centriolin

Overview
Namecentriolin (AFB74713.1)
Smed IDSMED30012954
Length (bp)6702
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of centriolin (SMED30012954) t-SNE clustered cells

Violin plots show distribution of expression levels for centriolin (SMED30012954) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of centriolin (SMED30012954) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for centriolin (SMED30012954) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012954

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012954SMESG000006866.1 JQ036183smed_ncbi_20200123PMID:22223737
Azimzadeh et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx tipSMED30012954SMESG000006866.1 JQ036183smed_ncbi_20200123PMID:22223737
Azimzadeh et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30012954SMESG000006866.1 dd_Smed_v4_10369_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30012954SMESG000006866.1 dd_Smed_v4_10369_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30012954SMESG000006866.1 dd_Smed_v4_10369_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012954SMESG000006866.1 dd_Smed_v4_10369_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of centriolin vs. Ensembl Human
Match: CNTRL (centriolin [Source:HGNC Symbol;Acc:HGNC:1858])

HSP 1 Score: 185.267 bits (469), Expect = 2.114e-49
Identity = 122/327 (37.31%), Postives = 191/327 (58.41%), Query Frame = 1
Query:  133 GVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKK---QKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQA-YMGKGQF 1098
            GVRYITE  IK +  +D+L  IK LNL   K G KK +YIE+L+    + VL++ ++ I KIEKLDKL  LREL LS NKI +++G+EN+ NL+ L++ GN++  IP W  ++ K L  +N   N   S+++ISKL  L+DL+ L + ENPV  + HY  + +  L+ L  L+ + V   +++ A E+F   E++R+   L +   + EE+K  Q +  ++   QD+  K L ++   QK + E++K               +     RACQK YELEQ++AF KIDAKF+ L+ +          SE+++I    D++ Y+GK ++
Sbjct:   79 GVRYITEALIKKLTKQDNLALIKSLNLSLSKDGGKKFKYIENLEKCVKLEVLNLSYNLIGKIEKLDKLLKLRELNLSYNKISKIEGIENMCNLQKLNLAGNEIEHIPVWLGKKLKSLRVLNLKGNKISSLQDISKLKPLQDLISLILVENPVVTLPHYLQFTIFHLRSLESLEGQPVTTQDRQEAFERFSLEEVERLERDLEKKMIETEELKSKQTRFLEEIKNQDKLNKSLKEEAMLQKQSCEELKSDLNTKNELLKQKTIELT---RACQKQYELEQELAFYKIDAKFEPLNYY---------PSEYAEIDKAPDESPYIGKSRY 393          
BLAST of centriolin vs. Ensembl Human
Match: CNTRL (centriolin [Source:HGNC Symbol;Acc:HGNC:1858])

HSP 1 Score: 187.578 bits (475), Expect = 1.246e-46
Identity = 123/327 (37.61%), Postives = 192/327 (58.72%), Query Frame = 1
Query:  133 GVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKK---QKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQA-YMGKGQF 1098
            GVRYITE  IK +  +D+L  IK LNL   K G KK +YIE+L+    + VL++ ++ I KIEKLDKL  LREL LS NKI +++G+EN+ NL+ L++ GN++  IP W  ++ K L  +N   N   S+++ISKL  L+DL+ L + ENPV  + HY  + +  L+ L  L+ + V   +++ A E+F   E++R+   L +   + EE+K  Q +  ++   QD+  K L ++   QK + E++K               +     RACQK YELEQ++AF KIDAKF+ L+ +  P       SE+++I    D++ Y+GK ++
Sbjct:   79 GVRYITEALIKKLTKQDNLALIKSLNLSLSKDGGKKFKYIENLEKCVKLEVLNLSYNLIGKIEKLDKLLKLRELNLSYNKISKIEGIENMCNLQKLNLAGNEIEHIPVWLGKKLKSLRVLNLKGNKISSLQDISKLKPLQDLISLILVENPVVTLPHYLQFTIFHLRSLESLEGQPVTTQDRQEAFERFSLEEVERLERDLEKKMIETEELKSKQTRFLEEIKNQDKLNKSLKEEAMLQKQSCEELKSDLNTKNELLKQKTIELT---RACQKQYELEQELAFYKIDAKFEPLNYY--P-------SEYAEIDKAPDESPYIGKSRY 393          

HSP 2 Score: 105.145 bits (261), Expect = 1.414e-21
Identity = 211/941 (22.42%), Postives = 435/941 (46.23%), Query Frame = 1
Query: 3397 SAPSNNPQFVQQQAMPPNNSPLPGATYI---PNGFLPQIHNSHSTPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLED---HFQNNGKHKSSWKLKQKF----KSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQ------DLLN-NISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSR---QVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNE----KKELESNLKILRKQE--SQVHET-LTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIF--DLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIF--ELEEIIKQQENNAHHYEQENRKLSNHLAVINR-------DLAALRQNHQFEMDNKDKELSRLRKR---------------------VAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIV 6042
              P     +     +P N+ PL   T +   P    P ++     P   ++P+  +        G L CNVPEHH LE+     ++  +H  S K ++++    K  SEK M       E++H   +DL            E   L  ++++L+ T Q      D ++ N+ SL  E E           +SL H       + DEI  ++  + +++ EL  AD  L  ++   +  +E+T   + K  DA+++  +   + EELE++++E ++ L KA  +L  +Q +   L   K+  EE++ +I  I+  KD++FQ ++++  +   +L  L+ D+ MA       +Q+L E + LL   R EL +LK++V   Q+ +  ++  +G +   + +    + +++   Q   RL +   +E+    RE   L   LE L  +K +L   I   + +   +K+ I+K+E++  V+  ++ K   + ++I  ML+++  +L  +  ++  R+ +LE+      ++ +E + L    +++  EI+  +Q +  D    +R+  +  +++  +  LSKEK  LQ +    +K+L    ++L   E  S++ ++ L  LE  V + + EL++++ +K S       L    +++ +QL E +  + S++E L  ++   +    ++    + Q  L  E  +LQ  I      F++   E + ++++   L  EI  + +++KL+++++    LQ     E++KLE        +  QL+ E+T++   L+   +K+  L  +  ++   E++ +   LE+ + Q +      EQ+  + S  L  + +       D + LR     E    +K+++ L++                      + KE+  +E +A+D   RA  L  +LNQ + +Y  L+ ++ 
Sbjct: 1255 PVPQGMALYAPPPPLPNNSRPLTPGTVVYGPPPAGAPMVYGP--PPPNFSIPFIPM--------GVLHCNVPEHHNLENEVSRLEDIMQHLKSKKREERWMRASKRQSEKEM-------EELHHNIDDL----------LQEKKSLECEVEELHRTVQKRQQQKDFIDGNVESLMTELEI---------EKSLKH----HEDIVDEIECIEKTLLKRRSELREADRLLAEAESELSCTKEKTKNAVEKFTDAKRSLLQTESDAEELERRAQETAVNLVKADQQLRSLQADAKDLEQHKIKQEEILKEINKIVAAKDSDFQCLSKKKEKLTEELQKLQKDIEMAERNEDHHLQVLKESEVLLQAKRAELEKLKSQVTSQQQEMAVLDRQLGHKKEELHLLQGSMVQAKADLQEALRLGETEVTEKCNHIREVKSL---LEELSFQKGELNVQISERKTQLTLIKQEIEKEEENLQVVLRQMSKHKTELKNILDMLQLENHELQGLKLQHDQRVSELEKTQVAVLEEKLELENLQQISQQQKGEIEWQKQLLERDKREIERMTAESRALQSCVECLSKEKEDLQEKCDIWEKKLAQTKRVLAAAEENSKMEQSNLEKLELNVRKLQQELDQLNRDKLS-------LHNDISAMQQQLQEKREAVNSLQEELANVQDHLNLAKQDLLHTTKHQDVLLSEQTRLQKDISEWANRFEDCQKEEETKQQQLQVLQNEI--EENKLKLVQQEMMFQRLQKERESEESKLETSKVTLKEQQHQLEKELTDQKSKLDQVLSKV--LAAEERVRTLQEEERWCESLEKTLSQTKRQLSEREQQLVEKSGELLALQKEADSMRADFSLLRNQFLTERKKAEKQVASLKEALKIQRSQLEKNLLEQKQENSCIQKEMATIELVAQDNHERARRLMKELNQMQYEYTELKKQMA 2141          
BLAST of centriolin vs. Ensembl Human
Match: CNTRL (centriolin [Source:HGNC Symbol;Acc:HGNC:1858])

HSP 1 Score: 187.578 bits (475), Expect = 1.246e-46
Identity = 123/327 (37.61%), Postives = 192/327 (58.72%), Query Frame = 1
Query:  133 GVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKK---QKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQA-YMGKGQF 1098
            GVRYITE  IK +  +D+L  IK LNL   K G KK +YIE+L+    + VL++ ++ I KIEKLDKL  LREL LS NKI +++G+EN+ NL+ L++ GN++  IP W  ++ K L  +N   N   S+++ISKL  L+DL+ L + ENPV  + HY  + +  L+ L  L+ + V   +++ A E+F   E++R+   L +   + EE+K  Q +  ++   QD+  K L ++   QK + E++K               +     RACQK YELEQ++AF KIDAKF+ L+ +  P       SE+++I    D++ Y+GK ++
Sbjct:   79 GVRYITEALIKKLTKQDNLALIKSLNLSLSKDGGKKFKYIENLEKCVKLEVLNLSYNLIGKIEKLDKLLKLRELNLSYNKISKIEGIENMCNLQKLNLAGNEIEHIPVWLGKKLKSLRVLNLKGNKISSLQDISKLKPLQDLISLILVENPVVTLPHYLQFTIFHLRSLESLEGQPVTTQDRQEAFERFSLEEVERLERDLEKKMIETEELKSKQTRFLEEIKNQDKLNKSLKEEAMLQKQSCEELKSDLNTKNELLKQKTIELT---RACQKQYELEQELAFYKIDAKFEPLNYY--P-------SEYAEIDKAPDESPYIGKSRY 393          

HSP 2 Score: 105.145 bits (261), Expect = 1.414e-21
Identity = 211/941 (22.42%), Postives = 435/941 (46.23%), Query Frame = 1
Query: 3397 SAPSNNPQFVQQQAMPPNNSPLPGATYI---PNGFLPQIHNSHSTPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLED---HFQNNGKHKSSWKLKQKF----KSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQ------DLLN-NISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSR---QVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNE----KKELESNLKILRKQE--SQVHET-LTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIF--DLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIF--ELEEIIKQQENNAHHYEQENRKLSNHLAVINR-------DLAALRQNHQFEMDNKDKELSRLRKR---------------------VAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIV 6042
              P     +     +P N+ PL   T +   P    P ++     P   ++P+  +        G L CNVPEHH LE+     ++  +H  S K ++++    K  SEK M       E++H   +DL            E   L  ++++L+ T Q      D ++ N+ SL  E E           +SL H       + DEI  ++  + +++ EL  AD  L  ++   +  +E+T   + K  DA+++  +   + EELE++++E ++ L KA  +L  +Q +   L   K+  EE++ +I  I+  KD++FQ ++++  +   +L  L+ D+ MA       +Q+L E + LL   R EL +LK++V   Q+ +  ++  +G +   + +    + +++   Q   RL +   +E+    RE   L   LE L  +K +L   I   + +   +K+ I+K+E++  V+  ++ K   + ++I  ML+++  +L  +  ++  R+ +LE+      ++ +E + L    +++  EI+  +Q +  D    +R+  +  +++  +  LSKEK  LQ +    +K+L    ++L   E  S++ ++ L  LE  V + + EL++++ +K S       L    +++ +QL E +  + S++E L  ++   +    ++    + Q  L  E  +LQ  I      F++   E + ++++   L  EI  + +++KL+++++    LQ     E++KLE        +  QL+ E+T++   L+   +K+  L  +  ++   E++ +   LE+ + Q +      EQ+  + S  L  + +       D + LR     E    +K+++ L++                      + KE+  +E +A+D   RA  L  +LNQ + +Y  L+ ++ 
Sbjct: 1255 PVPQGMALYAPPPPLPNNSRPLTPGTVVYGPPPAGAPMVYGP--PPPNFSIPFIPM--------GVLHCNVPEHHNLENEVSRLEDIMQHLKSKKREERWMRASKRQSEKEM-------EELHHNIDDL----------LQEKKSLECEVEELHRTVQKRQQQKDFIDGNVESLMTELEI---------EKSLKH----HEDIVDEIECIEKTLLKRRSELREADRLLAEAESELSCTKEKTKNAVEKFTDAKRSLLQTESDAEELERRAQETAVNLVKADQQLRSLQADAKDLEQHKIKQEEILKEINKIVAAKDSDFQCLSKKKEKLTEELQKLQKDIEMAERNEDHHLQVLKESEVLLQAKRAELEKLKSQVTSQQQEMAVLDRQLGHKKEELHLLQGSMVQAKADLQEALRLGETEVTEKCNHIREVKSL---LEELSFQKGELNVQISERKTQLTLIKQEIEKEEENLQVVLRQMSKHKTELKNILDMLQLENHELQGLKLQHDQRVSELEKTQVAVLEEKLELENLQQISQQQKGEIEWQKQLLERDKREIERMTAESRALQSCVECLSKEKEDLQEKCDIWEKKLAQTKRVLAAAEENSKMEQSNLEKLELNVRKLQQELDQLNRDKLS-------LHNDISAMQQQLQEKREAVNSLQEELANVQDHLNLAKQDLLHTTKHQDVLLSEQTRLQKDISEWANRFEDCQKEEETKQQQLQVLQNEI--EENKLKLVQQEMMFQRLQKERESEESKLETSKVTLKEQQHQLEKELTDQKSKLDQVLSKV--LAAEERVRTLQEEERWCESLEKTLSQTKRQLSEREQQLVEKSGELLALQKEADSMRADFSLLRNQFLTERKKAEKQVASLKEALKIQRSQLEKNLLEQKQENSCIQKEMATIELVAQDNHERARRLMKELNQMQYEYTELKKQMA 2141          
BLAST of centriolin vs. Ensembl Human
Match: CNTRL (centriolin [Source:HGNC Symbol;Acc:HGNC:1858])

HSP 1 Score: 105.531 bits (262), Expect = 1.189e-21
Identity = 210/935 (22.46%), Postives = 433/935 (46.31%), Query Frame = 1
Query: 3397 SAPSNNPQFVQQQAMPPNNSPLPGATYI---PNGFLPQIHNSHSTPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLED---HFQNNGKHKSSWKLKQKF----KSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTN-EIGRLNYQIDQLNYTKQDLLNNISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSR---QVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNE----KKELESNLKILRKQE--SQVHET-LTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIF--DLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIF--ELEEIIKQQENNAHHYEQENRKLSNHLAVINR-------DLAALRQNHQFEMDNKDKELSRLRKR---------------------VAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIV 6042
              P     +     +P N+ PL   T +   P    P ++     P   ++P+  +        G L CNVPEHH LE+     ++  +H  S K ++++    K  SEK M       E++H   +DL    +Q  K    E+  L+  + +    K  +  N+ SL  E E           +SL H       + DEI  ++  + +++ EL  AD  L  ++   +  +E+T   + K  DA+++  +   + EELE++++E ++ L KA  +L  +Q +   L   K+  EE++ +I  I+  KD++FQ ++++  +   +L  L+ D+ MA       +Q+L E + LL   R EL +LK++V   Q+ +  ++  +G +   + +    + +++   Q   RL +   +E+    RE   L   LE L  +K +L   I   + +   +K+ I+K+E++  V+  ++ K   + ++I  ML+++  +L  +  ++  R+ +LE+      ++ +E + L    +++  EI+  +Q +  D    +R+  +  +++  +  LSKEK  LQ +    +K+L    ++L   E  S++ ++ L  LE  V + + EL++++ +K S       L    +++ +QL E +  + S++E L  ++   +    ++    + Q  L  E  +LQ  I      F++   E + ++++   L  EI  + +++KL+++++    LQ     E++KLE        +  QL+ E+T++   L+   +K+  L  +  ++   E++ +   LE+ + Q +      EQ+  + S  L  + +       D + LR     E    +K+++ L++                      + KE+  +E +A+D   RA  L  +LNQ + +Y  L+ ++ 
Sbjct:  703 PVPQGMALYAPPPPLPNNSRPLTPGTVVYGPPPAGAPMVYGP--PPPNFSIPFIPM--------GVLHCNVPEHHNLENEVSRLEDIMQHLKSKKREERWMRASKRQSEKEM-------EELHHNIDDL----LQEKKSLECEVEELHRTVQKRQQQKDFIDGNVESLMTELEI---------EKSLKH----HEDIVDEIECIEKTLLKRRSELREADRLLAEAESELSCTKEKTKNAVEKFTDAKRSLLQTESDAEELERRAQETAVNLVKADQQLRSLQADAKDLEQHKIKQEEILKEINKIVAAKDSDFQCLSKKKEKLTEELQKLQKDIEMAERNEDHHLQVLKESEVLLQAKRAELEKLKSQVTSQQQEMAVLDRQLGHKKEELHLLQGSMVQAKADLQEALRLGETEVTEKCNHIREVKSL---LEELSFQKGELNVQISERKTQLTLIKQEIEKEEENLQVVLRQMSKHKTELKNILDMLQLENHELQGLKLQHDQRVSELEKTQVAVLEEKLELENLQQISQQQKGEIEWQKQLLERDKREIERMTAESRALQSCVECLSKEKEDLQEKCDIWEKKLAQTKRVLAAAEENSKMEQSNLEKLELNVRKLQQELDQLNRDKLS-------LHNDISAMQQQLQEKREAVNSLQEELANVQDHLNLAKQDLLHTTKHQDVLLSEQTRLQKDISEWANRFEDCQKEEETKQQQLQVLQNEI--EENKLKLVQQEMMFQRLQKERESEESKLETSKVTLKEQQHQLEKELTDQKSKLDQVLSKV--LAAEERVRTLQEEERWCESLEKTLSQTKRQLSEREQQLVEKSGELLALQKEADSMRADFSLLRNQFLTERKKAEKQVASLKEALKIQRSQLEKNLLEQKQENSCIQKEMATIELVAQDNHERARRLMKELNQMQYEYTELKKQMA 1589          
BLAST of centriolin vs. Ensembl Human
Match: PPP1R7 (protein phosphatase 1 regulatory subunit 7 [Source:HGNC Symbol;Acc:HGNC:9295])

HSP 1 Score: 66.6254 bits (161), Expect = 1.595e-10
Identity = 52/159 (32.70%), Postives = 87/159 (54.72%), Query Frame = 1
Query:  160 IKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKIN---FSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRL 627
            I+ I + D L  ++ L L    G  KI  +++LD L N+TVLS++ + + KIE L  L NLRELYLS N I  ++GLEN   L +LD+  N++  I +       +LT++     + N+ +S  ++ +L   + L  + +  NP+     YR  +++ L
Sbjct:  155 IRAIENIDTLTNLESLFL----GKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIEN-----ISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLAL 304          

HSP 2 Score: 52.7582 bits (125), Expect = 3.906e-6
Identity = 33/97 (34.02%), Postives = 61/97 (62.89%), Query Frame = 1
Query:  157 FIKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSI 447
             IK I + + L  +++L+L     D +I+ IE+L+ L  + +L I F+ +  IE +DKL  L++L+L  NKI +++ L NL  L++L++  N++ +I
Sbjct:   66 LIKCIENLEELQSLRELDL----YDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAI 158          
BLAST of centriolin vs. Ensembl Celegans
Match: sds-22 (Protein phosphatase 1 regulatory subunit SDS22 homolog [Source:UniProtKB/Swiss-Prot;Acc:P45969])

HSP 1 Score: 60.4622 bits (145), Expect = 5.645e-9
Identity = 54/163 (33.13%), Postives = 85/163 (52.15%), Query Frame = 1
Query:  190 DRIKKL-------NLD-CGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAA--IAHYRLYIVMRLKYLLILD 648
            +RIKK+       NLD    G  KIR +E ++ L  ++VLS+  + I KIE +++L NL+ELYLS+  +  + G+E L NL +LDV  N++ +       R + L     + N  +S  EI +L  LK L  + +  NP        YR  ++M L  +  +D
Sbjct:  157 NRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLSVLSLPGNRIVKIENVEQLNNLKELYLSDQGLQDIHGVEPLTNLLLLDVANNEIKTFSG--VERLESLNDFWANDNKVESFSEIEQLSKLKGLQTVYLERNPFYFNDTNQYRRKVMMTLTQVTQID 317          
BLAST of centriolin vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 58.5362 bits (140), Expect = 2.802e-8
Identity = 39/107 (36.45%), Postives = 63/107 (58.88%), Query Frame = 1
Query:  124 NPPGVRYITEEF--IKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQL 438
            N PG+R ++  +  +K I H   L  + +LNL+    D +I  +E+L+ L N+  L + ++ I KIE L +L NL EL+L  NKII ++GLE    +K L+   N++
Sbjct:   47 NTPGIRDLSLRWNLLKKIDHFQCLTSLTRLNLN----DNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFGDNRI 149          

HSP 2 Score: 53.5286 bits (127), Expect = 1.087e-6
Identity = 41/136 (30.15%), Postives = 76/136 (55.88%), Query Frame = 1
Query:  184 HLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAA 591
            HL  +++L L    G  +IR IE LD +  +  LS+  +A++ IE LD L  L+ + L++N I ++DGL  L NLK LD+  N +  + +    + K ++ +   +N  +  +++ +L  L++L  L +  NP+ +
Sbjct:  157 HLVNLERLFL----GANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKIDGLSGLTNLKSLDLNDNIIEKLEN--VEQFKGISSLMIRKNKLNCWQDVRQLKKLENLTVLTMEMNPLYS 286          
BLAST of centriolin vs. Ensembl Celegans
Match: C06A8.6 (pep chromosome:WBcel235:II:7772499:7773914:1 gene:WBGene00015516.1 transcript:C06A8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A8.6)

HSP 1 Score: 53.1434 bits (126), Expect = 1.286e-6
Identity = 37/105 (35.24%), Postives = 60/105 (57.14%), Query Frame = 1
Query:  169 IAHEDHL----DRIKKL-NLDCGKG-------DKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSI 447
            + H +H     + IKK+ NLDC          D +I  +E+LD+L N+  L + F+ I KIE L+KL  L+ L+   NKI +++GL+ L  L+ L++  N++  I
Sbjct:   53 LTHVEHFSFRWNLIKKIENLDCLTTLTHLEFYDNQITKVENLDSLVNLESLDLSFNRITKIENLEKLTKLKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKI 157          
BLAST of centriolin vs. Ensembl Fly
Match: sds22 (gene:FBgn0028992 transcript:FBtr0083436)

HSP 1 Score: 58.5362 bits (140), Expect = 2.939e-8
Identity = 46/127 (36.22%), Postives = 67/127 (52.76%), Query Frame = 1
Query:  226 GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYR 606
            G  KI  IE+LD L N+ +LS++ + I KIE L+KL NLRELY+SEN +  ++ L     L+ LD+  N+L  I +           +N   N  D  ++I  L   K L  + +  NP+A    YR
Sbjct:  179 GKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLN--HNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYR 303          

HSP 2 Score: 58.151 bits (139), Expect = 4.051e-8
Identity = 35/99 (35.35%), Postives = 65/99 (65.66%), Query Frame = 1
Query:  235 KIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEIS 531
            +I  IE+LD L N+T+L +  + ++KIE ++ L NLR+L+L +NKI +++ L+ L+NL+IL ++ N++  I +    +   L ++  S N  ++IE +S
Sbjct:  138 RITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENL--EKLANLRELYVSENGVETIENLS 234          

HSP 3 Score: 52.373 bits (124), Expect = 2.746e-6
Identity = 30/73 (41.10%), Postives = 48/73 (65.75%), Query Frame = 1
Query:  229 DKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSI 447
            D +I  IE+LD+L ++ VL I F+ + KIE LDKL  L ++Y   N+I +++ L+ L NL +L++  N+L  I
Sbjct:   92 DNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKI 164          

HSP 4 Score: 51.2174 bits (121), Expect = 6.467e-6
Identity = 49/147 (33.33%), Postives = 77/147 (52.38%), Query Frame = 1
Query:  121 MNPPGVRYITEEFIKIIAHED--HLDRIKKLNLDCGKGDKKIRYIEHLDN---LNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTL 546
            MN P     T   I++I  ED   ++ I  ++ DC + D   R IE L+N   L  I  L +R++ I+KIE L  L  L EL L +N+I +++ L++L +L++LD+  N+L  I +    +   L K+ F  N    IE +  L  L
Sbjct:    8 MNEPEAAK-TVSGIQVIPAEDVASIEDIITIDPDCYELDLNHRRIEKLENFEPLTRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENL--DKLVKLEKVYFVSNRITQIENLDMLTNL 151          
BLAST of centriolin vs. Ensembl Fly
Match: TbCMF46 (gene:FBgn0032163 transcript:FBtr0079898)

HSP 1 Score: 56.6102 bits (135), Expect = 2.803e-7
Identity = 48/153 (31.37%), Postives = 82/153 (53.59%), Query Frame = 1
Query:  190 DRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVA-----AIAHYRLYIVMRLKY 633
            DRI  + L+     K I  I+HL  + N+T L +  + IE IE L+ L  L++L LS N I R++ LE L+ L+ L +  N++  I +  T   + L  ++   N+ D++E I +L  +  L  L++  NP+A      ++ Y + I+ +L Y
Sbjct:   67 DRITTMRLEF----KNILRIDHLWMMPNLTKLCLNCNKIEVIEHLEMLTALKDLNLSFNYITRIENLEKLVKLEKLSLFSNRIRKIENIHT--LQNLVILSIGNNLIDTVEGIERLRFVSSLKVLNLEGNPIAKQPDFPLSLYVIAILPQLNY 213          
BLAST of centriolin vs. Ensembl Fly
Match: Ppr-Y (gene:FBgn0046697 transcript:FBtr0346721)

HSP 1 Score: 54.6842 bits (130), Expect = 1.004e-6
Identity = 40/130 (30.77%), Postives = 74/130 (56.92%), Query Frame = 1
Query:  247 IEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYL 636
            I+HL  L N+T L +  + IE IE ++ L NL++L LS N I +++ L+ L+NL++L +  N++ +I +        L  I+   N+ D++E I +   + +L  +++  NP+A   ++ L     LKY+
Sbjct:   74 IDHLWILPNLTKLCLNCNKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIEN--IDMLTMLVIISLGNNLIDTVEGIERFRFMNNLKIINLEGNPIAKRTNFCL-----LKYI 196          
BLAST of centriolin vs. Ensembl Zebrafish
Match: lrrc23 (leucine rich repeat containing 23 [Source:ZFIN;Acc:ZDB-GENE-041010-153])

HSP 1 Score: 72.0182 bits (175), Expect = 1.917e-12
Identity = 53/161 (32.92%), Postives = 88/161 (54.66%), Query Frame = 1
Query:  196 IKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXV-SENPVAAIAHYRLYIVMRLKYLLILDNREVLADEK 675
            ++ LNL  G G + ++ ++H  NL N+  L +R + +E  + +  L NLR LYL++N I +L+GLE L  L  L +R NQL ++    +   K L  +N   N+  S+  +  L ++   L   V  +NP+A    YRLY++ +L +L  +D   V  +EK
Sbjct:  151 LETLNL-TGNGIQTMQGLDH-PNLTNLVTLELRGNCLETTDGI-YLPNLRHLYLAQNNIKKLEGLEKLERLITLHLRHNQLETL-DGLSASMKCLEYLNVRGNLISSMRALQTLASVGQTLKALVLLDNPIAKTDDYRLYVISQLPHLERVDKDPVTPEEK 307          
BLAST of centriolin vs. Ensembl Zebrafish
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 67.781 bits (164), Expect = 4.634e-11
Identity = 56/177 (31.64%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  160 IKIIAHEDHLDRIKKLNLDCGK------------------GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKIN---FSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRL 627
            I  IA+ DHL  ++ L L   +                  G  KI  +++LD L+N+TVLSI+ + I K+E L  L NLRELYLS N I  ++GLEN   L  LD+  N++  I +       +LT +     + N  ++  ++ +L   K L  + +  NP+     YR  I++ L
Sbjct:  161 IASIANLDHLTSLQMLELGSNRIRVIENLDSLSSLESLFLGTNKITQLQNLDGLHNLTVLSIQSNRITKLEGLQNLVNLRELYLSHNGIEVMEGLENNKKLSTLDIAANRIKKIEN-----ISHLTDLKEFWMNDNQIENWADLDELKNAKGLETVYLERNPLQKDPQYRRKIMLAL 332          
BLAST of centriolin vs. Ensembl Zebrafish
Match: lrguk (leucine-rich repeats and guanylate kinase domain containing [Source:ZFIN;Acc:ZDB-GENE-050419-232])

HSP 1 Score: 67.781 bits (164), Expect = 1.269e-10
Identity = 48/161 (29.81%), Postives = 94/161 (58.39%), Query Frame = 1
Query:  247 IEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSR 729
            I  L+    ++ LS+  + I +I  LD L  LREL L+ N I +++ L+ L NL++LD+  N++ S+     +  ++L  +N   N+   I+E + L  L  L ++++ +NPV     YR+ ++  L++L++LD + V A+EK  A+ +++   L+ +++R
Sbjct:  131 IRGLEKCKRLSHLSLAHNNISRIRGLDHL-PLRELCLAGNMINKIENLQTLHNLQVLDLSCNRIQSL--TGLQNLRFLGTVNLESNLITEIKEAAHLHDLILLREINLLKNPVQDHDDYRIAVIFLLQHLILLDKQTVTAEEKVAAVNKYDP-PLEVVAAR 287          
BLAST of centriolin vs. Ensembl Zebrafish
Match: cntrl (centriolin [Source:ZFIN;Acc:ZDB-GENE-120608-3])

HSP 1 Score: 61.2326 bits (147), Expect = 1.624e-8
Identity = 94/494 (19.03%), Postives = 219/494 (44.33%), Query Frame = 1
Query: 3436 AMPPNN----SPLPGATYIPNGFLPQIHNSHSTPI-LNTVPYSSIVTSEMKNAGSLFCNVPEHHYLEDHFQNNGKHKSSWKLKQKF--KSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDE 4896
            A PP +      +PG   +P G    ++     P  L   P  + +T  +  +G+L CNVP H  LE   +     K+  +L+++   ++ SE+   TL                         ++   L  +I  L  T + L  + S L                 +L H    +  L  E+  ++  + +++ EL  AD  L  +       Q +T E +  +++A+K  ++   E  E+EK+++++   L ++  +L  +Q E   L   K + E  +   + ++   D++FQ ++ ++ RA  +L   + +L        + +Q   E +  L+  + +L+ +  +V+L Q+ L  ++  + +     ++    +E+ RQ    ++++ + +   +++   +L+ ++ +L  +K +L   +   + +  Q+K++  ++E++   L+S ++K   +   +  M++++ G+L+ V  +   +L  LE+  E
Sbjct:   22 AFPPGSFIYSHSVPG---LPIGASTVLYGPPPDPARLVYGPPPANLTVPLVPSGTLHCNVPGHQDLERDLK-----KAERRLREECADRAHSEQEQHTLQ------------------------DKTAELQQEIKHLRRTVRTLQRHTSGL---------------ESTLSHAEEEQCVLG-EVECLEKTLLKRRAELREADRRLLEADAQLKNTQTKTEENIHHYNEAKKRMEETERELAEIEKRAQDSGKLLVQSKQQLRSLQEEVMTLQKRKEDKERSLHDAEEVLTCHDSKFQDVSRKLERANDRLEIAEKELRETQSMEVKLLQSCREMENSLAQRKTKLDEVNTQVMLQQKELSLLDRKLEQWKREEEVLRVSVEQHRQALLDVLRQGEEDAKLLQQRVQELRVDVHSLAVQKGELDSQLSERKTRLAQLKKDQQQEEETLQSLRSVIKKHKAELARMLEMIQLETGELEDVKLQCNQKLEQLEKSQE 467          
BLAST of centriolin vs. Ensembl Zebrafish
Match: cntrl (centriolin [Source:ZFIN;Acc:ZDB-GENE-120608-3])

HSP 1 Score: 61.2326 bits (147), Expect = 1.741e-8
Identity = 97/494 (19.64%), Postives = 219/494 (44.33%), Query Frame = 1
Query: 3436 AMPPNN----SPLPGATYIPNGFLPQIHNSHSTPI-LNTVPYSSIVTSEMKNAGSLFCNVPEHHYLEDHFQNNGKHKSSWKLKQKF--KSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDE 4896
            A PP +      +PG   +P G    ++     P  L   P  + +T  +  +G+L CNVP H  LE   +     K+  +L+++   ++ SE+   TL                         ++   L  +I  L  T + L  + S L         E        LG +      L   + K  + +RE    L  AD +LKN++        +T E +  +++A+K  ++   E  E+EK+++++   L ++  +L  +Q E   L   K + E  +   + ++   D++FQ ++ ++ RA  +L   + +L        + +Q   E +  L+  + +L+ +  +V+L Q+ L  ++  + +     ++    +E+ RQ    ++++ + +   +++   +L+ ++ +L  +K +L   +   + +  Q+K++  ++E++   L+S ++K   +   +  M++++ G+L+ V  +   +L  LE+  E
Sbjct:  284 AFPPGSFIYSHSVPG---LPIGASTVLYGPPPDPARLVYGPPPANLTVPLVPSGTLHCNVPGHQDLERDLK-----KAERRLREECADRAHSEQEQHTLQ------------------------DKTAELQQEIKHLRRTVRTLQRHTSGLESTLSHAEEEQCV-----LGEVEC----LEKTLLKRRAELREADRRLLEADAQLKNTQT-------KTEENIHHYNEAKKRMEETERELAEIEKRAQDSGKLLVQSKQQLRSLQEEVMTLQKRKEDKERSLHDAEEVLTCHDSKFQDVSRKLERANDRLEIAEKELRETQSMEVKLLQSCREMENSLAQRKTKLDEVNTQVMLQQKELSLLDRKLEQWKREEEVLRVSVEQHRQALLDVLRQGEEDAKLLQQRVQELRVDVHSLAVQKGELDSQLSERKTRLAQLKKDQQQEEETLQSLRSVIKKHKAELARMLEMIQLETGELEDVKLQCNQKLEQLEKSQE 729          
BLAST of centriolin vs. Ensembl Xenopus
Match: CNTRL (centriolin [Source:NCBI gene;Acc:100270771])

HSP 1 Score: 171.785 bits (434), Expect = 6.781e-42
Identity = 121/336 (36.01%), Postives = 200/336 (59.52%), Query Frame = 1
Query:   94 FIFQISVILMNPPGVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQAYMGKGQF 1098
             + Q    + N  GVRYITE  I+    +++L  +  LNL   K G KK ++IE+L+    + VL++  + IEKIEKL+K   LREL L+ NKI +++  E++ NLK L++ GN++  IP W  ++ K LT +N   N   S++++S+L  LKDL  L +S+NPV+ + HYRLY V  L+ L  LD + V   E++ A E+F   EL+++   L +   +++E++  + K+  +   QD+  + L ++     +  K+LE+ +++K+ +LK+K+ +L RACQK YELEQ++AF KIDAKF+ L      ++E             G+  Y+GK ++
Sbjct:   24 ILIQWVQFICNEVGVRYITESLIQKQTKQENLAYVTSLNLCLAKEGGKKFKFIENLEKCERLEVLNLSHNLIEKIEKLEKQIRLRELNLAYNKISKIEHFEHMQNLKKLNLAGNEIEHIPVWVGKKLKSLTALNLKENRISSLQDVSRLKPLKDLTTLSLSDNPVSNLPHYRLYTVFHLRSLNSLDAQPVTNQERQEAHERFNLEELEKLERELEKKISEIDELQNQKAKITGELQNQDELNRSLKQEALQQKKSYKELEQEMETKNEILKQKTVELKRACQKQYELEQELAFYKIDAKFEPLGYFESEVKE----------DVPGESPYIGKARY 349          

HSP 2 Score: 110.923 bits (276), Expect = 2.329e-23
Identity = 122/570 (21.40%), Postives = 261/570 (45.79%), Query Frame = 1
Query: 3427 QQQAMPPNNSP----LPGATYIPNGFL--------------PQIHNSHSTPILNTVPYSSI---VTSEMKNAGSLFCNVPEHHYLEDHFQNNGKHKSSWKLKQKFKSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKS 5073
            Q+  MPP  S     LP  T  P G +              P        P+   + Y       T  +  AG L CNVP HH LE+             +    KS   K   + + L+EDI    +DL++ +  + K+  E+     +  + N+       +I +L  E E           +SL H      ++ DEI  ++  + +++ EL  AD  L  ++      + +TT+ + K+  A+K+      + EELE++++E + +L KA  +L ++Q     L   +   E ++ +I S++++KD+EFQ + ++I      L  L +D+ +   +    +Q L E + LL + +  L R+  +V   Q+ +  M+  +G++   + +    I+  +     ++++ + + A  ++E  ++K  LE+L  +K +L   +   + +  ++K+ I ++E +   L S++ KL  + +H+  M++++  +L  +  ++  ++ ++E I     +  +E + L    +R   E+++ RQ +  D    + L     +++ ++++L  +K+
Sbjct: 1171 QRHFMPPAGSVIYTVLPDGTPAPQGTVVYGPPPPSSGRPVAPGTVIYGPPPVGTQIIYGPPPPHFTIPVIPAGVLHCNVPGHHNLENEL------TRLEDIIDHLKSRRHKEKRSKERLQEDI----DDLEHQKEILRKEVEELRVSGQRRKRKNFVD----GHIGTLITELEL---------EKSLQH----HDEIEDEIGCIEKTLLKRRAELREADRLLAEAEAELQSTRAKTTDIIEKYTCAKKHLSTTESDAEELERRAQETARQLVKADQQLRMLQRSACDLEQHRAEQESMLTEINSVVSEKDSEFQALGKKIDTMTESLQKLHADIQVVAAKEANHLQALKEAESLLQEKKAVLERIDEQVYAQQQDIAGMDRLLGQKKEELHLLQDHIDHKKADLKEVLRDGELDVADCRQEIQEVKSLLEDLSAQKGELNAQVSEKKAQLGRLKQEILQEEDNLQTLASQINKLKSELKHVLEMVQLENNELQGLKLQHNQKVDEMENIQTTLLEGKLELENLQRTSQRLNGEVERQRQVLEKDHREMELLMTQMHTLQENVASLGSDKA 1713          
BLAST of centriolin vs. Ensembl Xenopus
Match: CNTRL (centriolin [Source:NCBI gene;Acc:100270771])

HSP 1 Score: 170.629 bits (431), Expect = 1.823e-41
Identity = 120/326 (36.81%), Postives = 197/326 (60.43%), Query Frame = 1
Query:  124 NPPGVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQAYMGKGQF 1098
            N  GVRYITE  I+    +++L  +  LNL   K G KK ++IE+L+    + VL++  + IEKIEKL+K   LREL L+ NKI +++  E++ NLK L++ GN++  IP W  ++ K LT +N   N   S++++S+L  LKDL  L +S+NPV+ + HYRLY V  L+ L  LD + V   E++ A E+F   EL+++   L +   +++E++  + K+  +   QD+  + L ++     +  K+LE+ +++K+ +LK+K+ +L RACQK YELEQ++AF KIDAKF+ L      ++E             G+  Y+GK ++
Sbjct:   45 NEVGVRYITESLIQKQTKQENLAYVTSLNLCLAKEGGKKFKFIENLEKCERLEVLNLSHNLIEKIEKLEKQIRLRELNLAYNKISKIEHFEHMQNLKKLNLAGNEIEHIPVWVGKKLKSLTALNLKENRISSLQDVSRLKPLKDLTTLSLSDNPVSNLPHYRLYTVFHLRSLNSLDAQPVTNQERQEAHERFNLEELEKLERELEKKISEIDELQNQKAKITGELQNQDELNRSLKQEALQQKKSYKELEQEMETKNEILKQKTVELKRACQKQYELEQELAFYKIDAKFEPLGYFESEVKE----------DVPGESPYIGKARY 360          

HSP 2 Score: 123.25 bits (308), Expect = 4.306e-27
Identity = 197/928 (21.23%), Postives = 417/928 (44.94%), Query Frame = 1
Query: 3427 QQQAMPPNNSP----LPGATYIPNGFL--------------PQIHNSHSTPILNTVPYSSI---VTSEMKNAGSLFCNVPEHHYLEDHFQNNGKHKSSWKLKQKFKSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKCSETIKR-----DELKTQSNS-------VSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDL---QNNVSKEDNKLEKILKNSSFELAQLKSE---ITEKLENLEASGTKLHQLKK-DAAIKE---FTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINRDLAALRQN--------------HQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRI 6039
            Q+  MPP  S     LP  T  P G +              P        P+   + Y       T  +  AG L CNVP HH LE+             +    KS   K   + + L+EDI    +DL++ +  + K+  E+     +  + N+       +I +L  E E           +SL H      ++ DEI  ++  + +++ EL  AD  L  ++      + +TT+ + K+  A+K+      + EELE++++E + +L KA  +L ++Q     L   +   E ++ +I S++++KD+EFQ + ++I      L  L +D+ +   +    +Q L E + LL + +  L R+  +V   Q+ +  M+  +G++   + +    I+  +     ++++ + + A  ++E  ++K  LE+L  +K +L   +   + +  ++K+ I ++E +   L S++ KL  + +H+  M++++  +L  +  ++  ++ ++E I     +  +E + L    +R   E+++ RQ +  D    + L     +++ ++++L  +K+ ++   ++LE  L       +Q  +TL A E     + +  EK+ SE     IKR     D+L  Q +S       V +Q+ +   EL  +K+ L            ++R   + +  +  E   LQ  I  ++  +  L  +  R++++ + L + I +K  E++  ++ + DL   +  + +   KL++  +   +ELA  K+    +  K+  LE    +L Q +K  AA++E    T  ++ E E+ ++++ +     ++E          +   LA+ R+N               + E +   +E  + +  + K++  +E+ A D   RA  L  +L Q + ++ +LRN++
Sbjct: 1145 QRHFMPPAGSVIYTVLPDGTPAPQGTVVYGPPPPSSGRPVAPGTVIYGPPPVGTQIIYGPPPPHFTIPVIPAGVLHCNVPGHHNLENELTR------LEDIIDHLKSRRHKEKRSKERLQEDI----DDLEHQKEILRKEVEELRVSGQRRKRKNFVD----GHIGTLITELEL---------EKSLQH----HDEIEDEIGCIEKTLLKRRAELREADRLLAEAEAELQSTRAKTTDIIEKYTCAKKHLSTTESDAEELERRAQETARQLVKADQQLRMLQRSACDLEQHRAEQESMLTEINSVVSEKDSEFQALGKKIDTMTESLQKLHADIQVVAAKEANHLQALKEAESLLQEKKAVLERIDEQVYAQQQDIAGMDRLLGQKKEELHLLQDHIDHKKADLKEVLRDGELDVADCRQEIQEVKSLLEDLSAQKGELNAQVSEKKAQLGRLKQEILQEEDNLQTLASQINKLKSELKHVLEMVQLENNELQGLKLQHNQKVDEMENIQTTLLEGKLELENLQRTSQRLNGEVERQRQVLEKDHREMELLMTQMHTLQENVASLGSDKARVEESSQQLEKKL-------AQATKTLAATEENNRAASSNAEKLASE-----IKRLQKEIDQLHKQKHSLRQEGSVVQQQVQDRTDELNLLKDELNDTREGAWLAPQDLRNATRARDEMLREKTTLQAAIEESSARYKSLQDKEARKEQQLSHLQRAIEEKEGEMEKHDQVLRDLDIQEQQLKESTAKLKEHRQALEWELANRKTSLEMLNSKVNALEERALQLQQEEKWSAALEESLRSTRHQLEEKEQALREKASELAEMQKEAEISKADSGRVREQLASQRKNDEKRILLLKDAVKKQRAEYEQAMQEEKQEKNNLQKQLISVEQAAYDNHERAKRLMRELKQLQSEHTVLRNQV 2033          
BLAST of centriolin vs. Ensembl Xenopus
Match: CNTRL (centriolin [Source:NCBI gene;Acc:100270771])

HSP 1 Score: 169.088 bits (427), Expect = 5.116e-41
Identity = 119/323 (36.84%), Postives = 196/323 (60.68%), Query Frame = 1
Query:  133 GVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQAYMGKGQF 1098
            GVRYITE  I+    +++L  +  LNL   K G KK ++IE+L+    + VL++  + IEKIEKL+K   LREL L+ NKI +++  E++ NLK L++ GN++  IP W  ++ K LT +N   N   S++++S+L  LKDL  L +S+NPV+ + HYRLY V  L+ L  LD + V   E++ A E+F   EL+++   L +   +++E++  + K+  +   QD+  + L ++     +  K+LE+ +++K+ +LK+K+ +L RACQK YELEQ++AF KIDAKF+ L      ++E             G+  Y+GK ++
Sbjct:   10 GVRYITESLIQKQTKQENLAYVTSLNLCLAKEGGKKFKFIENLEKCERLEVLNLSHNLIEKIEKLEKQIRLRELNLAYNKISKIEHFEHMQNLKKLNLAGNEIEHIPVWVGKKLKSLTALNLKENRISSLQDVSRLKPLKDLTTLSLSDNPVSNLPHYRLYTVFHLRSLNSLDAQPVTNQERQEAHERFNLEELEKLERELEKKISEIDELQNQKAKITGELQNQDELNRSLKQEALQQKKSYKELEQEMETKNEILKQKTVELKRACQKQYELEQELAFYKIDAKFEPLGYFESEVKE----------DVPGESPYIGKARY 322          

HSP 2 Score: 117.857 bits (294), Expect = 1.691e-25
Identity = 200/938 (21.32%), Postives = 423/938 (45.10%), Query Frame = 1
Query: 3427 QQQAMPPNNSP----LPGATYIPNGFL--------------PQIHNSHSTPILNTVPYSSI---VTSEMKNAGSLFCNVPEHHYLEDHFQNNGKHKSSWKLKQKFKSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKCSETIKR-----DELKTQSNSVSKQLHESKCELQSIKERLIMIEAQC-DERTS------EIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQ--NNVSKEDNKLEKILKNSSFELAQ----LKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINRD--------------LAALRQN--------------HQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRI 6039
            Q+  MPP  S     LP  T  P G +              P        P+   + Y       T  +  AG L CNVP HH LE+             +    KS   K   + + L+EDI    +DL++ +  + K+  E+     +  + N+       +I +L  E E           +SL H      ++ DEI  ++  + +++ EL  AD  L  ++      + +TT+ + K+  A+K+      + EELE++++E + +L KA  +L ++Q     L   +   E ++ +I S++++KD+EFQ + ++I      L  L +D+ +   +    +Q L E + LL + +  L R+  +V   Q+ +  M+  +G++   + +    I+  +     ++++ + + A  ++E  ++K  LE+L  +K +L   +   + +  ++K+ I ++E +   L S++ KL  + +H+  M++++  +L  +  ++  ++ ++E I     +  +E + L    +R   E+++ RQ +  D    + L     +++ ++++L  +K+ ++   ++LE  L       +Q  +TL A E     + +  EK+ SE     IKR     D+L  Q +S+ +   E     Q ++ +L +++ +  D R        ++R   + +  +  E   LQ  I  ++  +  L  +  R++++ + L + I +K  E++ L    F  Q    V ++ +  E+ LK S+ +L +    L+ E+  +  +LE   +K++ L++ A   +  E+    LEE ++   +     EQ  R+ ++ LA + ++              LA+ R+N               + E +   +E  + +  + K++  +E+ A D   RA  L  +L Q + ++ +LRN++
Sbjct: 1161 QRHFMPPAGSVIYTVLPDGTPAPQGTVVYGPPPPSSGRPVAPGTVIYGPPPVGTQIIYGPPPPHFTIPVIPAGVLHCNVPGHHNLENELTR------LEDIIDHLKSRRHKEKRSKERLQEDI----DDLEHQKEILRKEVEELRVSGQRRKRKNFVD----GHIGTLITELEL---------EKSLQH----HDEIEDEIGCIEKTLLKRRAELREADRLLAEAEAELQSTRAKTTDIIEKYTCAKKHLSTTESDAEELERRAQETARQLVKADQQLRMLQRSACDLEQHRAEQESMLTEINSVVSEKDSEFQALGKKIDTMTESLQKLHADIQVVAAKEANHLQALKEAESLLQEKKAVLERIDEQVYAQQQDIAGMDRLLGQKKEELHLLQDHIDHKKADLKEVLRDGELDVADCRQEIQEVKSLLEDLSAQKGELNAQVSEKKAQLGRLKQEILQEEDNLQTLASQINKLKSELKHVLEMVQLENNELQGLKLQHNQKVDEMENIQTTLLEGKLELENLQRTSQRLNGEVERQRQVLEKDHREMELLMTQMHTLQENVASLGSDKARVEESSQQLEKKL-------AQATKTLAATEENNRAASSNAEKLASE-----IKRLQKEIDQLHKQKHSLRQ---EGSVVQQQVQGKLNLLKDELNDTREGAWLAPQDLRNATRARDEMLREKTTLQAAIEESSARYKSLQDKEARKEQQLSHLQRAIEEK--EVRFL----FGPQVLKQVLRDLDIQEQQLKESTAKLKEHRQALEWELANRKTSLEMLNSKVNALEERALQLQQEEKWSAALEESLRSTRHQLEEKEQALREKASELAEMQKEAEISKADSGRVREQLASQRKNDEKRILLLKDAVKKQRAEYEQAMQEEKQEKNNLQKQLISVEQAAYDNHERAKRLMRELKQLQSEHTVLRNQV 2050          
BLAST of centriolin vs. Ensembl Xenopus
Match: lrrc23 (leucine rich repeat containing 23 [Source:NCBI gene;Acc:549279])

HSP 1 Score: 70.0922 bits (170), Expect = 1.397e-11
Identity = 55/154 (35.71%), Postives = 85/154 (55.19%), Query Frame = 1
Query:  193 RIKKLNLDCGKGDKKIRYIEHLD--NLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILD 648
            R++ LNL       ++R +E L+  NL+++  L +R + +     L+ L +LRELYL +N I RL+GLE L+NL  L +R NQL S+   F+   + L  +N   NM   ++E+ KL+ L  L  L + ENP      YR+  ++ L  L  LD
Sbjct:  175 RLETLNLI----GNELRDLEGLECSNLSSLHTLELRSNQLLSTAGLN-LPSLRELYLGQNNISRLEGLEALVNLTTLHLRDNQLESL-DGFSEHLQALQYLNLRSNMVAKLQEVQKLYCLPRLRALVLRENPCEEEEGYRMETLIALPQLERLD 322          
BLAST of centriolin vs. Ensembl Xenopus
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:448394])

HSP 1 Score: 66.2402 bits (160), Expect = 2.703e-10
Identity = 50/156 (32.05%), Postives = 85/156 (54.49%), Query Frame = 1
Query:  160 IKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRL 627
            +++I + D L  +  L L    G  KI  +++L+ L N+TVLS++ + + KIE L  L NLRELYLS+N I  ++GLEN   L  LD+  N++  I +   +    L +   + N+ ++  ++ +L     L  + +  NP+   A YR  I++ L
Sbjct:  205 LRVIENLDSLRELDSLFL----GKNKITKLQNLETLTNLTVLSVQSNRLTKIEGLQNLVNLRELYLSDNGIQVIEGLENNNKLTTLDLASNRIKRIEN--IKHLSELQEFWMNDNLVENWSDLEELSGAPGLQTVYLERNPLQKDAQYRRKIMLAL 354          

HSP 2 Score: 53.1434 bits (126), Expect = 3.344e-6
Identity = 61/210 (29.05%), Postives = 104/210 (49.52%), Query Frame = 1
Query:  157 FIKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEEN----ELDRMSSRL--LETEKQLEEMKE 768
             IK+I + + L  + +L+L     D +IR I +L+ L ++ +L + F+ + +IE L+ L +L+ LYL  NKI R++    L  L++L++  N+L  I +  + R   L  +   +N    I ++  L TL +L  L V  N +  I   +  + +R  Y         L+D     IE  E N     LD  S+R+  +E  K L E++E
Sbjct:  116 LIKLIENLEQLVTLTELDL----YDNQIRKIGNLETLRDLQILDLSFNLLRRIEGLESLSHLQRLYLVNNKISRIENFGTLTQLRLLELGSNRLRVIENLDSLR--ELDSLFLGKN---KITKLQNLETLTNLTVLSVQSNRLTKIEGLQNLVNLRELY---------LSDNGIQVIEGLENNNKLTTLDLASNRIKRIENIKHLSELQE 307          
BLAST of centriolin vs. Ensembl Mouse
Match: Cntrl (centriolin [Source:MGI Symbol;Acc:MGI:1889576])

HSP 1 Score: 192.971 bits (489), Expect = 3.216e-51
Identity = 129/324 (39.81%), Postives = 202/324 (62.35%), Query Frame = 1
Query:  133 GVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQA-YMGKGQF 1098
            GVRYITE  IK +  +D+L  +K LNL   K G KK RYIE+L+    + VL++ ++ I KIEK+DKL  LREL LS NKI +++GLEN+ NL+ L++ GN++  IP WF ++ K L  +N   N   S++++SKL  L+DL  L + +NPV A+ HY  +I+  L+ L  L+ + V   +++ A E+F   E++R+   L +   + EE+K  Q K  ++   QD+  K L ++     +  ++LE +L +K  LLK+K+ +L RACQK YELEQ++AF KIDAKF+ L+ +          SE+++I    D++ Y+GK ++
Sbjct:   79 GVRYITEALIKKLTKQDNLALVKSLNLSLSKDGGKKFRYIENLEKCVKLEVLNLSYNLIVKIEKVDKLLRLRELNLSYNKISKIEGLENMCNLQKLNLAGNEIEHIPVWFAKKLKSLRVLNLKGNKISSLQDVSKLKPLQDLTSLVLIDNPVVALPHYLQFIIFHLRSLESLEGQPVTTQDRQEAFERFSLEEIERLEKDLEKKTVETEELKNKQTKFLEEIKNQDKLNKSLKEEAMLQKQSCEELESDLSTKKELLKQKTVELTRACQKQYELEQELAFYKIDAKFEPLNYY---------PSEYAEIDKYPDESPYIGKSRY 393          
BLAST of centriolin vs. Ensembl Mouse
Match: Cntrl (centriolin [Source:MGI Symbol;Acc:MGI:1889576])

HSP 1 Score: 193.741 bits (491), Expect = 1.175e-48
Identity = 130/327 (39.76%), Postives = 204/327 (62.39%), Query Frame = 1
Query:  133 GVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKK---QKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQA-YMGKGQF 1098
            GVRYITE  IK +  +D+L  +K LNL   K G KK RYIE+L+    + VL++ ++ I KIEK+DKL  LREL LS NKI +++GLEN+ NL+ L++ GN++  IP WF ++ K L  +N   N   S++++SKL  L+DL  L + +NPV A+ HY  +I+  L+ L  L+ + V   +++ A E+F   E++R+   L +   + EE+K  Q K  ++   QD+  K L ++   QK + E+++    +L +K  LLK+K+ +L RACQK YELEQ++AF KIDAKF+ L+ +          SE+++I    D++ Y+GK ++
Sbjct:   79 GVRYITEALIKKLTKQDNLALVKSLNLSLSKDGGKKFRYIENLEKCVKLEVLNLSYNLIVKIEKVDKLLRLRELNLSYNKISKIEGLENMCNLQKLNLAGNEIEHIPVWFAKKLKSLRVLNLKGNKISSLQDVSKLKPLQDLTSLVLIDNPVVALPHYLQFIIFHLRSLESLEGQPVTTQDRQEAFERFSLEEIERLEKDLEKKTVETEELKNKQTKFLEEIKNQDKLNKSLKEEAMLQKQSCEELE---SDLSTKKELLKQKTVELTRACQKQYELEQELAFYKIDAKFEPLNYYP---------SEYAEIDKYPDESPYIGKSRY 393          

HSP 2 Score: 130.954 bits (328), Expect = 1.338e-29
Identity = 208/939 (22.15%), Postives = 429/939 (45.69%), Query Frame = 1
Query: 3415 PQFVQQQAMPPNNSPLPG--ATYIPNGFLPQIHNSH--------------STPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLED---HFQNNGKH-KSSWKLKQKFKSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNN-ISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQN-----EKKELESNLKILRKQESQVHE--TLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNK-------LEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINR-------DLAALRQNHQFEMDNKDKELSRLRKRVA---------------------KEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIV 6042
            P ++    +P + SP+P   A Y P+  LP  ++SH                PI+   P ++     +  AG   CN+PEHH LE+     ++  +H KS  + +++ K+ ++     +D L  DI    +DL    +Q  K+        ++  + +  ++D ++  + +L  E E           +SL H       + DEI  ++  + +++ EL  AD  L  ++      +E+T   + K  DA++N  +   + E LEK+++E +L L KA  +L ++Q +   L   K+  EE++ +I  ++  KD +FQ +NE+  +   +L SL+ D+  A       +Q+L E + LL   R EL  LK++V   Q+ L  ++S++G R   + +    + +++      +   ++E A       ++K  LE L  +K +L   I   + +   +++ ++K+E++  V+  +L +   + +++  +L+++  +L  +  ++  ++V+LE+   +  ++ +E + L    +++  E+++ RQ +  D    +R++ + ++++  +  LSKEK  LQ      EKK   +   +   +ES   E   L  LE  V + R ELE++  +K +       L ++   V +QL   +  + S++E L   +   D    ++    + Q+ L  E  +LQ+ I       +    E + ++++   L  EI +    +   E     LQ    +E+ K       LE+  +    EL   KS + + L ++ A+  +L  L+++       E++I  LE ++ Q +      EQ+    S  L  + +       D + LR     E    +K+++ L++ +                      KE+  +E +A+D   RA  L  +L+Q +++Y+ L+ ++ 
Sbjct: 1244 PGYIMYTVLP-DGSPVPQGVALYAPSPPLP--NSSHPLTPGTVVYGPPPAGAPIIYGPPPANFAVP-LVPAGVQHCNIPEHHNLENEVSRLEDIMQHLKSKQREERRQKASTQHSEEEVDGLHRDI----DDL----LQEKKELELEVEELHRTIERHQQRKDFIDGHVENLMTELEI---------EKSLKH----HEDIVDEIECLEKTLLKRRSELREADRLLAEAENELACTKEKTKSAVEKFTDAKRNLLQTESDAEALEKRAQETALNLVKAEQQLRLLQADAEDLEQHKIKQEEILKEINKVVAAKDADFQCLNEKKEKLTEELQSLQRDIKAAQHSEDHHLQVLRESETLLQAKRAELETLKSQVTSQQQELAVLDSELGHRREELLLLQDSLAQAKADLQEALTLGETEVAEKCSHIREVKSLLEELSFQKGELNVHISEKKTQLALIQQEMEKEEKNLQVVLQQLSRHKTELKNVADILQLETSELQGLKLQHDQKVVELEKAQVDVLEEKLELENLQQATQQQRRELERQRQLLERDRRETERVRAESQALQSCVECLSKEKEDLQGQCESWEKKSSHAQRVLAATEESNKMEQSNLGKLELSVRKLRQELEQLSQDKLA-------LHSEVAEVQQQLQGKQEAINSLQEELDSTQDHLDLAKQDLIHTTKCQNELLNEQTQLQEDISKWMARLESCQKETETKEQQVQQLQDEIRESKLRLDQQEMMFQKLQKEREREEQKFEAGKVTLEQQQRQLEKELTDQKSRLKQLLTDVSAAEGRLGTLQEE-------ERRIEGLERMLSQAKQQLSEREQQLMAKSGELLALQKEADDMRADFSLLRNQFLTERKKAEKQVAGLKEALKIQRSQLEKNLLEQKQENSCMQKEMATIELVAQDNHERARRLMKELSQMQQEYLELKKQVA 2143          
BLAST of centriolin vs. Ensembl Mouse
Match: Cntrl (centriolin [Source:MGI Symbol;Acc:MGI:1889576])

HSP 1 Score: 193.741 bits (491), Expect = 1.205e-48
Identity = 130/327 (39.76%), Postives = 204/327 (62.39%), Query Frame = 1
Query:  133 GVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKK---QKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQA-YMGKGQF 1098
            GVRYITE  IK +  +D+L  +K LNL   K G KK RYIE+L+    + VL++ ++ I KIEK+DKL  LREL LS NKI +++GLEN+ NL+ L++ GN++  IP WF ++ K L  +N   N   S++++SKL  L+DL  L + +NPV A+ HY  +I+  L+ L  L+ + V   +++ A E+F   E++R+   L +   + EE+K  Q K  ++   QD+  K L ++   QK + E+++    +L +K  LLK+K+ +L RACQK YELEQ++AF KIDAKF+ L+ +          SE+++I    D++ Y+GK ++
Sbjct:   79 GVRYITEALIKKLTKQDNLALVKSLNLSLSKDGGKKFRYIENLEKCVKLEVLNLSYNLIVKIEKVDKLLRLRELNLSYNKISKIEGLENMCNLQKLNLAGNEIEHIPVWFAKKLKSLRVLNLKGNKISSLQDVSKLKPLQDLTSLVLIDNPVVALPHYLQFIIFHLRSLESLEGQPVTTQDRQEAFERFSLEEIERLEKDLEKKTVETEELKNKQTKFLEEIKNQDKLNKSLKEEAMLQKQSCEELE---SDLSTKKELLKQKTVELTRACQKQYELEQELAFYKIDAKFEPLNYYP---------SEYAEIDKYPDESPYIGKSRY 393          

HSP 2 Score: 131.339 bits (329), Expect = 1.084e-29
Identity = 208/939 (22.15%), Postives = 429/939 (45.69%), Query Frame = 1
Query: 3415 PQFVQQQAMPPNNSPLPG--ATYIPNGFLPQIHNSH--------------STPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLED---HFQNNGKH-KSSWKLKQKFKSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNN-ISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQN-----EKKELESNLKILRKQESQVHE--TLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNK-------LEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINR-------DLAALRQNHQFEMDNKDKELSRLRKRVA---------------------KEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIV 6042
            P ++    +P + SP+P   A Y P+  LP  ++SH                PI+   P ++     +  AG   CN+PEHH LE+     ++  +H KS  + +++ K+ ++     +D L  DI    +DL    +Q  K+        ++  + +  ++D ++  + +L  E E           +SL H       + DEI  ++  + +++ EL  AD  L  ++      +E+T   + K  DA++N  +   + E LEK+++E +L L KA  +L ++Q +   L   K+  EE++ +I  ++  KD +FQ +NE+  +   +L SL+ D+  A       +Q+L E + LL   R EL  LK++V   Q+ L  ++S++G R   + +    + +++      +   ++E A       ++K  LE L  +K +L   I   + +   +++ ++K+E++  V+  +L +   + +++  +L+++  +L  +  ++  ++V+LE+   +  ++ +E + L    +++  E+++ RQ +  D    +R++ + ++++  +  LSKEK  LQ      EKK   +   +   +ES   E   L  LE  V + R ELE++  +K +       L ++   V +QL   +  + S++E L   +   D    ++    + Q+ L  E  +LQ+ I       +    E + ++++   L  EI +    +   E     LQ    +E+ K       LE+  +    EL   KS + + L ++ A+  +L  L+++       E++I  LE ++ Q +      EQ+    S  L  + +       D + LR     E    +K+++ L++ +                      KE+  +E +A+D   RA  L  +L+Q +++Y+ L+ ++ 
Sbjct: 1245 PGYIMYTVLP-DGSPVPQGVALYAPSPPLP--NSSHPLTPGTVVYGPPPAGAPIIYGPPPANFAVP-LVPAGVQHCNIPEHHNLENEVSRLEDIMQHLKSKQREERRQKASTQHSEEEVDGLHRDI----DDL----LQEKKELELEVEELHRTIERHQQRKDFIDGHVENLMTELEI---------EKSLKH----HEDIVDEIECLEKTLLKRRSELREADRLLAEAENELACTKEKTKSAVEKFTDAKRNLLQTESDAEALEKRAQETALNLVKAEQQLRLLQADAEDLEQHKIKQEEILKEINKVVAAKDADFQCLNEKKEKLTEELQSLQRDIKAAQHSEDHHLQVLRESETLLQAKRAELETLKSQVTSQQQELAVLDSELGHRREELLLLQDSLAQAKADLQEALTLGETEVAEKCSHIREVKSLLEELSFQKGELNVHISEKKTQLALIQQEMEKEEKNLQVVLQQLSRHKTELKNVADILQLETSELQGLKLQHDQKVVELEKAQVDVLEEKLELENLQQATQQQRRELERQRQLLERDRRETERVRAESQALQSCVECLSKEKEDLQGQCESWEKKSSHAQRVLAATEESNKMEQSNLGKLELSVRKLRQELEQLSQDKLA-------LHSEVAEVQQQLQGKQEAINSLQEELDSTQDHLDLAKQDLIHTTKCQNELLNEQTQLQEDISKWMARLESCQKETETKEQQVQQLQDEIRESKLRLDQQEMMFQKLQKEREREEQKFEAGKVTLEQQQRQLEKELTDQKSRLKQLLTDVSAAEGRLGTLQEE-------ERRIEGLERMLSQAKQQLSEREQQLMAKSGELLALQKEADDMRADFSLLRNQFLTERKKAEKQVAGLKEALKIQRSQLEKNLLEQKQENSCMQKEMATIELVAQDNHERARRLMKELSQMQQEYLELKKQVA 2144          
BLAST of centriolin vs. Ensembl Mouse
Match: Cntrl (centriolin [Source:MGI Symbol;Acc:MGI:1889576])

HSP 1 Score: 193.741 bits (491), Expect = 1.205e-48
Identity = 130/327 (39.76%), Postives = 204/327 (62.39%), Query Frame = 1
Query:  133 GVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKK---QKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQA-YMGKGQF 1098
            GVRYITE  IK +  +D+L  +K LNL   K G KK RYIE+L+    + VL++ ++ I KIEK+DKL  LREL LS NKI +++GLEN+ NL+ L++ GN++  IP WF ++ K L  +N   N   S++++SKL  L+DL  L + +NPV A+ HY  +I+  L+ L  L+ + V   +++ A E+F   E++R+   L +   + EE+K  Q K  ++   QD+  K L ++   QK + E+++    +L +K  LLK+K+ +L RACQK YELEQ++AF KIDAKF+ L+ +          SE+++I    D++ Y+GK ++
Sbjct:   79 GVRYITEALIKKLTKQDNLALVKSLNLSLSKDGGKKFRYIENLEKCVKLEVLNLSYNLIVKIEKVDKLLRLRELNLSYNKISKIEGLENMCNLQKLNLAGNEIEHIPVWFAKKLKSLRVLNLKGNKISSLQDVSKLKPLQDLTSLVLIDNPVVALPHYLQFIIFHLRSLESLEGQPVTTQDRQEAFERFSLEEIERLEKDLEKKTVETEELKNKQTKFLEEIKNQDKLNKSLKEEAMLQKQSCEELE---SDLSTKKELLKQKTVELTRACQKQYELEQELAFYKIDAKFEPLNYYP---------SEYAEIDKYPDESPYIGKSRY 393          

HSP 2 Score: 131.339 bits (329), Expect = 1.084e-29
Identity = 208/939 (22.15%), Postives = 429/939 (45.69%), Query Frame = 1
Query: 3415 PQFVQQQAMPPNNSPLPG--ATYIPNGFLPQIHNSH--------------STPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLED---HFQNNGKH-KSSWKLKQKFKSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNN-ISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQN-----EKKELESNLKILRKQESQVHE--TLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNK-------LEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINR-------DLAALRQNHQFEMDNKDKELSRLRKRVA---------------------KEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIV 6042
            P ++    +P + SP+P   A Y P+  LP  ++SH                PI+   P ++     +  AG   CN+PEHH LE+     ++  +H KS  + +++ K+ ++     +D L  DI    +DL    +Q  K+        ++  + +  ++D ++  + +L  E E           +SL H       + DEI  ++  + +++ EL  AD  L  ++      +E+T   + K  DA++N  +   + E LEK+++E +L L KA  +L ++Q +   L   K+  EE++ +I  ++  KD +FQ +NE+  +   +L SL+ D+  A       +Q+L E + LL   R EL  LK++V   Q+ L  ++S++G R   + +    + +++      +   ++E A       ++K  LE L  +K +L   I   + +   +++ ++K+E++  V+  +L +   + +++  +L+++  +L  +  ++  ++V+LE+   +  ++ +E + L    +++  E+++ RQ +  D    +R++ + ++++  +  LSKEK  LQ      EKK   +   +   +ES   E   L  LE  V + R ELE++  +K +       L ++   V +QL   +  + S++E L   +   D    ++    + Q+ L  E  +LQ+ I       +    E + ++++   L  EI +    +   E     LQ    +E+ K       LE+  +    EL   KS + + L ++ A+  +L  L+++       E++I  LE ++ Q +      EQ+    S  L  + +       D + LR     E    +K+++ L++ +                      KE+  +E +A+D   RA  L  +L+Q +++Y+ L+ ++ 
Sbjct: 1245 PGYIMYTVLP-DGSPVPQGVALYAPSPPLP--NSSHPLTPGTVVYGPPPAGAPIIYGPPPANFAVP-LVPAGVQHCNIPEHHNLENEVSRLEDIMQHLKSKQREERRQKASTQHSEEEVDGLHRDI----DDL----LQEKKELELEVEELHRTIERHQQRKDFIDGHVENLMTELEI---------EKSLKH----HEDIVDEIECLEKTLLKRRSELREADRLLAEAENELACTKEKTKSAVEKFTDAKRNLLQTESDAEALEKRAQETALNLVKAEQQLRLLQADAEDLEQHKIKQEEILKEINKVVAAKDADFQCLNEKKEKLTEELQSLQRDIKAAQHSEDHHLQVLRESETLLQAKRAELETLKSQVTSQQQELAVLDSELGHRREELLLLQDSLAQAKADLQEALTLGETEVAEKCSHIREVKSLLEELSFQKGELNVHISEKKTQLALIQQEMEKEEKNLQVVLQQLSRHKTELKNVADILQLETSELQGLKLQHDQKVVELEKAQVDVLEEKLELENLQQATQQQRRELERQRQLLERDRRETERVRAESQALQSCVECLSKEKEDLQGQCESWEKKSSHAQRVLAATEESNKMEQSNLGKLELSVRKLRQELEQLSQDKLA-------LHSEVAEVQQQLQGKQEAINSLQEELDSTQDHLDLAKQDLIHTTKCQNELLNEQTQLQEDISKWMARLESCQKETETKEQQVQQLQDEIRESKLRLDQQEMMFQKLQKEREREEQKFEAGKVTLEQQQRQLEKELTDQKSRLKQLLTDVSAAEGRLGTLQEE-------ERRIEGLERMLSQAKQQLSEREQQLMAKSGELLALQKEADDMRADFSLLRNQFLTERKKAEKQVAGLKEALKIQRSQLEKNLLEQKQENSCMQKEMATIELVAQDNHERARRLMKELSQMQQEYLELKKQVA 2144          
BLAST of centriolin vs. Ensembl Mouse
Match: Cntrl (centriolin [Source:MGI Symbol;Acc:MGI:1889576])

HSP 1 Score: 132.109 bits (331), Expect = 6.365e-30
Identity = 207/929 (22.28%), Postives = 425/929 (45.75%), Query Frame = 1
Query: 3445 PNNSPLPG--ATYIPNGFLPQIHNSH--------------STPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLED---HFQNNGKH-KSSWKLKQKFKSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNN-ISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQN-----EKKELESNLKILRKQESQVHE--TLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNK-------LEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINR-------DLAALRQNHQFEMDNKDKELSRLRKRV---------------------AKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIV 6042
            P+ SP+P   A Y P+  LP  ++SH                PI+   P ++     +  AG   CN+PEHH LE+     ++  +H KS  + +++ K+ ++     +D L  DI    +DL    +Q  K+        ++  + +  ++D ++  + +L  E E           +SL H       + DEI  ++  + +++ EL  AD  L  ++      +E+T   + K  DA++N  +   + E LEK+++E +L L KA  +L ++Q +   L   K+  EE++ +I  ++  KD +FQ +NE+  +   +L SL+ D+  A       +Q+L E + LL   R EL  LK++V   Q+ L  ++S++G R   + +    + +++      +   ++E A       ++K  LE L  +K +L   I   + +   +++ ++K+E++  V+  +L +   + +++  +L+++  +L  +  ++  ++V+LE+   +  ++ +E + L    +++  E+++ RQ +  D    +R++ + ++++  +  LSKEK  LQ      EKK   +   +   +ES   E   L  LE  V + R ELE++  +K +       L ++   V +QL   +  + S++E L   +   D    ++    + Q+ L  E  +LQ+ I       +    E + ++++   L  EI +    +   E     LQ    +E+ K       LE+  +    EL   KS + + L ++ A+  +L  L+++       E++I  LE ++ Q +      EQ+    S  L  + +       D + LR     E    +K+++ L++ +                      KE+  +E +A+D   RA  L  +L+Q +++Y+ L+ ++ 
Sbjct:  700 PDGSPVPQGVALYAPSPPLP--NSSHPLTPGTVVYGPPPAGAPIIYGPPPANFAVP-LVPAGVQHCNIPEHHNLENEVSRLEDIMQHLKSKQREERRQKASTQHSEEEVDGLHRDI----DDL----LQEKKELELEVEELHRTIERHQQRKDFIDGHVENLMTELEI---------EKSLKH----HEDIVDEIECLEKTLLKRRSELREADRLLAEAENELACTKEKTKSAVEKFTDAKRNLLQTESDAEALEKRAQETALNLVKAEQQLRLLQADAEDLEQHKIKQEEILKEINKVVAAKDADFQCLNEKKEKLTEELQSLQRDIKAAQHSEDHHLQVLRESETLLQAKRAELETLKSQVTSQQQELAVLDSELGHRREELLLLQDSLAQAKADLQEALTLGETEVAEKCSHIREVKSLLEELSFQKGELNVHISEKKTQLALIQQEMEKEEKNLQVVLQQLSRHKTELKNVADILQLETSELQGLKLQHDQKVVELEKAQVDVLEEKLELENLQQATQQQRRELERQRQLLERDRRETERVRAESQALQSCVECLSKEKEDLQGQCESWEKKSSHAQRVLAATEESNKMEQSNLGKLELSVRKLRQELEQLSQDKLA-------LHSEVAEVQQQLQGKQEAINSLQEELDSTQDHLDLAKQDLIHTTKCQNELLNEQTQLQEDISKWMARLESCQKETETKEQQVQQLQDEIRESKLRLDQQEMMFQKLQKEREREEQKFEAGKVTLEQQQRQLEKELTDQKSRLKQLLTDVSAAEGRLGTLQEE-------ERRIEGLERMLSQAKQQLSEREQQLMAKSGELLALQKEADDMRADFSLLRNQFLTERKKAEKQVAGLKEALKIQRSQLEKNLLEQKQENSCMQKEMATIELVAQDNHERARRLMKELSQMQQEYLELKKQVA 1590          
BLAST of centriolin vs. UniProt/SwissProt
Match: sp|A2AL36|CNTRL_MOUSE (Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 8.432e-48
Identity = 130/327 (39.76%), Postives = 204/327 (62.39%), Query Frame = 1
Query:  133 GVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKK---QKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQA-YMGKGQF 1098
            GVRYITE  IK +  +D+L  +K LNL   K G KK RYIE+L+    + VL++ ++ I KIEK+DKL  LREL LS NKI +++GLEN+ NL+ L++ GN++  IP WF ++ K L  +N   N   S++++SKL  L+DL  L + +NPV A+ HY  +I+  L+ L  L+ + V   +++ A E+F   E++R+   L +   + EE+K  Q K  ++   QD+  K L ++   QK + E+++    +L +K  LLK+K+ +L RACQK YELEQ++AF KIDAKF+ L+ +          SE+++I    D++ Y+GK ++
Sbjct:   79 GVRYITEALIKKLTKQDNLALVKSLNLSLSKDGGKKFRYIENLEKCVKLEVLNLSYNLIVKIEKVDKLLRLRELNLSYNKISKIEGLENMCNLQKLNLAGNEIEHIPVWFAKKLKSLRVLNLKGNKISSLQDVSKLKPLQDLTSLVLIDNPVVALPHYLQFIIFHLRSLESLEGQPVTTQDRQEAFERFSLEEIERLEKDLEKKTVETEELKNKQTKFLEEIKNQDKLNKSLKEEAMLQKQSCEELE---SDLSTKKELLKQKTVELTRACQKQYELEQELAFYKIDAKFEPLNYYP---------SEYAEIDKYPDESPYIGKSRY 393          

HSP 2 Score: 131.339 bits (329), Expect = 7.586e-29
Identity = 208/939 (22.15%), Postives = 429/939 (45.69%), Query Frame = 1
Query: 3415 PQFVQQQAMPPNNSPLPG--ATYIPNGFLPQIHNSH--------------STPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLED---HFQNNGKH-KSSWKLKQKFKSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNN-ISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQN-----EKKELESNLKILRKQESQVHE--TLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNK-------LEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINR-------DLAALRQNHQFEMDNKDKELSRLRKRVA---------------------KEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIV 6042
            P ++    +P + SP+P   A Y P+  LP  ++SH                PI+   P ++     +  AG   CN+PEHH LE+     ++  +H KS  + +++ K+ ++     +D L  DI    +DL    +Q  K+        ++  + +  ++D ++  + +L  E E           +SL H       + DEI  ++  + +++ EL  AD  L  ++      +E+T   + K  DA++N  +   + E LEK+++E +L L KA  +L ++Q +   L   K+  EE++ +I  ++  KD +FQ +NE+  +   +L SL+ D+  A       +Q+L E + LL   R EL  LK++V   Q+ L  ++S++G R   + +    + +++      +   ++E A       ++K  LE L  +K +L   I   + +   +++ ++K+E++  V+  +L +   + +++  +L+++  +L  +  ++  ++V+LE+   +  ++ +E + L    +++  E+++ RQ +  D    +R++ + ++++  +  LSKEK  LQ      EKK   +   +   +ES   E   L  LE  V + R ELE++  +K +       L ++   V +QL   +  + S++E L   +   D    ++    + Q+ L  E  +LQ+ I       +    E + ++++   L  EI +    +   E     LQ    +E+ K       LE+  +    EL   KS + + L ++ A+  +L  L+++       E++I  LE ++ Q +      EQ+    S  L  + +       D + LR     E    +K+++ L++ +                      KE+  +E +A+D   RA  L  +L+Q +++Y+ L+ ++ 
Sbjct: 1245 PGYIMYTVLP-DGSPVPQGVALYAPSPPLP--NSSHPLTPGTVVYGPPPAGAPIIYGPPPANFAVP-LVPAGVQHCNIPEHHNLENEVSRLEDIMQHLKSKQREERRQKASTQHSEEEVDGLHRDI----DDL----LQEKKELELEVEELHRTIERHQQRKDFIDGHVENLMTELEI---------EKSLKH----HEDIVDEIECLEKTLLKRRSELREADRLLAEAENELACTKEKTKSAVEKFTDAKRNLLQTESDAEALEKRAQETALNLVKAEQQLRLLQADAEDLEQHKIKQEEILKEINKVVAAKDADFQCLNEKKEKLTEELQSLQRDIKAAQHSEDHHLQVLRESETLLQAKRAELETLKSQVTSQQQELAVLDSELGHRREELLLLQDSLAQAKADLQEALTLGETEVAEKCSHIREVKSLLEELSFQKGELNVHISEKKTQLALIQQEMEKEEKNLQVVLQQLSRHKTELKNVADILQLETSELQGLKLQHDQKVVELEKAQVDVLEEKLELENLQQATQQQRRELERQRQLLERDRRETERVRAESQALQSCVECLSKEKEDLQGQCESWEKKSSHAQRVLAATEESNKMEQSNLGKLELSVRKLRQELEQLSQDKLA-------LHSEVAEVQQQLQGKQEAINSLQEELDSTQDHLDLAKQDLIHTTKCQNELLNEQTQLQEDISKWMARLESCQKETETKEQQVQQLQDEIRESKLRLDQQEMMFQKLQKEREREEQKFEAGKVTLEQQQRQLEKELTDQKSRLKQLLTDVSAAEGRLGTLQEE-------ERRIEGLERMLSQAKQQLSEREQQLMAKSGELLALQKEADDMRADFSLLRNQFLTERKKAEKQVAGLKEALKIQRSQLEKNLLEQKQENSCMQKEMATIELVAQDNHERARRLMKELSQMQQEYLELKKQVA 2144          
BLAST of centriolin vs. UniProt/SwissProt
Match: sp|Q7Z7A1|CNTRL_HUMAN (Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2)

HSP 1 Score: 187.578 bits (475), Expect = 5.983e-46
Identity = 123/327 (37.61%), Postives = 192/327 (58.72%), Query Frame = 1
Query:  133 GVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKK---QKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQA-YMGKGQF 1098
            GVRYITE  IK +  +D+L  IK LNL   K G KK +YIE+L+    + VL++ ++ I KIEKLDKL  LREL LS NKI +++G+EN+ NL+ L++ GN++  IP W  ++ K L  +N   N   S+++ISKL  L+DL+ L + ENPV  + HY  + +  L+ L  L+ + V   +++ A E+F   E++R+   L +   + EE+K  Q +  ++   QD+  K L ++   QK + E++K               +     RACQK YELEQ++AF KIDAKF+ L+ +  P       SE+++I    D++ Y+GK ++
Sbjct:   79 GVRYITEALIKKLTKQDNLALIKSLNLSLSKDGGKKFKYIENLEKCVKLEVLNLSYNLIGKIEKLDKLLKLRELNLSYNKISKIEGIENMCNLQKLNLAGNEIEHIPVWLGKKLKSLRVLNLKGNKISSLQDISKLKPLQDLISLILVENPVVTLPHYLQFTIFHLRSLESLEGQPVTTQDRQEAFERFSLEEVERLERDLEKKMIETEELKSKQTRFLEEIKNQDKLNKSLKEEAMLQKQSCEELKSDLNTKNELLKQKTIELT---RACQKQYELEQELAFYKIDAKFEPLNYY--P-------SEYAEIDKAPDESPYIGKSRY 393          

HSP 2 Score: 105.145 bits (261), Expect = 6.790e-21
Identity = 211/941 (22.42%), Postives = 435/941 (46.23%), Query Frame = 1
Query: 3397 SAPSNNPQFVQQQAMPPNNSPLPGATYI---PNGFLPQIHNSHSTPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLED---HFQNNGKHKSSWKLKQKF----KSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQ------DLLN-NISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSR---QVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNE----KKELESNLKILRKQE--SQVHET-LTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIF--DLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIF--ELEEIIKQQENNAHHYEQENRKLSNHLAVINR-------DLAALRQNHQFEMDNKDKELSRLRKR---------------------VAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIV 6042
              P     +     +P N+ PL   T +   P    P ++     P   ++P+  +        G L CNVPEHH LE+     ++  +H  S K ++++    K  SEK M       E++H   +DL            E   L  ++++L+ T Q      D ++ N+ SL  E E           +SL H       + DEI  ++  + +++ EL  AD  L  ++   +  +E+T   + K  DA+++  +   + EELE++++E ++ L KA  +L  +Q +   L   K+  EE++ +I  I+  KD++FQ ++++  +   +L  L+ D+ MA       +Q+L E + LL   R EL +LK++V   Q+ +  ++  +G +   + +    + +++   Q   RL +   +E+    RE   L   LE L  +K +L   I   + +   +K+ I+K+E++  V+  ++ K   + ++I  ML+++  +L  +  ++  R+ +LE+      ++ +E + L    +++  EI+  +Q +  D    +R+  +  +++  +  LSKEK  LQ +    +K+L    ++L   E  S++ ++ L  LE  V + + EL++++ +K S       L    +++ +QL E +  + S++E L  ++   +    ++    + Q  L  E  +LQ  I      F++   E + ++++   L  EI  + +++KL+++++    LQ     E++KLE        +  QL+ E+T++   L+   +K+  L  +  ++   E++ +   LE+ + Q +      EQ+  + S  L  + +       D + LR     E    +K+++ L++                      + KE+  +E +A+D   RA  L  +LNQ + +Y  L+ ++ 
Sbjct: 1255 PVPQGMALYAPPPPLPNNSRPLTPGTVVYGPPPAGAPMVYGP--PPPNFSIPFIPM--------GVLHCNVPEHHNLENEVSRLEDIMQHLKSKKREERWMRASKRQSEKEM-------EELHHNIDDL----------LQEKKSLECEVEELHRTVQKRQQQKDFIDGNVESLMTELEI---------EKSLKH----HEDIVDEIECIEKTLLKRRSELREADRLLAEAESELSCTKEKTKNAVEKFTDAKRSLLQTESDAEELERRAQETAVNLVKADQQLRSLQADAKDLEQHKIKQEEILKEINKIVAAKDSDFQCLSKKKEKLTEELQKLQKDIEMAERNEDHHLQVLKESEVLLQAKRAELEKLKSQVTSQQQEMAVLDRQLGHKKEELHLLQGSMVQAKADLQEALRLGETEVTEKCNHIREVKSL---LEELSFQKGELNVQISERKTQLTLIKQEIEKEEENLQVVLRQMSKHKTELKNILDMLQLENHELQGLKLQHDQRVSELEKTQVAVLEEKLELENLQQISQQQKGEIEWQKQLLERDKREIERMTAESRALQSCVECLSKEKEDLQEKCDIWEKKLAQTKRVLAAAEENSKMEQSNLEKLELNVRKLQQELDQLNRDKLS-------LHNDISAMQQQLQEKREAVNSLQEELANVQDHLNLAKQDLLHTTKHQDVLLSEQTRLQKDISEWANRFEDCQKEEETKQQQLQVLQNEI--EENKLKLVQQEMMFQRLQKERESEESKLETSKVTLKEQQHQLEKELTDQKSKLDQVLSKV--LAAEERVRTLQEEERWCESLEKTLSQTKRQLSEREQQLVEKSGELLALQKEADSMRADFSLLRNQFLTERKKAEKQVASLKEALKIQRSQLEKNLLEQKQENSCIQKEMATIELVAQDNHERARRLMKELNQMQYEYTELKKQMA 2141          
BLAST of centriolin vs. UniProt/SwissProt
Match: sp|Q28CU0|LRC23_XENTR (Leucine-rich repeat-containing protein 23 OS=Xenopus tropicalis OX=8364 GN=lrrc23 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.913e-11
Identity = 55/154 (35.71%), Postives = 85/154 (55.19%), Query Frame = 1
Query:  193 RIKKLNLDCGKGDKKIRYIEHLD--NLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILD 648
            R++ LNL       ++R +E L+  NL+++  L +R + +     L+ L +LRELYL +N I RL+GLE L+NL  L +R NQL S+   F+   + L  +N   NM   ++E+ KL+ L  L  L + ENP      YR+  ++ L  L  LD
Sbjct:  172 RLETLNLI----GNELRDLEGLECSNLSSLHTLELRSNQLLSTAGLN-LPSLRELYLGQNNISRLEGLEALVNLTTLHLRDNQLESL-DGFSEHLQALQYLNLRSNMVAKLQEVQKLYCLPRLRALVLRENPCEEEEGYRMETLIALPQLERLD 319          
BLAST of centriolin vs. UniProt/SwissProt
Match: sp|Q32PL1|PP1R7_DANRE (Protein phosphatase 1 regulatory subunit 7 OS=Danio rerio OX=7955 GN=ppp1r7 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 3.498e-10
Identity = 56/177 (31.64%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  160 IKIIAHEDHLDRIKKLNLDCGK------------------GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKIN---FSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRL 627
            I  IA+ DHL  ++ L L   +                  G  KI  +++LD L+N+TVLSI+ + I K+E L  L NLRELYLS N I  ++GLEN   L  LD+  N++  I +       +LT +     + N  ++  ++ +L   K L  + +  NP+     YR  I++ L
Sbjct:  161 IASIANLDHLTSLQMLELGSNRIRVIENLDSLSSLESLFLGTNKITQLQNLDGLHNLTVLSIQSNRITKLEGLQNLVNLRELYLSHNGIEVMEGLENNKKLSTLDIAANRIKKIEN-----ISHLTDLKEFWMNDNQIENWADLDELKNAKGLETVYLERNPLQKDPQYRRKIMLAL 332          
BLAST of centriolin vs. UniProt/SwissProt
Match: sp|Q3UM45|PP1R7_MOUSE (Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus OX=10090 GN=Ppp1r7 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 4.241e-10
Identity = 52/159 (32.70%), Postives = 87/159 (54.72%), Query Frame = 1
Query:  160 IKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKIN---FSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRL 627
            I+ I + D L  ++ L L    G  KI  +++LD L N+TVLS++ + + KIE L  L NLRELYLS N I  ++GLEN   L +LD+  N++  I +       +LT++     + N+ +S  ++ +L   + L  + +  NP+     YR  +++ L
Sbjct:  199 IRAIENIDTLTNLESLFL----GKNKITKLQNLDALTNLTVLSVQSNRLAKIEGLQSLVNLRELYLSNNGIEVIEGLENNNKLTMLDIASNRIKKIEN-----ISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLAL 348          
BLAST of centriolin vs. TrEMBL
Match: H6WA31 (Centriolin (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 394/404 (97.52%), Postives = 396/404 (98.02%), Query Frame = 1
Query:  379 LDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQAYMGKGQFITKKEVEMLMERKRMKQGHSKKEQEENNGRNSTQKLKEDFVDSLNEKVKEKLTELNQINKEISEKNKIVDNLNNNIDHKELFYDSNTPTKSLIPNFHRADRPRSALASFXXXXXXXXXXXXXXXXXETESINKHNEHSNTTDLFLEKVENLTEMQREAEELRRQ 1590
            LD   N  + +ILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKDLLDLDVSENPVAAIAHYRLYIVMRLKYLLILDNREVL DEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQLEENLKSKDLLLKKKSEDLFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQAYMGKGQFITKKEVEMLMERKRMKQGHSKKEQEENNGRNSTQKLKEDFVDSLNEKVKEKLTELNQINKEISEKNKI DNLNNNIDHKELFYDSNTPTKSLIPNFHRADRPRSALASFNRLSPLRTLLNRPRRLSETESINKHNEHSNTTDLFLEKVENLTEMQREAEELRRQ
Sbjct:    5 LDKKHNKTSFQILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKDLLDLDVSENPVAAIAHYRLYIVMRLKYLLILDNREVLVDEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQLEENLKSKDLLLKKKSEDLFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQAYMGKGQFITKKEVEMLMERKRMKQGHSKKEQEENNGRNSTQKLKEDFVDSLNEKVKEKLTELNQINKEISEKNKIFDNLNNNIDHKELFYDSNTPTKSLIPNFHRADRPRSALASFNRLSPLRTLLNRPRRLSETESINKHNEHSNTTDLFLEKVENLTEMQREAEELRRQ 408          
BLAST of centriolin vs. TrEMBL
Match: A0A1S3JJS6 (centriolin isoform X2 OS=Lingula unguis OX=7574 GN=LOC106173545 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 1.094e-60
Identity = 215/901 (23.86%), Postives = 455/901 (50.50%), Query Frame = 1
Query: 3472 TYIPNGFLPQIHNSHSTPILNTVPYSSIVTSEMKNAGS-------LFCNVPEHHYLEDHFQNNGKHKSSWKLKQKFKSDSEKYMMTLDS-------LKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSL----------REETEFVTRETIASTSESLGH-MRARKSQLS---DEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQE-------NNAHHYEQENRKLSNHLAVINRDLAALRQNHQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIVIFGRFLDKE 6069
             Y+P G    +H S     +   P         K A         LFCNVPEHH +ED+       +   +LKQK K   ++  ++ ++       L+ ++  R ++L+ +++ + +Q   +  +    ++L   ++  L  +  L          RE  E  ++  +A +     +  R RKS+L+   DEI  ++  + +++ EL  AD  L+  +      + Q   T+ ++D AR+     + + EE+E++S+EA ++L +A +++  +Q E  +L   K   E  +  I  +I+ KD EF+ ++E++     +L+ ++ +L +A E+ +E +  L + + LL + R EL ++K+++   +  L+ ++  +G R+  + +    + R +   N+L++E ++E +   +E  +L+   + L+ ++  L   I + + +   +KE+I + E+S  +L S + K   + +H+  M++M++ +LD+V  ++ ++L +LER      ++  + + +  +  +K  E ++++QT+    E  + L+ +KE +E SI+TL+KEK ++Q   K  +  +  L++   Q+ + + A + K  +  T+L+++  E    T  ++ L+    + ++ +   K EL+ +KE L   E + ++   ++++         +E++++QD IR +  + +E   +  ++++    L  E+ +K  E + +++ +  ++  + +E+ KL ++L N   EL  +K+E   K + L+ +  +L Q KK     + TE+K  ELE+ + Q E       N     E++  KL + L  + R L    Q           E  +L++  A+EI  LE +A+D C RAN LS DLN+ R++Y+  + +++     LDKE
Sbjct: 1245 AYVPVGHPIAVHPSGPVQYVPVTPGPGQPPDGQKMAAVNLPGQEVLFCNVPEHHDMEDYIAQ--LQEKIKELKQKIKKLEKRETLSAEAERSAVKRLRAELEDRRDELEGLDLAMERQKASLRHMKEVEEKLKEEREGALKELEELKKTNAKTNRRREFLEGRSQYDVADSDYEYDYNPRQRKSRLNYLEDEIQCLEETLAKRRAELREADRLLQECQGDLQDARNQAKTTVQQYDQAREGLTTTVQQAEEIERRSKEAGVQLVQAQDQIEDLQKEIRQLDMEKAKKEATLQGILKVISTKDEEFRNLDEQVKDLEERLDQVEGELGLAEEREKETLASLKDCETLLENRRTELGKIKSQIDSERTQLENLDHQVGRRSTELQLVEESLARKQGELNKLMREAETEASNRHKEIQELRLTSQELQTQQRTLQADIADKQDQLQAIKEDIQQNEESLQILTSTVSKSRAELKHVVDMVKMEKSELDQVREQHGAKLKELERTQIALREEKEDLEYMQGETGKKQVECERLKQTLETQRETTESLKLEKELLEDSINTLAKEKDLIQESYKSYDDKVNQLKRAHLQLEDGILAGQRKQERLETQLKEIEKEVTEATADKEALERDLKTYTQHIKGKKSELKGLKENLNETEQKKEQMEKQLKETRMATDGALVELQRVQDSIRQSEQTQEECFKQQTQKQDLIRHLVTEVEEKEAEHQRMQQVLHRVKKELEREETKLSRLLSNGRLELENIKTEAAMKQDELDQNDKQLKQFKKQMEELQHTEEKFVELEQKVSQLETAVSEASNQRLSLERDQDKLLSELEEVKRHLHVTSQ-----------EYEQLQQNSAREIADLESVAQDHCRRANRLSQDLNELRQEYIEAKRKLMSQAEILDKE 2132          

HSP 2 Score: 216.468 bits (550), Expect = 3.141e-52
Identity = 125/325 (38.46%), Postives = 221/325 (68.00%), Query Frame = 1
Query:  130 PGVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMS-EHSQISSTGDQAYMGKGQF 1098
            PGVRYIT++ I+ +  E HLD++  LNL   K G KKI+YIE+LD L  + VL++  + IEK+EKL+KL  LREL LS N+I +++G+E L  L++L++ GN + S+PHW  ++ + L  I  ++N   S+ E++KL +L+DL  L V+ENPV  + H  LY++  L+ L +LD +++  +E++ A ++F+++E++ +  +L +T+++LEE+++   K   +  ++++ ++   KK  +  E+IK++E  +++KD LLK+K+ +L +ACQK+YELEQ++AF KIDAKF+    ++G +  P N   E S++ +  +  Y+G+ ++
Sbjct:   57 PGVRYITDDLIRRVTKEQHLDQVTVLNLTLSKEGGKKIKYIENLDGLRRLQVLNLSCNMIEKMEKLEKLTKLRELNLSFNRISKIEGIETLAALQVLNLTGNNIESLPHWLGKKLRSLRVIRLAKNKLQSLSELAKLKSLQDLSQLTVTENPVTELPHAHLYLIFHLRSLEVLDGQQLDIEEREEADQRFQQDEIENLERQLEDTQRRLEELQDEHNKSVHEIQEKEKQERSRKKKAGAAEEKIKEMEREIQTKDDLLKRKTAELTKACQKHYELEQELAFFKIDAKFE----NLGKIPTPGNGDVEESELGA--ESPYIGRARY 375          
BLAST of centriolin vs. TrEMBL
Match: A0A1S3JIG3 (centriolin isoform X1 OS=Lingula unguis OX=7574 GN=LOC106173545 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 1.947e-59
Identity = 218/906 (24.06%), Postives = 460/906 (50.77%), Query Frame = 1
Query: 3472 TYIPNGFLPQIHNSHSTPILNTVPYSS-----------IVTSEMKNAGSLFCNVPEHHYLEDHF-QNNGKHKSSWKLKQKFKSDSEKYMMTLDS-------LKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSL----------REETEFVTRETIASTSESLGH-MRARKSQLS---DEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQE-------NNAHHYEQENRKLSNHLAVINRDLAALRQNHQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIVIFGRFLDKE 6069
             Y+P G    +H S   P+   VP +            +    +     LFCNVPEHH +ED+  Q   K K   +LKQK K   ++  ++ ++       L+ ++  R ++L+ +++ + +Q   +  +    ++L   ++  L  +  L          RE  E  ++  +A +     +  R RKS+L+   DEI  ++  + +++ EL  AD  L+  +      + Q   T+ ++D AR+     + + EE+E++S+EA ++L +A +++  +Q E  +L   K   E  +  I  +I+ KD EF+ ++E++     +L+ ++ +L +A E+ +E +  L + + LL + R EL ++K+++   +  L+ ++  +G R+  + +    + R +   N+L++E ++E +   +E  +L+   + L+ ++  L   I + + +   +KE+I + E+S  +L S + K   + +H+  M++M++ +LD+V  ++ ++L +LER      ++  + + +  +  +K  E ++++QT+    E  + L+ +KE +E SI+TL+KEK ++Q   K  +  +  L++   Q+ + + A + K  +  T+L+++  E    T  ++ L+    + ++ +   K EL+ +KE L   E + ++   ++++         +E++++QD IR +  + +E   +  ++++    L  E+ +K  E + +++ +  ++  + +E+ KL ++L N   EL  +K+E   K + L+ +  +L Q KK     + TE+K  ELE+ + Q E       N     E++  KL + L  + R L    Q           E  +L++  A+EI  LE +A+D C RAN LS DLN+ R++Y+  + +++     LDKE
Sbjct: 1245 AYVPVGHPIAVHPS--GPV-QYVPVTPGPGQPPGDGQKMAAVNLPGQEVLFCNVPEHHDMEDYIAQLQEKIK---ELKQKIKKLEKRETLSAEAERSAVKRLRAELEDRRDELEGLDLAMERQKASLRHMKEVEEKLKEEREGALKELEELKKTNAKTNRRREFLEGRSQYDVADSDYEYDYNPRQRKSRLNYLEDEIQCLEETLAKRRAELREADRLLQECQGDLQDARNQAKTTVQQYDQAREGLTTTVQQAEEIERRSKEAGVQLVQAQDQIEDLQKEIRQLDMEKAKKEATLQGILKVISTKDEEFRNLDEQVKDLEERLDQVEGELGLAEEREKETLASLKDCETLLENRRTELGKIKSQIDSERTQLENLDHQVGRRSTELQLVEESLARKQGELNKLMREAETEASNRHKEIQELRLTSQELQTQQRTLQADIADKQDQLQAIKEDIQQNEESLQILTSTVSKSRAELKHVVDMVKMEKSELDQVREQHGAKLKELERTQIALREEKEDLEYMQGETGKKQVECERLKQTLETQRETTESLKLEKELLEDSINTLAKEKDLIQESYKSYDDKVNQLKRAHLQLEDGILAGQRKQERLETQLKEIEKEVTEATADKEALERDLKTYTQHIKGKKSELKGLKENLNETEQKKEQMEKQLKETRMATDGALVELQRVQDSIRQSEQTQEECFKQQTQKQDLIRHLVTEVEEKEAEHQRMQQVLHRVKKELEREETKLSRLLSNGRLELENIKTEAAMKQDELDQNDKQLKQFKKQMEELQHTEEKFVELEQKVSQLETAVSEASNQRLSLERDQDKLLSELEEVKRHLHVTSQ-----------EYEQLQQNSAREIADLESVAQDHCRRANRLSQDLNELRQEYIEAKRKLMSQAEILDKE 2133          

HSP 2 Score: 216.468 bits (550), Expect = 2.913e-52
Identity = 125/325 (38.46%), Postives = 221/325 (68.00%), Query Frame = 1
Query:  130 PGVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMS-EHSQISSTGDQAYMGKGQF 1098
            PGVRYIT++ I+ +  E HLD++  LNL   K G KKI+YIE+LD L  + VL++  + IEK+EKL+KL  LREL LS N+I +++G+E L  L++L++ GN + S+PHW  ++ + L  I  ++N   S+ E++KL +L+DL  L V+ENPV  + H  LY++  L+ L +LD +++  +E++ A ++F+++E++ +  +L +T+++LEE+++   K   +  ++++ ++   KK  +  E+IK++E  +++KD LLK+K+ +L +ACQK+YELEQ++AF KIDAKF+    ++G +  P N   E S++ +  +  Y+G+ ++
Sbjct:   57 PGVRYITDDLIRRVTKEQHLDQVTVLNLTLSKEGGKKIKYIENLDGLRRLQVLNLSCNMIEKMEKLEKLTKLRELNLSFNRISKIEGIETLAALQVLNLTGNNIESLPHWLGKKLRSLRVIRLAKNKLQSLSELAKLKSLQDLSQLTVTENPVTELPHAHLYLIFHLRSLEVLDGQQLDIEEREEADQRFQQDEIENLERQLEDTQRRLEELQDEHNKSVHEIQEKEKQERSRKKKAGAAEEKIKEMEREIQTKDDLLKRKTAELTKACQKHYELEQELAFFKIDAKFE----NLGKIPTPGNGDVEESELGA--ESPYIGRARY 375          
BLAST of centriolin vs. TrEMBL
Match: A0A1S3JIC2 (centriolin isoform X3 OS=Lingula unguis OX=7574 GN=LOC106173545 PE=4 SV=1)

HSP 1 Score: 240.35 bits (612), Expect = 1.957e-59
Identity = 218/906 (24.06%), Postives = 460/906 (50.77%), Query Frame = 1
Query: 3472 TYIPNGFLPQIHNSHSTPILNTVPYSS-----------IVTSEMKNAGSLFCNVPEHHYLEDHF-QNNGKHKSSWKLKQKFKSDSEKYMMTLDS-------LKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSL----------REETEFVTRETIASTSESLGH-MRARKSQLS---DEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQE-------NNAHHYEQENRKLSNHLAVINRDLAALRQNHQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIVIFGRFLDKE 6069
             Y+P G    +H S   P+   VP +            +    +     LFCNVPEHH +ED+  Q   K K   +LKQK K   ++  ++ ++       L+ ++  R ++L+ +++ + +Q   +  +    ++L   ++  L  +  L          RE  E  ++  +A +     +  R RKS+L+   DEI  ++  + +++ EL  AD  L+  +      + Q   T+ ++D AR+     + + EE+E++S+EA ++L +A +++  +Q E  +L   K   E  +  I  +I+ KD EF+ ++E++     +L+ ++ +L +A E+ +E +  L + + LL + R EL ++K+++   +  L+ ++  +G R+  + +    + R +   N+L++E ++E +   +E  +L+   + L+ ++  L   I + + +   +KE+I + E+S  +L S + K   + +H+  M++M++ +LD+V  ++ ++L +LER      ++  + + +  +  +K  E ++++QT+    E  + L+ +KE +E SI+TL+KEK ++Q   K  +  +  L++   Q+ + + A + K  +  T+L+++  E    T  ++ L+    + ++ +   K EL+ +KE L   E + ++   ++++         +E++++QD IR +  + +E   +  ++++    L  E+ +K  E + +++ +  ++  + +E+ KL ++L N   EL  +K+E   K + L+ +  +L Q KK     + TE+K  ELE+ + Q E       N     E++  KL + L  + R L    Q           E  +L++  A+EI  LE +A+D C RAN LS DLN+ R++Y+  + +++     LDKE
Sbjct: 1245 AYVPVGHPIAVHPS--GPV-QYVPVTPGPGQPPGDGQKMAAVNLPGQEVLFCNVPEHHDMEDYIAQLQEKIK---ELKQKIKKLEKRETLSAEAERSAVKRLRAELEDRRDELEGLDLAMERQKASLRHMKEVEEKLKEEREGALKELEELKKTNAKTNRRREFLEGRSQYDVADSDYEYDYNPRQRKSRLNYLEDEIQCLEETLAKRRAELREADRLLQECQGDLQDARNQAKTTVQQYDQAREGLTTTVQQAEEIERRSKEAGVQLVQAQDQIEDLQKEIRQLDMEKAKKEATLQGILKVISTKDEEFRNLDEQVKDLEERLDQVEGELGLAEEREKETLASLKDCETLLENRRTELGKIKSQIDSERTQLENLDHQVGRRSTELQLVEESLARKQGELNKLMREAETEASNRHKEIQELRLTSQELQTQQRTLQADIADKQDQLQAIKEDIQQNEESLQILTSTVSKSRAELKHVVDMVKMEKSELDQVREQHGAKLKELERTQIALREEKEDLEYMQGETGKKQVECERLKQTLETQRETTESLKLEKELLEDSINTLAKEKDLIQESYKSYDDKVNQLKRAHLQLEDGILAGQRKQERLETQLKEIEKEVTEATADKEALERDLKTYTQHIKGKKSELKGLKENLNETEQKKEQMEKQLKETRMATDGALVELQRVQDSIRQSEQTQEECFKQQTQKQDLIRHLVTEVEEKEAEHQRMQQVLHRVKKELEREETKLSRLLSNGRLELENIKTEAAMKQDELDQNDKQLKQFKKQMEELQHTEEKFVELEQKVSQLETAVSEASNQRLSLERDQDKLLSELEEVKRHLHVTSQ-----------EYEQLQQNSAREIADLESVAQDHCRRANRLSQDLNELRQEYIEAKRKLMSQAEILDKE 2133          

HSP 2 Score: 216.468 bits (550), Expect = 2.978e-52
Identity = 125/325 (38.46%), Postives = 221/325 (68.00%), Query Frame = 1
Query:  130 PGVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMS-EHSQISSTGDQAYMGKGQF 1098
            PGVRYIT++ I+ +  E HLD++  LNL   K G KKI+YIE+LD L  + VL++  + IEK+EKL+KL  LREL LS N+I +++G+E L  L++L++ GN + S+PHW  ++ + L  I  ++N   S+ E++KL +L+DL  L V+ENPV  + H  LY++  L+ L +LD +++  +E++ A ++F+++E++ +  +L +T+++LEE+++   K   +  ++++ ++   KK  +  E+IK++E  +++KD LLK+K+ +L +ACQK+YELEQ++AF KIDAKF+    ++G +  P N   E S++ +  +  Y+G+ ++
Sbjct:   57 PGVRYITDDLIRRVTKEQHLDQVTVLNLTLSKEGGKKIKYIENLDGLRRLQVLNLSCNMIEKMEKLEKLTKLRELNLSFNRISKIEGIETLAALQVLNLTGNNIESLPHWLGKKLRSLRVIRLAKNKLQSLSELAKLKSLQDLSQLTVTENPVTELPHAHLYLIFHLRSLEVLDGQQLDIEEREEADQRFQQDEIENLERQLEDTQRRLEELQDEHNKSVHEIQEKEKQERSRKKKAGAAEEKIKEMEREIQTKDDLLKRKTAELTKACQKHYELEQELAFFKIDAKFE----NLGKIPTPGNGDVEESELGA--ESPYIGRARY 375          
BLAST of centriolin vs. TrEMBL
Match: A0A1S3JJ59 (centriolin isoform X4 OS=Lingula unguis OX=7574 GN=LOC106173545 PE=4 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 7.336e-59
Identity = 216/899 (24.03%), Postives = 456/899 (50.72%), Query Frame = 1
Query: 3472 TYIPNGFLPQIHNSHSTPILNTVPYSS-----------IVTSEMKNAGSLFCNVPEHHYLEDHF-QNNGKHKSSWKLKQKFKSDSEKYMMTLDS-------LKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSL----------REETEFVTRETIASTSESLGH-MRARKSQLS---DEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINRDLAALRQNHQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIVIFGRFLDKE 6069
             Y+P G    +H S   P+   VP +            +    +     LFCNVPEHH +ED+  Q   K K   +LKQK K   ++  ++ ++       L+ ++  R ++L+ +++ + +Q   +  +    ++L   ++  L  +  L          RE  E  ++  +A +     +  R RKS+L+   DEI  ++  + +++ EL  AD  L+  +      + Q   T+ ++D AR+     + + EE+E++S+EA ++L +A +++  +Q E  +L   K   E  +  I  +I+ KD EF+ ++E++     +L+ ++ +L +A E+ +E +  L + + LL + R EL ++K+++   +  L+ ++  +G R+  + +    + R +   N+L++E ++E +   +E  +L+   + L+ ++  L   I + + +   +KE+I + E+S  +L S + K   + +H+  M++M++ +LD+V  ++ ++L +LER      ++  + + +  +  +K  E ++++QT+    E  + L+ +KE +E SI+TL+KEK ++Q   K  +  +  L++   Q+ + + A + K  +  T+L+++  E    T  ++ L+    + ++ +   K EL+ +KE L   E + ++   ++++         +E++++QD IR +  + +E   +  ++++    L  E+ +K  E + +++ +  ++  + +E+ KL ++L N   EL  +K+E   K + L+ +  +L Q KK     + TE+K  ELE+ + Q E      E  N++LS     + R+   L+QN                   A+EI  LE +A+D C RAN LS DLN+ R++Y+  + +++     LDKE
Sbjct: 1245 AYVPVGHPIAVHPS--GPV-QYVPVTPGPGQPPGDGQKMAAVNLPGQEVLFCNVPEHHDMEDYIAQLQEKIK---ELKQKIKKLEKRETLSAEAERSAVKRLRAELEDRRDELEGLDLAMERQKASLRHMKEVEEKLKEEREGALKELEELKKTNAKTNRRREFLEGRSQYDVADSDYEYDYNPRQRKSRLNYLEDEIQCLEETLAKRRAELREADRLLQECQGDLQDARNQAKTTVQQYDQAREGLTTTVQQAEEIERRSKEAGVQLVQAQDQIEDLQKEIRQLDMEKAKKEATLQGILKVISTKDEEFRNLDEQVKDLEERLDQVEGELGLAEEREKETLASLKDCETLLENRRTELGKIKSQIDSERTQLENLDHQVGRRSTELQLVEESLARKQGELNKLMREAETEASNRHKEIQELRLTSQELQTQQRTLQADIADKQDQLQAIKEDIQQNEESLQILTSTVSKSRAELKHVVDMVKMEKSELDQVREQHGAKLKELERTQIALREEKEDLEYMQGETGKKQVECERLKQTLETQRETTESLKLEKELLEDSINTLAKEKDLIQESYKSYDDKVNQLKRAHLQLEDGILAGQRKQERLETQLKEIEKEVTEATADKEALERDLKTYTQHIKGKKSELKGLKENLNETEQKKEQMEKQLKETRMATDGALVELQRVQDSIRQSEQTQEECFKQQTQKQDLIRHLVTEVEEKEAEHQRMQQVLHRVKKELEREETKLSRLLSNGRLELENIKTEAAMKQDELDQNDKQLKQFKKQMEELQHTEEKFVELEQKVSQLETAVS--EASNQRLS-----LEREYEQLQQNS------------------AREIADLESVAQDHCRRANRLSQDLNELRQEYIEAKRKLMSQAEILDKE 2112          

HSP 2 Score: 216.468 bits (550), Expect = 3.096e-52
Identity = 125/325 (38.46%), Postives = 221/325 (68.00%), Query Frame = 1
Query:  130 PGVRYITEEFIKIIAHEDHLDRIKKLNLDCGK-GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMS-EHSQISSTGDQAYMGKGQF 1098
            PGVRYIT++ I+ +  E HLD++  LNL   K G KKI+YIE+LD L  + VL++  + IEK+EKL+KL  LREL LS N+I +++G+E L  L++L++ GN + S+PHW  ++ + L  I  ++N   S+ E++KL +L+DL  L V+ENPV  + H  LY++  L+ L +LD +++  +E++ A ++F+++E++ +  +L +T+++LEE+++   K   +  ++++ ++   KK  +  E+IK++E  +++KD LLK+K+ +L +ACQK+YELEQ++AF KIDAKF+    ++G +  P N   E S++ +  +  Y+G+ ++
Sbjct:   57 PGVRYITDDLIRRVTKEQHLDQVTVLNLTLSKEGGKKIKYIENLDGLRRLQVLNLSCNMIEKMEKLEKLTKLRELNLSFNRISKIEGIETLAALQVLNLTGNNIESLPHWLGKKLRSLRVIRLAKNKLQSLSELAKLKSLQDLSQLTVTENPVTELPHAHLYLIFHLRSLEVLDGQQLDIEEREEADQRFQQDEIENLERQLEDTQRRLEELQDEHNKSVHEIQEKEKQERSRKKKAGAAEEKIKEMEREIQTKDDLLKRKTAELTKACQKHYELEQELAFFKIDAKFE----NLGKIPTPGNGDVEESELGA--ESPYIGRARY 375          
BLAST of centriolin vs. Ensembl Cavefish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 72.0182 bits (175), Expect = 3.586e-12
Identity = 61/189 (32.28%), Postives = 106/189 (56.08%), Query Frame = 1
Query:  232 KKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMK--ENQLKLQKD 792
            KKI  I+HL    ++T L +  ++IEKI+ L+KL NL  L LS NKI  ++GLE L+ L+ L +  NQ+ +I    T   ++L  ++   N+   I+ +  L   K+L  L+++ NP+    +Y++++V  L  L+ LD R V    ++ A+      E++ M+   L+ ++ +E  K  E +L+L KD
Sbjct:   53 KKILQIDHLWEFTSLTKLQLNNNSIEKIQGLEKLTNLLWLDLSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEKMDT--LEHLEILSLGENVISQIDNVIYLRRFKNLRSLNLARNPICQETNYKIFVVAYLPDLVYLDFRLVDEQTRERAL-----TEINVMTDNELKEKRAMEAQKITEQELQLHKD 234          
BLAST of centriolin vs. Ensembl Cavefish
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:111191999])

HSP 1 Score: 68.1662 bits (165), Expect = 3.191e-11
Identity = 54/159 (33.96%), Postives = 85/159 (53.46%), Query Frame = 1
Query:  160 IKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKIN---FSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRL 627
            I+II + D L  +  L L    G  KI  +++LD L+N+TVLSI+ + I K+E L  + NLRELYLS N I  ++GLEN   L  LD+  N++  I +       +LT +     + N  ++  ++ +L   K L  + +  NP+     YR  I++ L
Sbjct:  184 IRIIENLDALTSLDSLFL----GTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQNMVNLRELYLSHNGIEVIEGLENNKKLTTLDIAANRIKKIEN-----ISHLTDLQEFWMNDNQIENWSDLDELKNAKGLETVYLERNPLQKDPQYRRKIMLAL 333          

HSP 2 Score: 58.151 bits (139), Expect = 4.913e-8
Identity = 45/130 (34.62%), Postives = 70/130 (53.85%), Query Frame = 1
Query:  160 IKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLK 549
            I  IA+ +HL  +  L L    G  +IR IE+LD L ++  L +  + I K++ LD L NL  L +  N+I +L+GL+N++NL+ L +  N +  I        K LT ++ + N    IE IS L  L+
Sbjct:  162 ISSIANLEHLTSLHMLEL----GSNRIRIIENLDALTSLDSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQNMVNLRELYLSHNGIEVIEGL--ENNKKLTTLDIAANRIKKIENISHLTDLQ 285          
BLAST of centriolin vs. Ensembl Cavefish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 66.2402 bits (160), Expect = 2.669e-10
Identity = 62/186 (33.33%), Postives = 101/186 (54.30%), Query Frame = 1
Query:  235 KIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKD 792
            KI  I+HL    ++T L +  ++IEKI+ L+KL NL  L LS NKI  ++GLE L+ L+ L +  NQ+ +I    T   ++L  ++   N+   I+ +  L   K+L  L+++ NP+    +Y++++V  L  L+ LD R  L DE+         NEL     R +E +K    + E +L+L KD
Sbjct:   42 KILQIDHLWEFTSLTKLQLNNNSIEKIQGLEKLTNLLWL-LSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEKMDT--LEHLEILSLGENVISQIDNVIYLRRFKNLRSLNLARNPICQETNYKIFVVAYLPDLVYLDFR--LVDEQT--------NELK--EKRAMEAQK----ITEQELQLHKD 208          
BLAST of centriolin vs. Ensembl Cavefish
Match: lrrc23 (leucine rich repeat containing 23 [Source:NCBI gene;Acc:103047179])

HSP 1 Score: 58.9214 bits (141), Expect = 2.436e-8
Identity = 45/138 (32.61%), Postives = 75/138 (54.35%), Query Frame = 1
Query:  196 IKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXV-SENPVAAIAHYR 606
            ++ LNL  G G +++  +E+   L N+  L +R +++E  + +  L NLR LYL++NKI +L+GLE L  L  L +RGNQL ++    +   K L  +N   N+  S + +  L  +   L   V + NP + +  YR
Sbjct:  152 LESLNL-TGNGIQRVSGLEY-HRLTNLVTLELRGNSLETTDGI-YLPNLRNLYLAQNKIKQLEGLEKLERLTTLHLRGNQLETL-DGLSPSMKSLQYLNIRDNLIASRKALQSLLGVAQTLQAIVLTGNPFSDMEDYR 285          
BLAST of centriolin vs. Ensembl Cavefish
Match: lrguk (leucine rich repeats and guanylate kinase domain containing [Source:NCBI gene;Acc:103023555])

HSP 1 Score: 55.0694 bits (131), Expect = 1.035e-6
Identity = 49/169 (28.99%), Postives = 82/169 (48.52%), Query Frame = 1
Query:  283 LSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRC--------------------KYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSR 729
            L + +++I +I+ ++K  +L    ++ NKI R+ GL NL  LK L +RGN +  I +  T R                       L  INF  NM   I+E+S L  +  L +L++  NPV     YR+ ++  L  L  LD   V A +K  A+ +++   L+ +++R
Sbjct:  118 LILDYNSITEIKGVEKCSSLIHFSIAHNKISRISGLNNL-PLKHLCLRGNLIKKIENLHTLRALQFLDISSNRIHSLSGLQNLPLLGSINFESNMISEIKEVSYLHDILLLRELNLKRNPVQEQPDYRMMVIFLLNRLTELDELAVTAVDKVTAVNKYDP-PLEVVAAR 284          
BLAST of centriolin vs. Ensembl Sea Lamprey
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 64.3142 bits (155), Expect = 9.784e-11
Identity = 47/140 (33.57%), Postives = 77/140 (55.00%), Query Frame = 1
Query:  226 GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKIN---FSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYL 636
            G  KI  +++LD+L N+TVLSI+ + I KIE L  L NL+ELYLS N I  ++GLEN   L  LD+  N++  I +       +LT++     + N   +  ++ +L   + L  + +  NP+     YR  I++ L ++
Sbjct:  196 GKNKITKLQNLDSLTNLTVLSIQSNRITKIEGLSSLVNLQELYLSHNGIEVIEGLENNKKLTTLDIAANRVRRIEN-----VGHLTELQEFWMNDNQISNWNDVDELKNARGLQTVYLERNPLQRDPQYRRKIMLALPWV 330          

HSP 2 Score: 53.1434 bits (126), Expect = 4.088e-7
Identity = 29/73 (39.73%), Postives = 48/73 (65.75%), Query Frame = 1
Query:  229 DKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSI 447
            D  ++ IE+LD L N+ +L I F+ + KIE LD L  +R+L+L  NKI +++ L +L  L++L+V  N++  I
Sbjct:  109 DNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVI 181          
BLAST of centriolin vs. Ensembl Sea Lamprey
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 53.1434 bits (126), Expect = 6.946e-7
Identity = 53/198 (26.77%), Postives = 92/198 (46.46%), Query Frame = 1
Query:  157 FIKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLK----------------------XXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIA 684
             I+   H  HL R+  L+L       ++  I  L NL ++ VL +  + I KI  L+ L  L  L L  N+I+R++ L +L  L++L++ GNQ+  +     R    L ++N  RN   S++E+  L +L+                       L ++ +  NP+A  A YR   +  +  L  LD + V  +E+++A
Sbjct:   63 LIRRAQHLSHLRRLVFLDLYA----NELEEISGLYNLRSLRVLMLGKNRIRKITSLESLTKLDVLDLHGNQIVRIENLSHLSELRVLNLAGNQITHVDS--LRGLHSLAELNLRRNNISSMKEVDCLPSLQRLFLSYNNIANFDGIVCLREAPSLCEVALDGNPLAQEACYRQTALRHMGQLRQLDMKRVTEEERRLA 254          
BLAST of centriolin vs. Ensembl Sea Lamprey
Match: cep97 (centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-031030-11])

HSP 1 Score: 52.373 bits (124), Expect = 1.371e-6
Identity = 48/168 (28.57%), Postives = 78/168 (46.43%), Query Frame = 1
Query:  187 LDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPV------AAIAHYRLYIVMRLKYLLILDNREVLADE 672
            L  +K+LNL        I  IE L +L ++  L++  ++I+ IE L+   +L  + LS+N I  L  +  L NL+ L + GN + S+    T     L  ++ + N    + E+S L  L+ L  L V +NP       A    +R Y++     L +LD   V   E
Sbjct:   78 LSSLKQLNLP----RNSIPAIEGLKDLCHLQWLNLAGNSIKTIEHLNGCTSLTYVDLSDNNISHLGDMSKLSNLRTLLLHGNMVTSLRTAPTHLPPQLGILSLAENEITDLTEMSHLSCLRSLEQLSVMKNPCMLSAPSAPACDHRPYVLSWCLTLRVLDGHVVTQKE 241          
BLAST of centriolin vs. Ensembl Sea Lamprey
Match: lrrc6 (leucine rich repeat containing 6 [Source:NCBI gene;Acc:432388])

HSP 1 Score: 50.8322 bits (120), Expect = 2.739e-6
Identity = 50/177 (28.25%), Postives = 83/177 (46.89%), Query Frame = 1
Query:  283 LSIRFHAIEKIEKLDKLC-NLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQ 810
            LS+    IE+++ LD  C +L+ LYL  N I R++ L  L  L+ +++  N +  I +   + C+ L K++ + N    +  +  L     L +L +  NP A    YR Y+V  L  L  LD +E+   E+  A       EL+    R+LE E +    +  Q       A+Q+Q
Sbjct:   23 LSLHQQQIERLQHLDVWCRHLKTLYLHNNVIPRIENLSRLKELEYINLALNNVERIEN--LQGCESLQKLDLTVNFVGELSSVETLRHNPLLEELFLVGNPCADFEGYRPYVVATLPQLKRLDGQEIERSERIRA-----HQELEWTRRRVLEQEAEYLARRAQQKLSYAGVARQNQ 192          
BLAST of centriolin vs. Ensembl Sea Lamprey
Match: LRRC9 (leucine rich repeat containing 9 [Source:HGNC Symbol;Acc:HGNC:19848])

HSP 1 Score: 50.0618 bits (118), Expect = 6.246e-6
Identity = 57/229 (24.89%), Postives = 101/229 (44.10%), Query Frame = 1
Query:  115 ILMNPPGVRYITEEFIKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHW--FTRRCKY---LTKINFSRNMFDSI-EEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKL 783
            +L  PP VR                 R K ++LD    +  +  +    +LN+ITVL++  +++ +++ +++L  LR L +S N++ RLD L ++ +L+ LDV  NQL ++      +R C       +++ +R+   S+      L TL          NP   +   RL  V +L+ L  LD   +  +E   A+ Q   +    +S  LL      E  +   L L
Sbjct:  122 VLSMPPTVR----------------PRPKLISLD----EASLLSLTKTSSLNHITVLNLHGNSLTRLKDINRLVFLRRLVVSFNELARLDDLTHMPSLEYLDVSHNQLGTLEGMKDLSRLCHLDISWNRLSCARDAAGSLRRHAGALVTLD------TRHNPWLKLECARLRFVGQLRSLASLDGVPITEEEVAAALRQAASSH---ISQALLLAHACTEAARPRCLSL 321          
BLAST of centriolin vs. Ensembl Nematostella
Match: EDO29833 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2I2])

HSP 1 Score: 115.161 bits (287), Expect = 1.511e-29
Identity = 61/131 (46.56%), Postives = 90/131 (68.70%), Query Frame = 1
Query:  130 PGVRYITEEFIKIIAHEDHLDRIKKLNLDCGKG-DKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSI 519
             GV YI+E  IK ++ E++L  IK LNL  GK  +KK RY+E+LDNL N++ L I  H IEKIEKLDKL  LREL LS N I +L+GLE+L++L++L++  NQ+ ++P    ++ + L   +F+ N  +S+
Sbjct:   14 AGVAYISENLIKRLSKEENLANIKSLNLALGKDLNKKFRYLENLDNLKNLSALHISNHMIEKIEKLDKLTQLRELNLSRNSITKLEGLESLVHLQVLNISRNQIQTLPAPLMKKLRELRVFHFAYNSLESV 144          
BLAST of centriolin vs. Ensembl Nematostella
Match: EDO33841 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR20])

HSP 1 Score: 72.4034 bits (176), Expect = 1.387e-12
Identity = 63/197 (31.98%), Postives = 114/197 (57.87%), Query Frame = 1
Query:  523 EISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAK-----QDQYQKDLNKKQKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQAYMGKGQF 1098
            EI+KL  L+DL ++ +  NP++ +AH  LY + +L+ L  LD + V+ DE+  A ++F ++E+ R+ + L    K  + + E +  +  +  K     Q Q +KD    Q++     K+L+  L +K+ +L  K+++L RAC+K + LEQ++AF K+DAKF+    H+G L  P+  +E  ++    + AY+GK  +
Sbjct:  113 EITKLRPLQDLTEISMVGNPMSTLAHSHLYAIFQLRSLTTLDKQTVMDDERVAADDRFGQDEIRRLEAELNRQNKLYDALFEEKHSVSTELDKVSRLHQQQKEKDTQLAQRN-----KELQRELNAKEEILASKTKELSRACEKQFRLEQELAFYKLDAKFE----HLGKLPWPEG-AEFPEVED-DEAAYIGKAGY 298          
BLAST of centriolin vs. Ensembl Nematostella
Match: EDO49856 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REV6])

HSP 1 Score: 63.5438 bits (153), Expect = 3.379e-10
Identity = 49/155 (31.61%), Postives = 88/155 (56.77%), Query Frame = 1
Query:  265 LNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSR 729
            L+ + +L +R + +     ++ L NLRELYL+ N I +++GL+ L +L  L +R NQ++S+   F+   K L  +N   N   S +E+ KL  L  L  L + ENPV+    YR+ +++ L+ L  LD  E   DE++ A E + + + + ++++
Sbjct:  164 LSRLAILELRGNKLMTTTGMN-LENLRELYLAANTIRKVEGLDRLEHLTKLHLRDNQIDSL-EGFSENMKNLQYLNLRGNSISSNKEVQKLKCLPLLRALVLMENPVSDEDDYRIEVLIALRRLERLDKDEYTEDERQEAEEIYNQRQEEELAAQ 316          
BLAST of centriolin vs. Ensembl Nematostella
Match: EDO48550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJB1])

HSP 1 Score: 56.6102 bits (135), Expect = 9.539e-8
Identity = 40/139 (28.78%), Postives = 74/139 (53.24%), Query Frame = 1
Query:  283 LSIRFHAIEKIEKLDKLC-NLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQF 696
            +S+    IE++E LDKLC +L+ LYL  N I +++ +  L  L+ +++  N +  I +     C+ L K++ + N  D +  I  L     L ++ ++ NP      YR Y++  L  L  LD +EV   E+ +A++++
Sbjct:   23 ISLHQQEIERLELLDKLCRDLKILYLQSNLIPKIENVSRLKKLEYINLALNNITRIENL--EGCESLKKLDLTVNFVDELTSIKSLKCNIHLQEMFLTGNPCTDYDGYREYVIATLTQLKWLDGKEVEKSERILALQEY 159          
BLAST of centriolin vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 55.4546 bits (132), Expect = 1.126e-7
Identity = 37/110 (33.64%), Postives = 65/110 (59.09%), Query Frame = 1
Query:  229 DKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKIN---FSRNMFDSIEEISKLWTLK 549
            D +I  IE+LD L N+ +L + F+ I+ IE L+ L  L +LYL +NKI R++GLE+L  L ++++  N++  +        ++LTK+      +N    ++ +S L +LK
Sbjct:   80 DNQISKIENLDRLVNLRILDLSFNVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGL-----EHLTKLESLFVGKNKITELQNLSGLCSLK 184          

HSP 2 Score: 50.447 bits (119), Expect = 4.247e-6
Identity = 44/159 (27.67%), Postives = 83/159 (52.20%), Query Frame = 1
Query:  160 IKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYL 636
            I+++   +HL +++ L +    G  KI  +++L  L ++ VLSI+ + I +++ L+ L +L ELY+S N I  + GLE+L  L  LD+  N++  I +        L +  F+ N  +  E++ +L     L  + +  NP++    YR  + + L  L
Sbjct:  149 IRVLEGLEHLTKLESLFV----GKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHLDSLEELYISHNGIEEIKGLESLTKLNTLDLASNRIKRISN--VGHLLNLEEFWFNDNQLEHWEDLDELAKCPKLHTVYLERNPLSRDTAYRRKVKLALPAL 301          
BLAST of centriolin vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 66.6254 bits (161), Expect = 8.434e-11
Identity = 53/159 (33.33%), Postives = 86/159 (54.09%), Query Frame = 1
Query:  160 IKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKIN---FSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRL 627
            I++I + D L  +  L L    G  KI  +++LD L+N++VLSI+ + I KIE L  L NL+ELYLS N I  ++GLEN   L  LD+  N++  I +       +LT++     + N  ++  ++ +L   K L  + +  NP+     YR  I++ L
Sbjct:  184 IRVIENLDGLTSLTSLFL----GTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIEN-----ISHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLERNPLQKDPQYRRKIMLAL 333          

HSP 2 Score: 60.4622 bits (145), Expect = 8.975e-9
Identity = 46/136 (33.82%), Postives = 73/136 (53.68%), Query Frame = 1
Query:  142 YITEEFIKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLK 549
            ++    I  IA+ +H   ++ L L    G  +IR IE+LD L ++T L +  + I K++ LD L NL  L +  N+I +++GL+NL+NLK L +  N +  I        K LT ++ + N    IE IS L  L+
Sbjct:  156 FLVHNKITGIANLEHFSFLEMLEL----GSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGL--ENNKKLTTLDIAANRVKKIENISHLTELQ 285          
BLAST of centriolin vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 63.1586 bits (152), Expect = 1.465e-9
Identity = 53/159 (33.33%), Postives = 86/159 (54.09%), Query Frame = 1
Query:  160 IKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKIN---FSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRL 627
            I++I + D L  +  L L    G  KI  +++LD L+N++VLSI+ + I KIE L  L NL+ELYLS N I  ++GLEN   L  LD+  N++  I +       +LT++     + N  ++  ++ +L   K L  + +  NP+     YR  I++ L
Sbjct:  223 IRVIENLDGLTSLTSLFL----GTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIEN-----ISHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLERNPLQKDPQYRRKIMLAL 372          

HSP 2 Score: 57.7658 bits (138), Expect = 7.614e-8
Identity = 46/136 (33.82%), Postives = 73/136 (53.68%), Query Frame = 1
Query:  142 YITEEFIKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLK 549
            ++    I  IA+ +H   ++ L L    G  +IR IE+LD L ++T L +  + I K++ LD L NL  L +  N+I +++GL+NL+NLK L +  N +  I        K LT ++ + N    IE IS L  L+
Sbjct:  195 FLVHNKITGIANLEHFSFLEMLEL----GSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEG--LENNKKLTTLDIAANRVKKIENISHLTELQ 324          
BLAST of centriolin vs. Ensembl Medaka
Match: lrguk (leucine rich repeats and guanylate kinase domain containing [Source:NCBI gene;Acc:101165778])

HSP 1 Score: 59.6918 bits (143), Expect = 3.085e-8
Identity = 50/165 (30.30%), Postives = 90/165 (54.55%), Query Frame = 1
Query:  235 KIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSR 729
             I  I  L+    +T LS+  + I +I  LD L  L  L L  N++ ++DGLEN+ +L++LD+  N++  +     +  + L  IN  +N    I+E   +  L  L DL++ ENP+    +YRL ++  L++L +LD   V A+EK  +  +++   +D +++R
Sbjct:  127 SISEITGLEQCYRLTHLSLAHNKISRISGLDGL-PLTYLCLRGNQLQKIDGLENVKSLQVLDLSLNRVTCL--TGLQSLQLLCSINLEKNQISEIDECKHIHNLLLLRDLNLLENPLQEQPNYRLAVIFLLQHLTMLDQEVVTAEEKVTSANKYDP-PMDLVAAR 287          
BLAST of centriolin vs. Ensembl Medaka
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:101162841])

HSP 1 Score: 54.6842 bits (130), Expect = 9.904e-7
Identity = 51/174 (29.31%), Postives = 90/174 (51.72%), Query Frame = 1
Query:  238 IRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEE 759
            I+ I+ L    ++  L +  + I+KI+ LD L NL  L LS N+I ++ GL +L  LK+L++  NQ+  I +  T     LT      N+ + +E +  L   K L+ + +  N  +    Y+ +IV     L +LDN+ +L + K+ A  +++++   R      E++KQL E
Sbjct:   48 IQRIDSLQEYTSLVRLDLNNNLIKKIQGLDSLINLTWLNLSFNRIEKIQGLTSLQKLKVLNLSNNQITVIENMDT--LDNLTHFFIGCNLLNQLENVLYLKRFKKLVHIYMKGNLFSNEDDYQFFIVAFFPNLTVLDNKLILQELKEKASSKYQDDIEKRNQE---ESQKQLAE 216          
BLAST of centriolin vs. Ensembl Medaka
Match: lrrc23 (leucine rich repeat containing 23 [Source:NCBI gene;Acc:105354421])

HSP 1 Score: 53.5286 bits (127), Expect = 1.273e-6
Identity = 44/137 (32.12%), Postives = 72/137 (52.55%), Query Frame = 1
Query:  268 NNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTL-KXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEK 675
             N+  L +R + +E  + L+ L NL+ LYL++N I  L+GL+ L +L IL +R N+L ++    +   K L  +N   N+    + +  +  + K L  L +SENP+ A A YR  ++  L  L  LD   V   E+
Sbjct:  165 GNLLTLELRGNHLETTDGLN-LPNLQRLYLADNGIKHLEGLDKLESLAILHIRDNKLETL-EGLSPNMKCLQYLNVRGNLIAEEKALQSIGLVAKSLQALVLSENPLVATADYRPNVLTLLPQLKRLDKEPVTPAER 299          
BLAST of centriolin vs. Planmine SMEST
Match: SMESG000006866.1 (SMESG000006866.1)

HSP 1 Score: 4118.15 bits (10679), Expect = 0.000e+0
Identity = 2141/2158 (99.21%), Postives = 2145/2158 (99.40%), Query Frame = 1
Query:  121 MNPPGVRYITEEFIKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQXXXXXXXXXXXXXXXXXXXFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQAYMGKGQFITKKEVEMLMERKRMKQGHSKKEQEENNGRNSTQKLKEDFVDSLNEKVKEKLTELNQINKEISEKNKIVDNLNNNIDHKELFYDSNTPTKSLIPNFHRADRPRSALASFXXXXXXXXXXXXXXXXXETESINKHNEHSNTTDLFLEKVENLTEMQREAEELRRQMESTEKESNRQQKDIEFLRSQFEKFKVADPNLANHIENEMKEKELHVDENLKLYDNLSKRLDQLSMEIEKSMNDIKEIEAKLLEENVFFTNDMKDKINTALSQLTQSVPNRINQDFKKVLDKCKYAEFENQKLQQKLIDQSKEIDALQHQLQNEGALSSRRSARSIDDEVEILRKELNRLRQDAVAAKDDLESEIEMEKVVNDXXXXXXXXXXXXXXXXXXXXXXXXXKHEKLIDQMKGDHYLMQEAIEREMMNFQDNVMHRIKIAASENQIEHLEKSKNPIDKALLNLIKSTTIEDKPPDTPADPEISKITEDLDHIKIQLTDINRKISIPSTITPLETSIGPKGFSRERDSQTLPIKKMLSKSNEIYKDELNDMKSKIRSLQDSLSKAMKMRKAQNKHKPSTNIKFTPKMSKETLYDISSSEDIQSTPKVRAHSQDRIPRKFKSVTPTAKKWNSMQQNISSDEQRVFDAIQDELQELIQHLNLSEYRNNQRIEEAMNRLSGFEHEYQSSREDRFSKERYDHIDQEKENLEEFLRETMSRVERCQEDIKQLNDKLGSNFRNSKQESDNNTYTSEMEKMAGILQSQKAEIERLNTILENLMKSAPSNNPQFVQQQAMPPNNSPLPGATYIPNGFLPQIHNSHSTPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLEDHFQNNGKHKSSWKLKQKFKSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINRDLAALRQNHQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIVIFGRFLDKESTCLAQEHFIEQQNLFKEYMQPNNSRISSNWENNGKAPGNDLPIGVESAILAEHQRHXXXXXXXXKDNIASATQASQNAQFNFDTLSGNKTFDNNLKWNTGSSGLGSTLDHTGNSLDTFENEKLKKALHSQFNEDVEKINSENSKSEIRCHQLRAEIDNLKSDFPSDKFPLSQSD 6594
            MNPPGVRYITEEFIKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKDLLDLDVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQLEENLKSKDLLLKKKSEDLFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQAYMGKGQFITKKEVEMLMERKRMKQGHSKKEQEENNGRNSTQKLKEDFVDSLNEKVKEKLTELNQINKEISEKNKIVDNLNNNIDHKELFYDSNTPTKSLIPNFHRADRPRSALASFNRLSPLRTLLNRPRRLSETESINKHNEHSNTTDLFLEKVENLTEMQREAEELRRQMESTEKESNRQQKDIEFLRSQFEKFKVADPNLANHIENEMKEKELHVDENLKLYDNLSKRLDQLSMEIEKSMNDIKEIEAKLLEENVFFTNDMKDKINTALSQLTQSVPNRINQDFKKVLDKCKYAEFENQKLQQKLIDQSKEIDALQHQLQNEGALSSRRSARSIDDEVEILRKELNRLRQDAVAAKDDLESEIEMEKVVNDELQKQLEELKQNEEILTENLEILQNKHEKLIDQMKGDHYLMQEAIEREMMNFQDNVMHRIKIAASENQIEHLEKSKNPIDKALLNLIKSTTIEDKPPDTPADPEISKITEDLDHIKIQLTDINRKISIPSTITPLETSIGPKGFSRERDSQTLPIKKMLSKSNEIYKDELNDMKSKIRSLQDSLSKAMKMRKAQNKHKPSTNIKFTPKMSKETLYDISSSEDIQSTPKVRAHSQDRIPRKFKSVTPTAKKWNSMQQNISSDEQRVFDAIQDELQELIQHLNLSEYRNNQRIEEAMNRLSGFEHEYQSSREDRFSKERYDHIDQEKENLEEFLRETMSRVERCQEDIKQLNDKLGSNFRNSKQESDNNTYTSEMEKMAGILQSQKAEIERLNTILENLMKSAPSNNPQFVQQQAMPPNNSPLPGATYIPNGFLPQIHNSHSTPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLEDHFQNNGKHKSSWKLKQKFKSDSEKYMMTLDSLKEDIHK+NEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFTQIQEQTTETLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEI+KIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKER+IMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINRDLAALRQNHQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNR             CLAQEHFIEQQNLFKEYMQPNNSRISSNWENNGKAPGNDLPIGVESAILAEHQRHLQNQLNLLKDNIASATQASQNAQFNFDTLSGNKTFDNNLKWNTGSSGLGSTLDHTGNSLDTFENEKLKKALHSQFNED+EKINSENSKSEIRCHQLRAEIDNLKSDFPSDKFPLSQSD
Sbjct:    1 MNPPGVRYITEEFIKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKDLLDLDVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQLEENLKSKDLLLKKKSEDLFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPLEEPDNMSEHSQISSTGDQAYMGKGQFITKKEVEMLMERKRMKQGHSKKEQEENNGRNSTQKLKEDFVDSLNEKVKEKLTELNQINKEISEKNKIVDNLNNNIDHKELFYDSNTPTKSLIPNFHRADRPRSALASFNRLSPLRTLLNRPRRLSETESINKHNEHSNTTDLFLEKVENLTEMQREAEELRRQMESTEKESNRQQKDIEFLRSQFEKFKVADPNLANHIENEMKEKELHVDENLKLYDNLSKRLDQLSMEIEKSMNDIKEIEAKLLEENVFFTNDMKDKINTALSQLTQSVPNRINQDFKKVLDKCKYAEFENQKLQQKLIDQSKEIDALQHQLQNEGALSSRRSARSIDDEVEILRKELNRLRQDAVAAKDDLESEIEMEKVVNDELQKQLEELKQNEEILTENLEILQNKHEKLIDQMKGDHYLMQEAIEREMMNFQDNVMHRIKIAASENQIEHLEKSKNPIDKALLNLIKSTTIEDKPPDTPADPEISKITEDLDHIKIQLTDINRKISIPSTITPLETSIGPKGFSRERDSQTLPIKKMLSKSNEIYKDELNDMKSKIRSLQDSLSKAMKMRKAQNKHKPSTNIKFTPKMSKETLYDISSSEDIQSTPKVRAHSQDRIPRKFKSVTPTAKKWNSMQQNISSDEQRVFDAIQDELQELIQHLNLSEYRNNQRIEEAMNRLSGFEHEYQSSREDRFSKERYDHIDQEKENLEEFLRETMSRVERCQEDIKQLNDKLGSNFRNSKQESDNNTYTSEMEKMAGILQSQKAEIERLNTILENLMKSAPSNNPQFVQQQAMPPNNSPLPGATYIPNGFLPQIHNSHSTPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLEDHFQNNGKHKSSWKLKQKFKSDSEKYMMTLDSLKEDIHKKNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFTQIQEQTTETLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEINKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERVIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINRDLAALRQNHQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNR-------------CLAQEHFIEQQNLFKEYMQPNNSRISSNWENNGKAPGNDLPIGVESAILAEHQRHLQNQLNLLKDNIASATQASQNAQFNFDTLSGNKTFDNNLKWNTGSSGLGSTLDHTGNSLDTFENEKLKKALHSQFNEDIEKINSENSKSEIRCHQLRAEIDNLKSDFPSDKFPLSQSD 2145          
BLAST of centriolin vs. Planmine SMEST
Match: SMESG000006866.1 (SMESG000006866.1)

HSP 1 Score: 2465.26 bits (6388), Expect = 0.000e+0
Identity = 1240/1257 (98.65%), Postives = 1244/1257 (98.97%), Query Frame = 1
Query: 2824 MSKETLYDISSSEDIQSTPKVRAHSQDRIPRKFKSVTPTAKKWNSMQQNISSDEQRVFDAIQDELQELIQHLNLSEYRNNQRIEEAMNRLSGFEHEYQSSREDRFSKERYDHIDQEKENLEEFLRETMSRVERCQEDIKQLNDKLGSNFRNSKQESDNNTYTSEMEKMAGILQSQKAEIERLNTILENLMKSAPSNNPQFVQQQAMPPNNSPLPGATYIPNGFLPQIHNSHSTPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLEDHFQNNGKHKSSWKLKQKFKSDSEKYMMTLDSLKEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFXXXXXXXXXXLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINRDLAALRQNHQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNRIVIFGRFLDKESTCLAQEHFIEQQNLFKEYMQPNNSRISSNWENNGKAPGNDLPIGVESAILAEHQRHXXXXXXXXKDNIASATQASQNAQFNFDTLSGNKTFDNNLKWNTGSSGLGSTLDHTGNSLDTFENEKLKKALHSQFNEDVEKINSENSKSEIRCHQLRAEIDNLKSDFPSDKFPLSQSD 6594
            MSKETLYDISSSEDIQSTPKVRAHSQDRIPRKFKSVTPTAKKWNSMQQNISSDEQRVFDAIQDELQELIQHLNLSEYRNNQRIEEAMNRLSGFEHEYQSSREDRFSKERYDHIDQEKENLEEFLRETMSRVERCQEDIKQLNDKLGSNFRNSKQESDNNTYTSEMEKMAGILQSQKAEIERLNTILENLMKSAPSNNPQFVQQQAMPPNNSPLPGATYIPNGFLPQIHNSHSTPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLEDHFQNNGKHKSSWKLKQKFKSDSEKYMMTLDSLKEDIHK+NEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFTQIQEQTTETLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEI+KIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKER+IMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINRDLAALRQNHQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNR             CLAQEHFIEQQNLFKEYMQPNNSRISSNWENNGKAPGNDLPIGVESAILAEHQRHLQNQLNLLKDNIASATQASQNAQFNFDTLSGNKTFDNNLKWNTGSSGLGSTLDHTGNSLDTFENEKLKKALHSQFNED+EKINSENSKSEIRCHQLRAEIDNLKSDFPSDKFPLSQSD
Sbjct:    1 MSKETLYDISSSEDIQSTPKVRAHSQDRIPRKFKSVTPTAKKWNSMQQNISSDEQRVFDAIQDELQELIQHLNLSEYRNNQRIEEAMNRLSGFEHEYQSSREDRFSKERYDHIDQEKENLEEFLRETMSRVERCQEDIKQLNDKLGSNFRNSKQESDNNTYTSEMEKMAGILQSQKAEIERLNTILENLMKSAPSNNPQFVQQQAMPPNNSPLPGATYIPNGFLPQIHNSHSTPILNTVPYSSIVTSEMKNAGSLFCNVPEHHYLEDHFQNNGKHKSSWKLKQKFKSDSEKYMMTLDSLKEDIHKKNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSLREETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRADNELKNSKIYFTQIQEQTTETLIKHDDARKNHKKVILECEELEKKSREASLELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEEISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEVVLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIKREFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQSELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVESKKLDADIKRKATEINKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEKSILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKCSETIKRDELKTQSNSVSKQLHESKCELQSIKERVIMIEAQCDERTSEIRKKMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKKNDEIKLLEKKIFDLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENLEASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSNHLAVINRDLAALRQNHQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCNRANSLSDDLNQARRDYMLLRNR-------------CLAQEHFIEQQNLFKEYMQPNNSRISSNWENNGKAPGNDLPIGVESAILAEHQRHLQNQLNLLKDNIASATQASQNAQFNFDTLSGNKTFDNNLKWNTGSSGLGSTLDHTGNSLDTFENEKLKKALHSQFNEDIEKINSENSKSEIRCHQLRAEIDNLKSDFPSDKFPLSQSD 1244          
BLAST of centriolin vs. Planmine SMEST
Match: SMESG000013624.1 (SMESG000013624.1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.227e-11
Identity = 54/162 (33.33%), Postives = 86/162 (53.09%), Query Frame = 1
Query:  274 ITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEE 759
            +  L +R + +      + +  L+ L+LS+N+I ++ GLENL++L +L +R N+L+ +   FT   + L  +N   N   +IEEI KL  L  L  L +S NPVA +  YRL  +  L+ L+ LD    L DE++   EQ  +    R+   +LE  K   E
Sbjct:  184 LVSLELRGNRLTDTSGFENMGKLKNLFLSKNQITKICGLENLISLSVLHLRDNELSEL-EGFTDDLQSLQYLNLRGNHVQAIEEIKKLKQLSLLRALILSGNPVAELDEYRLETLTTLRKLVRLDKDNFL-DEERTEAEQIYK---QRLHDEMLENRKSFTE 340          
BLAST of centriolin vs. Planmine SMEST
Match: SMESG000011491.1 (SMESG000011491.1)

HSP 1 Score: 64.6994 bits (156), Expect = 7.286e-10
Identity = 55/211 (26.07%), Postives = 100/211 (47.39%), Query Frame = 1
Query:  226 GDKKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRMSSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQI 858
            G  +I  IE L++L  + VL +  ++I+ IE ++ L +LR L L+ N I  L  L  L +L  +++R N + S+    +  C  L +I  S N    I + S L  L  L +L +  NP+++    R  ++     L +LD +++  D++  A +     EL   S+  L    Q    + +    Q +H ++    K+  K   +N ++I
Sbjct:  173 GRNRISKIEGLESLTRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSSRSAVIFNFPQLNLLDTKQITEDDRNKAKQIINRLELGSKSNSGLSRHIQGNNSRTSNSSQQSNHIQRFHSLKERQKGSLNNSQRI 383          
BLAST of centriolin vs. Planmine SMEST
Match: SMESG000061668.1 (SMESG000061668.1)

HSP 1 Score: 60.077 bits (144), Expect = 8.241e-9
Identity = 53/155 (34.19%), Postives = 80/155 (51.61%), Query Frame = 1
Query:  232 KKIRYIEHLDNLNNITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILDVRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKXXXXXXVSENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQF 696
            K I  I +L    ++T L +  + IEKIE LD+L +L  L LS NKI  ++GLENL+ L  L +  N++N I +      K L   +F +N+  SIE +  L   K L  L++S NP+     Y  +I      L+ LD + V   E +   E++
Sbjct:   72 KNILKINNLWAFKSLTKLQLVNNIIEKIENLDRLVHLEWLDLSFNKIEVIEGLENLVKLTDLSLYCNRINVIEN--MDNLKELNVFSFGKNLLTSIENVLYLRKFKKLQSLNLSGNPICHSDEYFSFIFAFFPNLMFLDYKLVTKMEHQACYEKY 224          
The following BLAST results are available for this feature:
BLAST of centriolin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNTRL2.114e-4937.31centriolin [Source:HGNC Symbol;Acc:HGNC:1858][more]
CNTRL1.246e-4637.61centriolin [Source:HGNC Symbol;Acc:HGNC:1858][more]
CNTRL1.246e-4637.61centriolin [Source:HGNC Symbol;Acc:HGNC:1858][more]
CNTRL1.189e-2122.46centriolin [Source:HGNC Symbol;Acc:HGNC:1858][more]
PPP1R71.595e-1032.70protein phosphatase 1 regulatory subunit 7 [Source... [more]
back to top
BLAST of centriolin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sds-225.645e-933.13Protein phosphatase 1 regulatory subunit SDS22 hom... [more]
K10D2.82.802e-836.45pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
C06A8.61.286e-635.24pep chromosome:WBcel235:II:7772499:7773914:1 gene:... [more]
back to top
BLAST of centriolin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sds222.939e-836.22gene:FBgn0028992 transcript:FBtr0083436[more]
TbCMF462.803e-731.37gene:FBgn0032163 transcript:FBtr0079898[more]
Ppr-Y1.004e-630.77gene:FBgn0046697 transcript:FBtr0346721[more]
back to top
BLAST of centriolin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc231.917e-1232.92leucine rich repeat containing 23 [Source:ZFIN;Acc... [more]
ppp1r74.634e-1131.64protein phosphatase 1, regulatory (inhibitor) subu... [more]
lrguk1.269e-1029.81leucine-rich repeats and guanylate kinase domain c... [more]
cntrl1.624e-819.03centriolin [Source:ZFIN;Acc:ZDB-GENE-120608-3][more]
cntrl1.741e-819.64centriolin [Source:ZFIN;Acc:ZDB-GENE-120608-3][more]
back to top
BLAST of centriolin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNTRL6.781e-4236.01centriolin [Source:NCBI gene;Acc:100270771][more]
CNTRL1.823e-4136.81centriolin [Source:NCBI gene;Acc:100270771][more]
CNTRL5.116e-4136.84centriolin [Source:NCBI gene;Acc:100270771][more]
lrrc231.397e-1135.71leucine rich repeat containing 23 [Source:NCBI gen... [more]
ppp1r72.703e-1032.05protein phosphatase 1 regulatory subunit 7 [Source... [more]
back to top
BLAST of centriolin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cntrl3.216e-5139.81centriolin [Source:MGI Symbol;Acc:MGI:1889576][more]
Cntrl1.175e-4839.76centriolin [Source:MGI Symbol;Acc:MGI:1889576][more]
Cntrl1.205e-4839.76centriolin [Source:MGI Symbol;Acc:MGI:1889576][more]
Cntrl1.205e-4839.76centriolin [Source:MGI Symbol;Acc:MGI:1889576][more]
Cntrl6.365e-3022.28centriolin [Source:MGI Symbol;Acc:MGI:1889576][more]
back to top
BLAST of centriolin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2AL36|CNTRL_MOUSE8.432e-4839.76Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 ... [more]
sp|Q7Z7A1|CNTRL_HUMAN5.983e-4637.61Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 S... [more]
sp|Q28CU0|LRC23_XENTR2.913e-1135.71Leucine-rich repeat-containing protein 23 OS=Xenop... [more]
sp|Q32PL1|PP1R7_DANRE3.498e-1031.64Protein phosphatase 1 regulatory subunit 7 OS=Dani... [more]
sp|Q3UM45|PP1R7_MOUSE4.241e-1032.70Protein phosphatase 1 regulatory subunit 7 OS=Mus ... [more]
back to top
BLAST of centriolin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H6WA310.000e+097.52Centriolin (Fragment) OS=Schmidtea mediterranea OX... [more]
A0A1S3JJS61.094e-6023.86centriolin isoform X2 OS=Lingula unguis OX=7574 GN... [more]
A0A1S3JIG31.947e-5924.06centriolin isoform X1 OS=Lingula unguis OX=7574 GN... [more]
A0A1S3JIC21.957e-5924.06centriolin isoform X3 OS=Lingula unguis OX=7574 GN... [more]
A0A1S3JJ597.336e-5924.03centriolin isoform X4 OS=Lingula unguis OX=7574 GN... [more]
back to top
BLAST of centriolin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drc33.586e-1232.28dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
ppp1r73.191e-1133.96protein phosphatase 1 regulatory subunit 7 [Source... [more]
drc32.669e-1033.33dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
lrrc232.436e-832.61leucine rich repeat containing 23 [Source:NCBI gen... [more]
lrguk1.035e-628.99leucine rich repeats and guanylate kinase domain c... [more]
back to top
BLAST of centriolin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r79.784e-1133.57protein phosphatase 1, regulatory (inhibitor) subu... [more]
LRRC496.946e-726.77leucine rich repeat containing 49 [Source:HGNC Sym... [more]
cep971.371e-628.57centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
lrrc62.739e-628.25leucine rich repeat containing 6 [Source:NCBI gene... [more]
LRRC96.246e-624.89leucine rich repeat containing 9 [Source:HGNC Symb... [more]
back to top
BLAST of centriolin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of centriolin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO298331.511e-2946.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO338411.387e-1231.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498563.379e-1031.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485509.539e-828.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449371.126e-733.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of centriolin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r78.434e-1133.33protein phosphatase 1 regulatory subunit 7 [Source... [more]
ppp1r71.465e-933.33protein phosphatase 1 regulatory subunit 7 [Source... [more]
lrguk3.085e-830.30leucine rich repeats and guanylate kinase domain c... [more]
drc39.904e-729.31dynein regulatory complex subunit 3 [Source:NCBI g... [more]
lrrc231.273e-632.12leucine rich repeat containing 23 [Source:NCBI gen... [more]
back to top
BLAST of centriolin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006866.10.000e+099.21SMESG000006866.1[more]
SMESG000006866.10.000e+098.65SMESG000006866.1[more]
SMESG000013624.11.227e-1133.33SMESG000013624.1[more]
SMESG000011491.17.286e-1026.07SMESG000011491.1[more]
SMESG000061668.18.241e-934.19SMESG000061668.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012954
GenBankAFB74713.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012954 ID=SMED30012954|Name=centriolin|organism=Schmidtea mediterranea sexual|type=transcript|length=6702bp
CGGTGGAAATCTTAAATTTTATTTTGTTAATTATATTAGTGGATTACTAT
TATAATAAACTGTTAAACTAATTACACTCAATCAAAAATCTTTTTTATAT
TCCAAATCTCTGTTATTTTGATGAATCCACCAGGGGTTCGATATATTACT
GAAGAATTCATTAAAATAATAGCACACGAAGACCATCTAGATCGAATTAA
AAAGTTAAATTTGGATTGCGGTAAAGGAGATAAAAAGATTCGTTATATTG
AACATTTGGATAATTTAAATAATATTACTGTCCTCAGTATTCGGTTTCAT
GCAATCGAAAAAATCGAAAAACTGGATAAATTATGCAATCTTCGAGAATT
GTATTTAAGTGAAAACAAAATTATCAGGCTTGATGGTTTAGAAAATTTAT
TAAACTTGAAAATTCTTGATGTGAGAGGTAATCAGTTAAATTCTATTCCC
CATTGGTTTACTAGGCGGTGTAAATATCTAACAAAAATTAATTTCTCCCG
CAACATGTTTGATTCGATTGAAGAAATATCAAAATTATGGACCTTGAAAG
ACTTACTGGATCTGGATGTGTCTGAGAATCCAGTAGCAGCAATTGCGCAC
TATCGATTGTACATTGTAATGAGGTTAAAATATTTACTAATACTTGACAA
TCGAGAAGTTCTTGCAGACGAGAAAAAAATTGCCATCGAACAATTTGAAG
AAAATGAATTAGACAGAATGAGTAGTCGATTGCTGGAAACAGAGAAACAA
CTTGAAGAAATGAAAGAAAACCAACTAAAACTTCAAAAAGACCACGCTAA
GCAAGATCAATATCAGAAAGATTTAAATAAAAAACAAAAGTCAAATATTG
AACAAATTAAACAGTTAGAAGAAAATTTAAAATCAAAAGATTTATTGCTT
AAAAAGAAATCAGAAGATTTATTCCGAGCATGCCAAAAGTATTATGAACT
TGAACAAGATATAGCATTTATAAAAATTGATGCAAAATTCGATTTACTTA
GTAATCACATCGGTCCATTAGAAGAGCCTGACAATATGTCCGAGCATTCA
CAAATATCAAGCACTGGAGATCAGGCTTATATGGGTAAAGGTCAATTTAT
CACTAAAAAGGAAGTAGAAATGTTAATGGAAAGAAAACGTATGAAACAAG
GTCACTCGAAAAAGGAACAGGAGGAAAATAATGGACGAAACTCGACACAG
AAGCTAAAGGAAGATTTTGTCGATTCACTCAACGAAAAAGTTAAAGAAAA
ACTTACTGAACTAAACCAAATTAACAAGGAAATATCAGAAAAAAATAAAA
TAGTCGATAACTTGAACAATAATATCGATCATAAAGAATTATTTTATGAT
TCAAATACTCCTACAAAATCATTAATACCCAATTTTCACCGAGCAGACAG
GCCGCGATCGGCGTTGGCGTCTTTTAATCGACTAAGTCCCCTTAGAACTT
TACTTAACAGACCAAGAAGACTCAGTGAAACAGAATCGATTAACAAACAC
AACGAGCATTCAAACACGACAGATTTGTTTTTAGAAAAAGTAGAAAATCT
AACTGAAATGCAAAGAGAAGCTGAAGAACTCAGAAGACAAATGGAATCCA
CGGAAAAAGAATCTAATCGTCAGCAAAAAGATATAGAATTTTTACGTAGC
CAATTTGAAAAATTCAAAGTAGCAGATCCTAATTTAGCTAATCATATAGA
AAATGAAATGAAAGAAAAAGAATTGCATGTCGATGAAAATCTGAAACTTT
ATGATAATTTATCTAAGCGTCTAGACCAATTATCTATGGAAATAGAGAAA
TCTATGAATGATATTAAGGAAATTGAAGCTAAACTTCTGGAGGAGAACGT
ATTTTTTACCAATGATATGAAAGATAAAATCAACACAGCATTGTCACAAT
TGACCCAATCCGTTCCGAATCGAATTAACCAGGACTTCAAAAAAGTTCTA
GACAAATGTAAATATGCAGAATTCGAAAATCAAAAATTGCAACAAAAACT
TATCGATCAAAGCAAAGAAATTGACGCATTGCAACACCAATTGCAGAACG
AAGGCGCGCTTAGTTCTCGAAGGTCTGCACGGTCAATTGATGACGAGGTG
GAAATCCTTCGTAAAGAGCTGAATCGATTACGTCAAGATGCAGTGGCAGC
CAAAGATGATCTAGAATCGGAAATAGAAATGGAAAAGGTGGTCAATGATG
AATTGCAAAAACAACTTGAAGAGCTTAAACAAAATGAAGAAATTTTGACA
GAAAACTTAGAGATTTTACAAAACAAGCATGAGAAATTAATAGATCAGAT
GAAAGGGGATCATTATCTGATGCAAGAAGCCATTGAAAGAGAAATGATGA
ACTTTCAAGATAATGTGATGCATAGAATAAAAATAGCAGCATCAGAAAAT
CAAATTGAACATTTAGAAAAATCTAAAAACCCGATAGATAAAGCTCTATT
AAACCTAATTAAATCAACCACCATTGAAGACAAACCTCCGGATACACCTG
CAGATCCAGAAATTTCTAAAATAACTGAAGATTTAGATCATATTAAAATC
CAGCTGACTGATATAAATAGAAAAATTTCTATTCCATCCACAATTACCCC
TCTAGAAACATCAATTGGTCCAAAAGGGTTTTCGAGAGAAAGAGATTCTC
AAACTTTACCAATTAAAAAAATGTTGTCGAAATCAAATGAAATTTACAAG
GATGAACTAAATGATATGAAATCCAAAATCAGGAGTTTACAAGATTCGTT
AAGCAAAGCTATGAAAATGAGAAAGGCTCAAAATAAACATAAACCGTCCA
CAAACATCAAGTTTACACCGAAAATGTCGAAAGAAACTTTATATGATATA
AGTTCATCTGAAGATATTCAATCAACTCCAAAAGTACGAGCCCATAGTCA
AGATCGAATTCCAAGAAAGTTCAAATCTGTAACACCAACAGCTAAAAAAT
GGAATAGCATGCAACAAAATATAAGCAGTGATGAGCAGAGAGTTTTTGAT
GCTATTCAAGACGAATTACAGGAATTAATACAACATCTTAATCTTTCTGA
ATATAGAAATAATCAAAGAATTGAAGAGGCCATGAATAGGTTATCAGGTT
TTGAACACGAATACCAAAGCTCTCGCGAAGATAGATTTTCAAAAGAAAGA
TATGACCACATTGATCAAGAAAAAGAAAATTTAGAAGAATTTTTAAGAGA
AACAATGTCCCGAGTTGAACGTTGTCAAGAAGACATCAAGCAATTGAATG
ACAAATTAGGCAGTAACTTTCGAAATTCGAAGCAAGAAAGTGACAACAAT
ACATATACCTCAGAAATGGAGAAAATGGCGGGAATTCTTCAAAGTCAAAA
GGCAGAAATTGAAAGACTGAATACTATTCTGGAAAATCTAATGAAATCTG
CACCCTCAAATAATCCTCAATTTGTTCAGCAACAGGCCATGCCTCCCAAT
AATTCTCCTTTGCCAGGTGCAACTTATATTCCAAACGGCTTTCTACCTCA
AATTCACAATAGTCATAGCACTCCAATATTAAACACGGTTCCTTATTCTT
CCATTGTTACAAGTGAAATGAAAAATGCTGGTTCACTTTTTTGTAATGTA
CCCGAACATCATTACCTAGAAGATCACTTTCAAAATAATGGCAAACATAA
ATCTTCGTGGAAATTGAAACAAAAATTTAAATCTGATTCGGAAAAATATA
TGATGACTCTCGATTCCTTGAAGGAGGATATTCATAAAAGAAACGAAGAT
TTAGATAATGTCGAAATTCAAATATCTAAACAAACAAACGAAATAGGAAG
GCTGAACTATCAAATTGACCAACTGAATTATACGAAACAAGATCTATTAA
ATAATATTAGTTCTTTAAGAGAAGAGACCGAATTTGTAACAAGGGAGACA
ATAGCCAGCACCAGTGAATCACTGGGTCACATGCGAGCCAGGAAGTCTCA
ATTATCCGATGAAATTAATAAAATGGATTCACTCATTCGTGAGAAAAAGG
ATGAACTATACCGCGCAGACAATGAATTAAAGAATTCTAAAATATATTTT
ACACAAATCCAGGAACAGACAACTGAGACTCTAATAAAGCATGACGATGC
CAGAAAAAATCACAAGAAAGTTATTCTTGAGTGCGAAGAGTTGGAAAAGA
AATCTAGAGAAGCTTCTCTAGAACTTGCAAAGGCGATGAATGAGTTAAAC
ATTGTTCAAAATGAGACATCAAAATTGACATCGAGTAAAATGAATCTGGA
GGAAGTTGTAGTCAAAATACAATCTATAATTAATCAAAAAGATAATGAGT
TCCAAAAAATAAACGAAGAAATCAGTCGAGCTGCACATCAATTAAATTCC
CTTAAATCTGATTTGAATATGGCCACAGAGCAGAACCGTGAAAAAATGCA
AATGCTTTCAGAAGGGGATCAGTTATTGTCCGATACAAGACTTGAACTTA
ATCGTTTAAAAAATGAAGTCGTACTAAATCAAGAGCATTTACAGAAAATG
GAATCGGATATAGGAGAAAGAAATGCTGCAATTGATATAGCAAATTCTGA
AATTGAACGATCTCGACAAGTCCATAATAGATTAATTCAAGAATATCAAA
GCGAGCAGGCTCGAATCAAGCGAGAATTTTCCGATCTTAAATTCGAATTG
GAAAATTTGAAAGATGAAAAGAATGATTTAATGTGTACAATAGAAAATTC
AAGGATGAAAAATATCCAGATGAAGGAAAATATTGACAAACAAGAACAAA
GTCAAATGGTACTCCAGTCAGAACTTGAAAAATTGAATTGTCAAACACAG
CACATTGATAGCATGTTGAGGATGAAGCAAGGTCAACTGGACAAAGTTCT
AGCCGAATATCAATCTAGATTAGTTGATCTCGAGAGAATCGACGAAGAAA
CTCACAAGCAGCATGTCGAATCAAAGAAATTGGATGCAGATATTAAACGG
AAAGCAACAGAAATTGATAAAATTCGACAAACTATAGCCATAGATTCTGA
AGGTTTTCAAAGATTACAATTCGATAAAGAGAGTATAGAGATGAGTATTT
CTACTCTTTCGAAGGAAAAAAGTATTTTACAAAATGAAAAAAAAGAGTTG
GAATCGAATCTTAAAATTTTAAGAAAACAAGAATCCCAAGTTCATGAAAC
TTTGACAGCATTGGAAGCAAAGGTTTCTCAGTCCCGTACAGAGTTGGAAA
AAATGCATTCTGAAAAGTGTAGTGAAACCATCAAACGAGACGAACTAAAA
ACTCAATCAAACTCTGTATCGAAACAATTGCATGAGTCGAAATGTGAATT
GCAATCAATTAAAGAGCGCCTTATCATGATTGAAGCTCAATGTGATGAGC
GTACGAGTGAAATTAGAAAGAAAATGCAATTGCAGTCTAATCTGAATATA
GAAATTAGGAAATTACAGGATCAAATACGGCTAGCAAATATTAGTTTTGA
CGAGCTCAATAGTGAAGCTCAAAGGAGAAAGGAGAAATGTAATGGACTTG
ACAAAGAAATTACAAAGAAAAATGATGAAATAAAACTCTTGGAAAAAAAA
ATCTTTGATCTCCAAAACAATGTTTCAAAGGAAGATAATAAATTGGAAAA
AATTTTAAAAAACAGTTCGTTTGAGCTTGCTCAGTTAAAATCAGAAATAA
CTGAGAAATTGGAAAATCTCGAAGCATCTGGTACTAAATTGCATCAATTA
AAAAAGGACGCTGCTATCAAAGAATTTACTGAACAGAAAATTTTTGAACT
TGAAGAAATTATTAAACAACAAGAAAATAATGCACATCACTATGAGCAAG
AGAATAGAAAACTATCCAATCATTTAGCAGTAATTAATAGAGACCTCGCT
GCTTTGCGACAAAATCACCAATTCGAAATGGATAATAAAGATAAAGAACT
ATCAAGACTTCGTAAACGAGTAGCTAAAGAAATTTTTCAGTTGGAAAAGT
TAGCGGAAGACCAGTGCAACCGTGCCAACAGTTTGTCTGATGATCTGAAT
CAAGCTCGTAGAGATTATATGCTATTGCGGAATCGGATTGTTATTTTTGG
AAGATTTTTGGACAAGGAATCTACGTGTTTGGCTCAAGAGCATTTCATTG
AACAGCAGAATTTATTTAAAGAATATATGCAACCAAACAATTCTAGAATA
TCCTCAAATTGGGAAAATAACGGTAAAGCACCTGGAAATGATTTACCAAT
TGGTGTGGAATCGGCCATATTGGCTGAACATCAGCGCCATTTGCAAAATC
AATTGAATCTCCTAAAGGATAATATTGCTTCAGCGACCCAAGCTTCACAG
AATGCTCAATTTAACTTTGATACTCTTTCTGGGAATAAGACATTTGATAA
CAATCTCAAATGGAATACTGGATCTTCGGGTCTTGGATCTACTTTAGACC
ATACTGGGAACTCATTAGACACTTTTGAAAATGAGAAATTAAAAAAAGCT
TTACACAGTCAATTCAATGAAGATGTAGAAAAAATCAATAGTGAAAATAG
CAAAAGTGAAATCCGTTGCCATCAGTTGCGTGCTGAAATTGATAATTTGA
AATCTGACTTTCCCAGTGACAAATTTCCTCTTTCACAAAGCGACTGACTT
AATCTCATTGTATTATTTTTTTGACAATATTTTATATATTTATCAAAATG
GCATTTGCTAAATGTTCAGACAATGTTTGTGTGTATTATAATTTGTGGAG
AA
back to top

protein sequence of SMED30012954-orf-1

>SMED30012954-orf-1 ID=SMED30012954-orf-1|Name=SMED30012954-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2159bp
MNPPGVRYITEEFIKIIAHEDHLDRIKKLNLDCGKGDKKIRYIEHLDNLN
NITVLSIRFHAIEKIEKLDKLCNLRELYLSENKIIRLDGLENLLNLKILD
VRGNQLNSIPHWFTRRCKYLTKINFSRNMFDSIEEISKLWTLKDLLDLDV
SENPVAAIAHYRLYIVMRLKYLLILDNREVLADEKKIAIEQFEENELDRM
SSRLLETEKQLEEMKENQLKLQKDHAKQDQYQKDLNKKQKSNIEQIKQLE
ENLKSKDLLLKKKSEDLFRACQKYYELEQDIAFIKIDAKFDLLSNHIGPL
EEPDNMSEHSQISSTGDQAYMGKGQFITKKEVEMLMERKRMKQGHSKKEQ
EENNGRNSTQKLKEDFVDSLNEKVKEKLTELNQINKEISEKNKIVDNLNN
NIDHKELFYDSNTPTKSLIPNFHRADRPRSALASFNRLSPLRTLLNRPRR
LSETESINKHNEHSNTTDLFLEKVENLTEMQREAEELRRQMESTEKESNR
QQKDIEFLRSQFEKFKVADPNLANHIENEMKEKELHVDENLKLYDNLSKR
LDQLSMEIEKSMNDIKEIEAKLLEENVFFTNDMKDKINTALSQLTQSVPN
RINQDFKKVLDKCKYAEFENQKLQQKLIDQSKEIDALQHQLQNEGALSSR
RSARSIDDEVEILRKELNRLRQDAVAAKDDLESEIEMEKVVNDELQKQLE
ELKQNEEILTENLEILQNKHEKLIDQMKGDHYLMQEAIEREMMNFQDNVM
HRIKIAASENQIEHLEKSKNPIDKALLNLIKSTTIEDKPPDTPADPEISK
ITEDLDHIKIQLTDINRKISIPSTITPLETSIGPKGFSRERDSQTLPIKK
MLSKSNEIYKDELNDMKSKIRSLQDSLSKAMKMRKAQNKHKPSTNIKFTP
KMSKETLYDISSSEDIQSTPKVRAHSQDRIPRKFKSVTPTAKKWNSMQQN
ISSDEQRVFDAIQDELQELIQHLNLSEYRNNQRIEEAMNRLSGFEHEYQS
SREDRFSKERYDHIDQEKENLEEFLRETMSRVERCQEDIKQLNDKLGSNF
RNSKQESDNNTYTSEMEKMAGILQSQKAEIERLNTILENLMKSAPSNNPQ
FVQQQAMPPNNSPLPGATYIPNGFLPQIHNSHSTPILNTVPYSSIVTSEM
KNAGSLFCNVPEHHYLEDHFQNNGKHKSSWKLKQKFKSDSEKYMMTLDSL
KEDIHKRNEDLDNVEIQISKQTNEIGRLNYQIDQLNYTKQDLLNNISSLR
EETEFVTRETIASTSESLGHMRARKSQLSDEINKMDSLIREKKDELYRAD
NELKNSKIYFTQIQEQTTETLIKHDDARKNHKKVILECEELEKKSREASL
ELAKAMNELNIVQNETSKLTSSKMNLEEVVVKIQSIINQKDNEFQKINEE
ISRAAHQLNSLKSDLNMATEQNREKMQMLSEGDQLLSDTRLELNRLKNEV
VLNQEHLQKMESDIGERNAAIDIANSEIERSRQVHNRLIQEYQSEQARIK
REFSDLKFELENLKDEKNDLMCTIENSRMKNIQMKENIDKQEQSQMVLQS
ELEKLNCQTQHIDSMLRMKQGQLDKVLAEYQSRLVDLERIDEETHKQHVE
SKKLDADIKRKATEIDKIRQTIAIDSEGFQRLQFDKESIEMSISTLSKEK
SILQNEKKELESNLKILRKQESQVHETLTALEAKVSQSRTELEKMHSEKC
SETIKRDELKTQSNSVSKQLHESKCELQSIKERLIMIEAQCDERTSEIRK
KMQLQSNLNIEIRKLQDQIRLANISFDELNSEAQRRKEKCNGLDKEITKK
NDEIKLLEKKIFDLQNNVSKEDNKLEKILKNSSFELAQLKSEITEKLENL
EASGTKLHQLKKDAAIKEFTEQKIFELEEIIKQQENNAHHYEQENRKLSN
HLAVINRDLAALRQNHQFEMDNKDKELSRLRKRVAKEIFQLEKLAEDQCN
RANSLSDDLNQARRDYMLLRNRIVIFGRFLDKESTCLAQEHFIEQQNLFK
EYMQPNNSRISSNWENNGKAPGNDLPIGVESAILAEHQRHLQNQLNLLKD
NIASATQASQNAQFNFDTLSGNKTFDNNLKWNTGSSGLGSTLDHTGNSLD
TFENEKLKKALHSQFNEDVEKINSENSKSEIRCHQLRAEIDNLKSDFPSD
KFPLSQSD*
back to top
Aliases
The feature 'centriolin' has the following synonyms
Synonym
centriolin
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005815microtubule organizing center
Vocabulary: molecular function
TermDefinition
GO:0008092cytoskeletal protein binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0051493regulation of cytoskeleton organization
GO:0000278mitotic cell cycle
GO:0051301cell division
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002074pharynx tip
Vocabulary: INTERPRO
TermDefinition
IPR028640CEP110
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1643..1698
NoneNo IPR availableCOILSCoilCoilcoord: 1232..1259
NoneNo IPR availableCOILSCoilCoilcoord: 2119..2146
NoneNo IPR availableCOILSCoilCoilcoord: 190..224
NoneNo IPR availableCOILSCoilCoilcoord: 1387..1463
NoneNo IPR availableCOILSCoilCoilcoord: 2038..2058
NoneNo IPR availableCOILSCoilCoilcoord: 1324..1365
NoneNo IPR availableCOILSCoilCoilcoord: 537..571
NoneNo IPR availableCOILSCoilCoilcoord: 1748..1824
NoneNo IPR availableCOILSCoilCoilcoord: 1073..1093
NoneNo IPR availableCOILSCoilCoilcoord: 232..266
NoneNo IPR availableCOILSCoilCoilcoord: 1018..1045
NoneNo IPR availableCOILSCoilCoilcoord: 620..640
NoneNo IPR availableCOILSCoilCoilcoord: 470..511
NoneNo IPR availableCOILSCoilCoilcoord: 849..883
NoneNo IPR availableCOILSCoilCoilcoord: 984..1004
NoneNo IPR availableCOILSCoilCoilcoord: 1197..1224
NoneNo IPR availableCOILSCoilCoilcoord: 1945..1972
NoneNo IPR availableCOILSCoilCoilcoord: 653..726
NoneNo IPR availableCOILSCoilCoilcoord: 1867..1933
NoneNo IPR availableCOILSCoilCoilcoord: 1471..1558
NoneNo IPR availableCOILSCoilCoilcoord: 367..401
NoneNo IPR availableCOILSCoilCoilcoord: 1275..1295
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 93..122
e-value: 200.0
score: 5.0
coord: 71..92
e-value: 5.5
score: 16.0
coord: 49..70
e-value: 44.0
score: 10.3
NoneNo IPR availablePFAMPF14580LRR_9coord: 76..200
e-value: 8.4E-14
score: 51.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 216..237
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 339..362
NoneNo IPR availablePANTHERPTHR34491FAMILY NOT NAMEDcoord: 4..1100
coord: 1154..1415
NoneNo IPR availableSUPERFAMILYSSF52075Outer arm dynein light chain 1coord: 38..192
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 15..205
e-value: 1.7E-29
score: 104.0
IPR028640CentriolinPANTHERPTHR34491:SF2CENTRIOLINcoord: 4..1100
IPR028640CentriolinPANTHERPTHR34491:SF2CENTRIOLINcoord: 1154..1415
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 119..140
score: 6.28
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 51..72
score: 5.517
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 73..94
score: 9.337
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 95..116
score: 6.842