQYFPFDTQTCKLTFGSWTYNGLKIDVTFFRGIAGADISTYSQNGEWELVSADAVRNVVKYSCCPEPYQDLTYKIKIKRRSMFYVNNLILPCILLALLTGLSFLFPPETGERISLVVTVLLGMTVFMIIFTEAIPATSEATPLIGKYFAAVLIEISLCLLATCVPLRLHHHHPG-TEVPPWAKFIIFDIIGTLCCYKCGRK-KQKTNVNFIELETEKHKKGNGEAT--------NVRARNPRMQFSPSLD 331          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Nematostella
Match: EDO43642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY59])

HSP 1 Score: 197.208 bits (500), Expect = 1.054e-57
Identity = 106/303 (34.98%), Postives = 169/303 (55.78%), Query Frame = 3
Query:  153 EKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLE---ERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTF 1052
            E +L++ +  +Y+   RPV    ++V            TV+ G+ L  I+DL+E  Q+L +++ +  +W +  L WDPT + N+  + +    +W PD+ LYN AD   +   +R     ++  DG+  W    I+KSTC  ++ YFPFD Q+C LKFG WTYDG R+NI   N    + +   V + EW +    AN   + Y CC EPYPD++F +KIRR  +FY   +++PCFL++ LTL+ + +PPES  ++ L +   +A  + LLL+ +  P  +   PLI  YY   M ++T+  F
Sbjct:    2 ENKLLKDLFSNYNPSVRPVLKATSSV------------TVQLGVSLHQIIDLDERNQILISNLWVRQKWNNPLLTWDPTHFGNLTSINVDPLRVWRPDLILYNNADRDTDGALDRFYTKVQLKFDGSSLWLAPIIFKSTCKFDVAYFPFDEQSCILKFGSWTYDGLRLNIVPENGTD-IGIDKFVSNGEWELTGVSANRNVMFYDCCVEPYPDVTFTLKIRRLTLFYYMNMLIPCFLITGLTLLSYILPPESGERITLVVTSLLAQAVYLLLVSEIMPPVAEVVPLISIYYTTAMFMVTVFKF 291          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Medaka
Match: ENSORLT00000038695.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 246.899 bits (629), Expect = 4.711e-73
Identity = 133/412 (32.28%), Postives = 221/412 (53.64%), Query Frame = 3
Query:  144 GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPVKSSIGKKTSREIPRYLNCNFRDSGRQLNPPTDLSIKLTNEVEEIPVSSIQN 1379
            G  ++ L   ++  Y+   RPV+++             Q +TV FGL L+ I+D++E  QVLTT++ L   W D +L+W+ ++Y  +  V  P HLIW PDI LYN ADER +        ++S GT  + P  I+KSTC++++++FPFD+Q C LKFG WTY G+ +++         D+S  + + EW +++      E  Y CCDEPY DI+F V +RR  ++Y   L+LPC L+S+L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ LS   + +V+  H    +  ++P W + ++ N+   FL        +MK      P E+  V+S+   KT R            +   LN PT  S+     +  + V  +++
Sbjct:   47 GPNQRRLYSDLMSTYNPLERPVYNDS------------QSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKMLEA----DVSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFL--------RMKR-----PGEDR-VRSACDNKTRRS---------SLTSMDLNAPTSTSLSTNGNLLYVGVRGLES 419          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Medaka
Match: ENSORLT00000046008.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 246.899 bits (629), Expect = 4.961e-73
Identity = 133/412 (32.28%), Postives = 221/412 (53.64%), Query Frame = 3
Query:  144 GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPVKSSIGKKTSREIPRYLNCNFRDSGRQLNPPTDLSIKLTNEVEEIPVSSIQN 1379
            G  ++ L   ++  Y+   RPV+++             Q +TV FGL L+ I+D++E  QVLTT++ L   W D +L+W+ ++Y  +  V  P HLIW PDI LYN ADER +        ++S GT  + P  I+KSTC++++++FPFD+Q C LKFG WTY G+ +++         D+S  + + EW +++      E  Y CCDEPY DI+F V +RR  ++Y   L+LPC L+S+L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ LS   + +V+  H    +  ++P W + ++ N+   FL        +MK      P E+  V+S+   KT R            +   LN PT  S+     +  + V  +++
Sbjct:   44 GPNQRRLYSDLMSTYNPLERPVYNDS------------QSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKMLEA----DVSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFL--------RMKR-----PGEDR-VRSACDNKTRRS---------SLTSMDLNAPTSTSLSTNGNLLYVGVRGLES 416          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Medaka
Match: ENSORLT00000033785.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 244.973 bits (624), Expect = 6.268e-73
Identity = 131/401 (32.67%), Postives = 216/401 (53.87%), Query Frame = 3
Query:  177 LQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPVKSSIGKKTSREIPRYLNCNFRDSGRQLNPPTDLSIKLTNEVEEIPVSSIQN 1379
            +  Y+   RPV+++             Q +TV FGL L+ I+D++E  QVLTT++ L   W D +L+W+ ++Y  +  V  P HLIW PDI LYN ADER +        ++S GT  + P  I+KSTC++++++FPFD+Q C LKFG WTY G+ +++         D+S  + + EW +++      E  Y CCDEPY DI+F V +RR  ++Y   L+LPC L+S+L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ LS   + +V+  H    +  ++P W + ++ N+   FL        +MK      P E+  V+S+   KT R            +   LN PT  S+     +  + V  +++
Sbjct:    1 MSTYNPLERPVYNDS------------QSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKMLEA----DVSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILLNWCAWFL--------RMKR-----PGEDR-VRSACDNKTRRS---------SLTSMDLNAPTSTSLSTNGNLLYVGVRGLES 362          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Medaka
Match: si:ch73-380n15.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101162456])

HSP 1 Score: 239.195 bits (609), Expect = 3.863e-70
Identity = 119/377 (31.56%), Postives = 215/377 (57.03%), Query Frame = 3
Query:  144 GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINL-GSNIKMKNEETLFPTENSPVKSSI--GKKTSREIP 1265
            G  +++L + +L +Y++  RPV ++   ++            VE G  L+ I+D++E  QVL T+  L   W D++L W+P  Y  ++ +  PS  +W PDI LYN ADER +        +++ G  ++ P  I KSTC++++++FPFD+Q C LKFG WT++G+ +++   +    +D+S+ + + EW ++   A   E+ Y CC EPYPD++F V +RR  ++Y   L++PC L+S L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ +S  ++ IV+  H    +  ++P W++ ++ N+   FL +   GS  K ++ +    +++    SSI  G   S  IP
Sbjct:   28 GEYQRKLYKELLANYNRLERPVVNDSAAIL------------VELGFTLLQIIDVDEKNQVLITNAWLQLHWTDIYLTWNPENYPGVQNLRFPSDQVWTPDILLYNSADERFDATFHTNVLVNASGHCQYIPPGILKSTCYIDVRWFPFDVQKCDLKFGSWTHNGWLLDLQMLD----VDISTYISNGEWDLVGVPAKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGMSVVVTVIVLQFHHHDPHGGKMPKWVRVVLLNWCAWFLRMKQPGSERKKRHYQYRHASQHHSSTSSIEMGTMPSLSIP 388          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Medaka
Match: si:ch73-380n15.2 (neuronal acetylcholine receptor subunit alpha-7 [Source:NCBI gene;Acc:101162456])

HSP 1 Score: 239.58 bits (610), Expect = 4.885e-70
Identity = 119/377 (31.56%), Postives = 215/377 (57.03%), Query Frame = 3
Query:  144 GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINL-GSNIKMKNEETLFPTENSPVKSSI--GKKTSREIP 1265
            G  +++L + +L +Y++  RPV ++   ++            VE G  L+ I+D++E  QVL T+  L   W D++L W+P  Y  ++ +  PS  +W PDI LYN ADER +        +++ G  ++ P  I KSTC++++++FPFD+Q C LKFG WT++G+ +++   +    +D+S+ + + EW ++   A   E+ Y CC EPYPD++F V +RR  ++Y   L++PC L+S L L++F +P +S  K+ LG+ + ++  + +LL+ +  P+ S + PLI  Y+   M I+ +S  ++ IV+  H    +  ++P W++ ++ N+   FL +   GS  K ++ +    +++    SSI  G   S  IP
Sbjct:   52 GEYQRKLYKELLANYNRLERPVVNDSAAIL------------VELGFTLLQIIDVDEKNQVLITNAWLQLHWTDIYLTWNPENYPGVQNLRFPSDQVWTPDILLYNSADERFDATFHTNVLVNASGHCQYIPPGILKSTCYIDVRWFPFDVQKCDLKFGSWTHNGWLLDLQMLD----VDISTYISNGEWDLVGVPAKRNELYYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMMIVGMSVVVTVIVLQFHHHDPHGGKMPKWVRVVLLNWCAWFLRMKQPGSERKKRHYQYRHASQHHSSTSSIEMGTMPSLSIP 412          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Planmine SMEST
Match: SMESG000015256.1 (SMESG000015256.1)

HSP 1 Score: 1026.16 bits (2652), Expect = 0.000e+0
Identity = 530/533 (99.44%), Postives = 532/533 (99.81%), Query Frame = 3
Query:  465 ADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPVKSSIGKKTSREIPRYLNCNFRDSGRQLNPPTDLSIKLTNEVEEIPVSSIQNWIRFNSFSEAENVIHNIDTNNQKNSPNMDFTNDNRFLQVPLSPTLFPDYLSKSDLFKTLESCSPLHSPIFKKSFQFIDEIKXXXXXXXXXXXXXXXXYASAPLLKDAVALSLSQLGNLKASFSPAHNQKISMSSKKDINSYSVKNTQTSDHEFTLFGMDSEQHXXXXXXXXXXXXSLKYIQKLQENKENVARIFSEWRSVGLVLDRIFFYCYLFTVIFSIIMYFPKTN 2063
            ADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTEN+PVKSSIGKKTSREIPRYLNCNFRDSGRQLNPPTDLSIKLTNEVEEIPVSSIQNWIRFNSFSEAENVIHNIDTNNQKNSPNMDFTNDNRFLQVPLSPTLFPDYLSKSDLFKTLESCSPLHSPIFKKSFQFIDEIKNNDNNNNNISNNRDSIYASAPLLKDAVALSLSQLGNLKAS SPAHNQKISMSSKKDINSYSVKNTQTSDHEFTLFGMDSEQHKKICKDVKVIVKSLKYIQKLQENKENV+RIFSEWRSVGLVLDRIFFYCYLFTVIFSIIMYFPKTN
Sbjct:    3 ADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENNPVKSSIGKKTSREIPRYLNCNFRDSGRQLNPPTDLSIKLTNEVEEIPVSSIQNWIRFNSFSEAENVIHNIDTNNQKNSPNMDFTNDNRFLQVPLSPTLFPDYLSKSDLFKTLESCSPLHSPIFKKSFQFIDEIKNNDNNNNNISNNRDSIYASAPLLKDAVALSLSQLGNLKASISPAHNQKISMSSKKDINSYSVKNTQTSDHEFTLFGMDSEQHKKICKDVKVIVKSLKYIQKLQENKENVSRIFSEWRSVGLVLDRIFFYCYLFTVIFSIIMYFPKTN 535          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Planmine SMEST
Match: SMESG000015256.1 (SMESG000015256.1)

HSP 1 Score: 971.074 bits (2509), Expect = 0.000e+0
Identity = 505/508 (99.41%), Postives = 507/508 (99.80%), Query Frame = 3
Query:  540 MAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPVKSSIGKKTSREIPRYLNCNFRDSGRQLNPPTDLSIKLTNEVEEIPVSSIQNWIRFNSFSEAENVIHNIDTNNQKNSPNMDFTNDNRFLQVPLSPTLFPDYLSKSDLFKTLESCSPLHSPIFKKSFQFIDEIKXXXXXXXXXXXXXXXXYASAPLLKDAVALSLSQLGNLKASFSPAHNQKISMSSKKDINSYSVKNTQTSDHEFTLFGMDSEQHXXXXXXXXXXXXSLKYIQKLQENKENVARIFSEWRSVGLVLDRIFFYCYLFTVIFSIIMYFPKTN 2063
            MAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTEN+PVKSSIGKKTSREIPRYLNCNFRDSGRQLNPPTDLSIKLTNEVEEIPVSSIQNWIRFNSFSEAENVIHNIDTNNQKNSPNMDFTNDNRFLQVPLSPTLFPDYLSKSDLFKTLESCSPLHSPIFKKSFQFIDEIKNNDNNNNNISNNRDSIYASAPLLKDAVALSLSQLGNLKAS SPAHNQKISMSSKKDINSYSVKNTQTSDHEFTLFGMDSEQHKKICKDVKVIVKSLKYIQKLQENKENV+RIFSEWRSVGLVLDRIFFYCYLFTVIFSIIMYFPKTN
Sbjct:    1 MAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENNPVKSSIGKKTSREIPRYLNCNFRDSGRQLNPPTDLSIKLTNEVEEIPVSSIQNWIRFNSFSEAENVIHNIDTNNQKNSPNMDFTNDNRFLQVPLSPTLFPDYLSKSDLFKTLESCSPLHSPIFKKSFQFIDEIKNNDNNNNNISNNRDSIYASAPLLKDAVALSLSQLGNLKASISPAHNQKISMSSKKDINSYSVKNTQTSDHEFTLFGMDSEQHKKICKDVKVIVKSLKYIQKLQENKENVSRIFSEWRSVGLVLDRIFFYCYLFTVIFSIIMYFPKTN 508          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Planmine SMEST
Match: SMESG000071641.1 (SMESG000071641.1)

HSP 1 Score: 512.301 bits (1318), Expect = 4.996e-175
Identity = 237/345 (68.70%), Postives = 284/345 (82.32%), Query Frame = 3
Query:  144 GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNI 1178
            GW EK LI+ + ++YDKRSRPV D ++ + R  +N  +QQITVEFG  LI ILDLNEM+QVLTTS R L+RW D +L W P  Y NI  V +P+ ++WIPDI+LYNYADERLEERR C AKI  DGTV+WQPMAIYKSTC VNIKYFPFD QTCWLKFGPWTYDG+RVNITFY N   +DL++ + SPEW +L + ANHTE++YPCC E YPDI FY+ I+R P FYTYILILPCFLLSSLTLVLFW+PPESPAKMVLGMNIFVAFFL+LLLL+DTTPSAS NFPLIGTYYC+NMG+IT S+F+SC++VN HFRGDN+++VP W+KK++F +  K LC+ L   +
Sbjct:   17 GWTEKILIRDLFENYDKRSRPVVDGISKLSRVSENYTVQQITVEFGFNLIQILDLNEMDQVLTTSTRSLFRWTDPNLVWTPEMYGNISVVNVPADMLWIPDISLYNYADERLEERRSCDAKIYPDGTVDWQPMAIYKSTCSVNIKYFPFDEQTCWLKFGPWTYDGYRVNITFYGNNPNMDLTNFITSPEWKVLATRANHTEIKYPCCPEIYPDIKFYIWIKRQPAFYTYILILPCFLLSSLTLVLFWLPPESPAKMVLGMNIFVAFFLLLLLLEDTTPSASSNFPLIGTYYCLNMGLITFSSFVSCLIVNFHFRGDNKRQVPNWIKKVLFLFIAKLLCVKLNPKV 361          

HSP 2 Score: 56.225 bits (134), Expect = 6.496e-8
Identity = 30/93 (32.26%), Postives = 48/93 (51.61%), Query Frame = 3
Query: 1779 SKKDINSYSVKNTQTSDHEFTLFGMDSEQHXXXXXXXXXXXXSLKYIQKLQENKENVARIFSEWRSVGLVLDRIFFYCYLFTVIFSIIMYFPK 2057
            SK DI   + KN Q    +F         H +          +L+++Q L   +E       EW++VGLV+DR+FF+CY+F ++ S+  YFP+
Sbjct:  458 SKLDIEIVTDKNGQDITKQFQKLQKKISNHIRDIVK------NLRFLQNLHHVREISQITEMEWQAVGLVVDRVFFFCYIFIIVLSMASYFPR 544          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Planmine SMEST
Match: SMESG000071641.1 (SMESG000071641.1)

HSP 1 Score: 491.115 bits (1263), Expect = 7.077e-167
Identity = 230/345 (66.67%), Postives = 276/345 (80.00%), Query Frame = 3
Query:  144 GWKEKELIQWILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNI 1178
            GW EK LI+ + ++YDKRSRPV D ++ + R  +N  +QQITVEFG  LI ILDLNEM+Q          RW D +L W P  Y NI  V +P+ ++WIPDI+LYNYADERLEERR C AKI  DGTV+WQPMAIYKSTC VNIKYFPFD QTCWLKFGPWTYDG+RVNITFY N   +DL++ + SPEW +L + ANHTE++YPCC E YPDI FY+ I+R P FYTYILILPCFLLSSLTLVLFW+PPESPAKMVLGMNIFVAFFL+LLLL+DTTPSAS NFPLIGTYYC+NMG+IT S+F+SC++VN HFRGDN+++VP W+KK++F +  K LC+ L   +
Sbjct:   25 GWTEKILIRDLFENYDKRSRPVVDGISKLSRVSENYTVQQITVEFGFNLIQILDLNEMDQ----------RWTDPNLVWTPEMYGNISVVNVPADMLWIPDISLYNYADERLEERRSCDAKIYPDGTVDWQPMAIYKSTCSVNIKYFPFDEQTCWLKFGPWTYDGYRVNITFYGNNPNMDLTNFITSPEWKVLATRANHTEIKYPCCPEIYPDIKFYIWIKRQPAFYTYILILPCFLLSSLTLVLFWLPPESPAKMVLGMNIFVAFFLLLLLLEDTTPSASSNFPLIGTYYCLNMGLITFSSFVSCLIVNFHFRGDNKRQVPNWIKKVLFLFIAKLLCVKLNPKV 359          

HSP 2 Score: 56.225 bits (134), Expect = 7.189e-8
Identity = 30/93 (32.26%), Postives = 48/93 (51.61%), Query Frame = 3
Query: 1779 SKKDINSYSVKNTQTSDHEFTLFGMDSEQHXXXXXXXXXXXXSLKYIQKLQENKENVARIFSEWRSVGLVLDRIFFYCYLFTVIFSIIMYFPK 2057
            SK DI   + KN Q    +F         H +          +L+++Q L   +E       EW++VGLV+DR+FF+CY+F ++ S+  YFP+
Sbjct:  456 SKLDIEIVTDKNGQDITKQFQKLQKKISNHIRDIVK------NLRFLQNLHHVREISQITEMEWQAVGLVVDRVFFFCYIFIIVLSMASYFPR 542          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Planmine SMEST
Match: SMESG000040082.1 (SMESG000040082.1)

HSP 1 Score: 483.797 bits (1244), Expect = 3.329e-162
Identity = 234/406 (57.64%), Postives = 295/406 (72.66%), Query Frame = 3
Query:   57 TILIQGCFEAENLIAEDSEGSNSEVHLESGWKEKELIQWILQDYDKRSRPVFDNVTTVIR---TKDNDVIQQITVEFGLRLIHILDLNEMEQVLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSPVKSSIGKKTSREIP 1265
            TI+I   F  + L  +  E  + + H E  W EK LI  +L  YDKRSRPV DN+T V R    + N  IQQ+TVEFGL LI I+ L+EM+Q+LT++VR LYRWKD H+ W P  Y+NI  V IP+  +W+PDI++YNYADER+EERR C A I  DGTVEW PMAI+KSTC V IKYFPFD Q C LKFGPWTYDGFR+NITFY+N++ LD ++ V + EW ++++ A  T VRYPCC EPYPDISF++ ++R+  FY YILILPCFLLSSLTLVLFW+P ESPAKMVLGMNIF+AFFL+++LL+ + PSAS +FPLIGTYYC+NM +ITLSTFL  I VN HFRGDNR+EVP+WLKKL   +  + L ++LG  +K         T+     S + K   + +P
Sbjct:    8 TIIIGFVFLLKCLRCQYQEKLSIKNHPEKSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYILILPCFLLSSLTLVLFWLPAESPAKMVLGMNIFIAFFLLVVLLEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVETIKTKQCINPSFLNKAPPKHLP 413          

HSP 2 Score: 67.781 bits (164), Expect = 1.722e-11
Identity = 30/52 (57.69%), Postives = 38/52 (73.08%), Query Frame = 3
Query: 1908 LKYIQKLQENKENVARIFSEWRSVGLVLDRIFFYCYLFTVIFSIIMYFPKTN 2063
            L +IQK  ENKE V +I SEWR+VGLVLDR FF  Y+  +I S+I++FPK  
Sbjct:  611 LTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAIILSLILFFPKAG 662          
The following BLAST results are available for this feature:
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA42.387e-6937.04cholinergic receptor nicotinic alpha 4 subunit [So... [more]
CHRNA25.326e-6936.00cholinergic receptor nicotinic alpha 2 subunit [So... [more]
CHRNA72.194e-6833.53cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC243734.12.194e-6833.53cholinergic receptor nicotinic alpha 7 subunit [So... [more]
CHRNA22.226e-6836.00cholinergic receptor nicotinic alpha 2 subunit [So... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-634.308e-6835.10Acetylcholine receptor subunit alpha-type unc-63 ... [more]
unc-385.409e-6534.44Acetylcholine receptor subunit alpha-type unc-38 ... [more]
acr-214.941e-6234.04pep chromosome:WBcel235:III:6583461:6586549:1 gene... [more]
acr-215.103e-6232.20pep chromosome:WBcel235:III:6581927:6586549:1 gene... [more]
acr-215.722e-6234.04pep chromosome:WBcel235:III:6583461:6586549:1 gene... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha21.493e-7336.39gene:FBgn0000039 transcript:FBtr0084639[more]
nAChRalpha21.493e-7336.39gene:FBgn0000039 transcript:FBtr0084640[more]
nAChRalpha43.590e-7237.61gene:FBgn0266347 transcript:FBtr0332872[more]
nAChRalpha45.175e-7237.61gene:FBgn0266347 transcript:FBtr0300118[more]
nAChRalpha41.600e-6936.15gene:FBgn0266347 transcript:FBtr0346707[more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna4b8.481e-7036.03cholinergic receptor, nicotinic, alpha 4b [Source:... [more]
FO907089.12.465e-6933.23neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna74.081e-6932.24cholinergic receptor, nicotinic, alpha 7 (neuronal... [more]
chrna79.972e-6932.24cholinergic receptor, nicotinic, alpha 7 (neuronal... [more]
si:ch211-39a7.11.617e-6834.42si:ch211-39a7.1 [Source:ZFIN;Acc:ZDB-GENE-060503-6... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA21.104e-6836.23cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
CHRNA21.717e-6836.23cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
ncaph1.640e-6733.83non-SMC condensin I complex subunit H [Source:Xenb... [more]
ncaph1.929e-6733.83non-SMC condensin I complex subunit H [Source:Xenb... [more]
ncaph3.052e-6733.83non-SMC condensin I complex subunit H [Source:Xenb... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna28.147e-6936.69cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna28.147e-6936.69cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna41.029e-6836.75cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna31.532e-6834.15cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna41.868e-6836.75cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23414|ACH1_SCHGR2.481e-7337.21Acetylcholine receptor subunit alpha-L1 OS=Schisto... [more]
sp|P17644|ACH2_DROME1.496e-7236.39Acetylcholine receptor subunit alpha-like 2 OS=Dro... [more]
sp|P09480|ACHA2_CHICK6.656e-7235.41Neuronal acetylcholine receptor subunit alpha-2 OS... [more]
sp|P09482|ACHA4_CHICK5.893e-7036.41Neuronal acetylcholine receptor subunit alpha-4 OS... [more]
sp|P22770|ACHA7_CHICK6.562e-6934.73Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H1Z46.138e-15865.62Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E1808.312e-15765.62Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F2A98.578e-15765.62Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FTB21.549e-15560.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GNZ62.188e-15458.91Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna74.576e-7332.72neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna75.929e-7232.72neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna76.874e-7232.88neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna4b9.983e-7235.75neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna4b3.764e-7135.75neuronal acetylcholine receptor subunit alpha-2 [S... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna31.743e-6833.13cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb3b2.200e-6535.80cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna2a1.046e-6435.38cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
ENSPMAT00000008550.13.032e-5332.55pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
chrnb1l1.916e-4531.36cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420541.644e-7537.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479693.129e-6332.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448962.027e-5930.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395372.583e-5833.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436421.054e-5734.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038695.14.711e-7332.28neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000046008.14.961e-7332.28neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000033785.16.268e-7332.67neuronal acetylcholine receptor subunit alpha-7-li... [more]
si:ch73-380n15.23.863e-7031.56neuronal acetylcholine receptor subunit alpha-7 [S... [more]
si:ch73-380n15.24.885e-7031.56neuronal acetylcholine receptor subunit alpha-7 [S... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015256.10.000e+099.44SMESG000015256.1[more]
SMESG000015256.10.000e+099.41SMESG000015256.1[more]
SMESG000071641.14.996e-17568.70SMESG000071641.1[more]
SMESG000071641.17.077e-16766.67SMESG000071641.1[more]
SMESG000040082.13.329e-16257.64SMESG000040082.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012957 ID=SMED30012957|Name=Neuronal acetylcholine receptor subunit alpha-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2127bp
ATTAAGTTCAACAGAAAATCAAAATGTGCTGGATTTATAGGATGAGTCTT
TTCCTGACAATTTTAATTCAAGGTTGCTTCGAAGCAGAAAATTTAATTGC
TGAAGATAGCGAAGGTTCTAATTCTGAAGTTCACTTAGAATCCGGTTGGA
AAGAAAAGGAATTGATTCAGTGGATTTTACAAGACTATGATAAACGCTCA
AGACCTGTATTTGATAATGTTACAACAGTAATTAGGACGAAGGATAATGA
TGTCATTCAACAAATAACTGTGGAATTCGGACTGAGACTCATCCACATTC
TCGATCTTAATGAAATGGAACAAGTTCTAACCACTAGTGTCAGACTGCTT
TATAGATGGAAAGATCTACATTTAGAATGGGATCCAACAGAGTATGAAAA
TATAGAATTCGTATTTATTCCATCACATCTTATTTGGATTCCGGATATCG
CCTTGTATAATTATGCAGATGAAAGACTTGAGGAAAGAAGACCCTGTGCT
GCAAAGATTTCTAGTGATGGAACAGTAGAGTGGCAGCCGATGGCCATTTA
TAAAAGTACTTGTTTTGTAAATATAAAATATTTTCCATTTGACATTCAAA
CGTGTTGGTTAAAATTCGGACCCTGGACATATGATGGATTTAGAGTAAAC
ATAACATTTTACAACAATGAAAGTTTTCTGGATTTATCTAGTCTCGTTCC
AAGCCCAGAATGGACAATTTTACAATCTTGGGCAAACCATACTGAAGTCC
GATATCCTTGTTGTGATGAACCTTACCCAGATATAAGTTTTTATGTTAAA
ATTAGAAGAAGCCCAATGTTTTATACTTATATACTGATACTGCCTTGTTT
TCTATTATCTTCACTGACATTGGTTTTGTTTTGGATGCCACCAGAAAGTC
CAGCAAAGATGGTCCTAGGAATGAACATATTTGTCGCATTCTTTTTGATG
TTGCTATTATTACAAGATACGACTCCGTCTGCCTCTCGAAACTTTCCATT
AATAGGAACATATTATTGTGTCAATATGGGTATAATAACGCTTTCGACGT
TTTTATCTTGTATTGTGGTAAATTTACATTTTCGGGGAGACAACAGACAA
GAAGTTCCATATTGGCTCAAAAAATTAGTCTTCAATTATGCAGTAAAATT
TCTATGTATCAATTTGGGATCAAATATAAAAATGAAAAATGAAGAAACTT
TATTTCCAACAGAAAATAGTCCTGTTAAATCTTCTATTGGAAAGAAAACT
TCTCGAGAAATTCCAAGGTACTTAAATTGCAATTTTCGTGACAGCGGTAG
ACAGCTAAACCCTCCCACTGATTTATCTATAAAGCTAACAAATGAAGTTG
AAGAAATTCCTGTTTCTTCTATACAAAACTGGATCAGATTTAATTCATTT
TCGGAAGCTGAAAATGTAATTCATAATATAGACACTAACAACCAGAAAAA
CAGTCCAAACATGGATTTCACAAATGACAATAGGTTTCTACAAGTTCCGC
TATCTCCTACTCTTTTTCCTGATTATTTATCAAAAAGTGACCTTTTCAAA
ACTTTAGAGTCGTGTTCACCTCTTCACAGTCCAATATTTAAGAAAAGCTT
TCAGTTCATTGATGAAATTAAAAACAATGATAATAACAATAATAATATTT
CGAATAACAGAGATTCAATATATGCATCAGCTCCACTTCTCAAAGATGCA
GTTGCGTTGTCGTTAAGTCAATTAGGAAATCTTAAAGCTTCTTTTTCGCC
TGCTCATAATCAAAAAATATCAATGTCTTCAAAAAAGGATATCAACTCTT
ATTCCGTCAAAAATACTCAAACTTCGGATCATGAATTTACTCTCTTTGGA
ATGGATAGTGAACAACATAAGAAAATCTGCAAAGACGTCAAGGTCATAGT
AAAATCTTTGAAATATATCCAAAAATTACAAGAAAACAAAGAAAATGTTG
CAAGGATTTTCTCTGAATGGCGCAGTGTTGGCCTTGTTCTTGATCGCATT
TTCTTTTATTGTTATCTTTTTACAGTTATATTTTCCATAATAATGTACTT
TCCAAAAACGAATTTAGAAGAATAATAATTATCATTATATTTATATTTAT
TAATTAAAGCTTTGCAATTAAAACAAC
back to top

protein sequence of SMED30012957-orf-1

>SMED30012957-orf-1 ID=SMED30012957-orf-1|Name=SMED30012957-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=684bp
MCWIYRMSLFLTILIQGCFEAENLIAEDSEGSNSEVHLESGWKEKELIQW
ILQDYDKRSRPVFDNVTTVIRTKDNDVIQQITVEFGLRLIHILDLNEMEQ
VLTTSVRLLYRWKDLHLEWDPTEYENIEFVFIPSHLIWIPDIALYNYADE
RLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGP
WTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEP
YPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGM
NIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVN
LHFRGDNRQEVPYWLKKLVFNYAVKFLCINLGSNIKMKNEETLFPTENSP
VKSSIGKKTSREIPRYLNCNFRDSGRQLNPPTDLSIKLTNEVEEIPVSSI
QNWIRFNSFSEAENVIHNIDTNNQKNSPNMDFTNDNRFLQVPLSPTLFPD
YLSKSDLFKTLESCSPLHSPIFKKSFQFIDEIKNNDNNNNNISNNRDSIY
ASAPLLKDAVALSLSQLGNLKASFSPAHNQKISMSSKKDINSYSVKNTQT
SDHEFTLFGMDSEQHKKICKDVKVIVKSLKYIQKLQENKENVARIFSEWR
SVGLVLDRIFFYCYLFTVIFSIIMYFPKTNLEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR002394Nicotinic_acetylcholine_rcpt
IPR006029Neurotrans-gated_channel_TM
IPR027361Acetylcholine_rcpt_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 682..683
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 268..387
e-value: 1.2E-29
score: 105.0
NoneNo IPR availablePANTHERPTHR18945:SF778ACETYLCHOLINE RECEPTOR SUBUNIT BETA-LIKE 2coord: 44..673
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..18
score: 5.0
NoneNo IPR availableCDDcd19051LGIC_TM_cationcoord: 265..356
e-value: 1.2418E-32
score: 119.775
NoneNo IPR availableCDDcd19033LGIC_ECD_nAChR_proto-likecoord: 81..263
e-value: 6.01607E-107
score: 320.002
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.668
NoneNo IPR availableTMHMMTMhelixcoord: 327..349
NoneNo IPR availableTMHMMTMhelixcoord: 294..312
NoneNo IPR availableTMHMMTMhelixcoord: 265..287
NoneNo IPR availableTMHMMTMhelixcoord: 654..676
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 180..194
score: 46.4
coord: 103..119
score: 33.01
coord: 258..270
score: 28.99
coord: 136..147
score: 47.93
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 44..673
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 90..106
score: 36.34
coord: 124..138
score: 35.85
coord: 160..178
score: 44.8
coord: 142..154
score: 42.05
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 271..676
e-value: 7.6E-31
score: 108.0
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 40..267
e-value: 4.0E-70
score: 237.6
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 43..264
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 44..264
e-value: 5.4E-54
score: 182.9
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 180..194
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 264..676