TGc domain-containing protein

Overview
NameTGc domain-containing protein
Smed IDSMED30012935
Length (bp)2918
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TGc domain-containing protein (SMED30012935) t-SNE clustered cells

Violin plots show distribution of expression levels for TGc domain-containing protein (SMED30012935) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TGc domain-containing protein (SMED30012935) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TGc domain-containing protein (SMED30012935) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012935

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30012935SMESG000080370.1 dd_Smed_v4_4149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012935SMESG000080370.1 dd_Smed_v4_4149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012935SMESG000080370.1 dd_Smed_v4_4149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30012935SMESG000080370.1 dd_Smed_v4_4149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30012935SMESG000080370.1 dd_Smed_v4_4149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30012935SMESG000080370.1 dd_Smed_v4_4149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012935SMESG000080370.1 dd_Smed_v4_4149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012935SMESG000080370.1 dd_Smed_v4_4149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012935SMESG000080370.1 dd_Smed_v4_4149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012935SMESG000080370.1 SMESG000080369.1 Contig12453newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012935SMESG000080370.1 SMESG000080369.1 Contig12453uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012935SMESG000080370.1 Contig48127newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012935SMESG000080370.1 Contig48127uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30012935SMESG000080370.1 dd_Smed_v6_4149_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012935SMESG000080370.1 OX_Smed_1.0.04405ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30012935SMESG000080370.1 dd_Smed_v4_4149_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TGc domain-containing protein vs. Ensembl Human
Match: KY (kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:HGNC:26576])

HSP 1 Score: 96.6709 bits (239), Expect = 8.299e-20
Identity = 59/197 (29.95%), Postives = 98/197 (49.75%), Query Frame = 1
Query:  658 EYQKVCALFTWLTTKNLHELKFSSET-HASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFF-KYNLELYSHTQAVLEVQDKLVLMIK 1242
            + ++V A++ W+     +++  + E    +  P  +L    T    YA +F+ +CR  G+QC  + GY+KG  Y+ G    G  E  HAWNAV ++  W+L D  W +  +   TI S +  +  + FYF+T+P      HFP  ++WQL K   +L +FE+    K  F+ K  L  +  T  +  V  K  + I+
Sbjct:  182 DLERVRAIWIWICHHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSG--EFDHAWNAVYLEGRWHLVDSTWGSGLV--DTITS-KFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIE 373          
BLAST of TGc domain-containing protein vs. Ensembl Human
Match: KY (kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:HGNC:26576])

HSP 1 Score: 96.2857 bits (238), Expect = 8.876e-20
Identity = 59/197 (29.95%), Postives = 98/197 (49.75%), Query Frame = 1
Query:  658 EYQKVCALFTWLTTKNLHELKFSSET-HASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFF-KYNLELYSHTQAVLEVQDKLVLMIK 1242
            + ++V A++ W+     +++  + E    +  P  +L    T    YA +F+ +CR  G+QC  + GY+KG  Y+ G    G  E  HAWNAV ++  W+L D  W +  +   TI S +  +  + FYF+T+P      HFP  ++WQL K   +L +FE+    K  F+ K  L  +  T  +  V  K  + I+
Sbjct:  161 DLERVRAIWIWICHHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSG--EFDHAWNAVYLEGRWHLVDSTWGSGLV--DTITS-KFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIE 352          
BLAST of TGc domain-containing protein vs. Ensembl Human
Match: KY (kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:HGNC:26576])

HSP 1 Score: 66.6254 bits (161), Expect = 4.429e-11
Identity = 33/108 (30.56%), Postives = 56/108 (51.85%), Query Frame = 1
Query:  658 EYQKVCALFTWLTTKNLHELKFSSET-HASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAA 978
            + ++V A++ W+     +++  + E    +  P  +L    T    YA +F+ +CR  G+QC  + GY+KG  Y+ G    G  E  HAWNAV ++  W+L D  W +
Sbjct:  182 DLERVRAIWIWICHHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSG--EFDHAWNAVYLEGRWHLVDSTWGS 287          
BLAST of TGc domain-containing protein vs. Ensembl Celegans
Match: ltd-1 (Lim and Transglutaminase Domain [Source:UniProtKB/TrEMBL;Acc:A0A131MD24])

HSP 1 Score: 135.576 bits (340), Expect = 2.553e-33
Identity = 116/472 (24.58%), Postives = 198/472 (41.95%), Query Frame = 1
Query:  508 ENEIPSEDDYNIPEKRLDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINS------DRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQDK---LVLMIKLPIELVEKICXXXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAREY-------GDQI-FGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILAFLPDAGEYALEIYANNPEK 1872
            + EI +  DY      +DE+AI   ++  +SF  LI  L    S G + ++     A++ W+T KNL+ + F      +D+P  +L GI  G  +Y  +F+ LC Y GL C +I+G++K   Y+PG      +  ++ WNAV +D  W    C+W AR L+     S        ++Y+ D  YFMT+  +  Y  FP +  WQL  + ++L +FE +  V+  FFKYNL    +        DK     + I+LP +    I        +       G +L R+ +Q   +   + T     P +    L ++A          G  I F  +C+++V  +               +  + P P      +G  +    + L        + ++H +  I+  +  +      R +    +S H + +   R LQ  T      D   I    P  G+Y L+IY    ++
Sbjct:   31 KREIYTTTDYF---SSIDEVAIHCARNEVASFTDLIRTL----SSGAR-SDVDVARAIYRWITIKNLNTMIFDDSIQ-NDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHR-FRNTWNAVFLDGSWRFVQCNWGARHLVNAKDGSHEAKTDGNLRYEYDDHYFMTDSEEFIYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASISIRLPPKGDSLIFHYNLKFFDSEENTISGMSLKRFVMQSVTED--VVTFRVHAPSTRPLLLDIFANSVSSGAYLTGQPIKFKSVCKFKVVCE-------------SLQVIMVPLPECASGEWGPAKATRLFGL--------LPISHPDAIINTGRYVEIRFRMTRPLSEFVASLHRN-RTDDRALQACTRSALKGDMVYIQIEFPGEGQYGLDIYTRQDDQ 468          
BLAST of TGc domain-containing protein vs. Ensembl Celegans
Match: ltd-1 (Lim and Transglutaminase Domain [Source:UniProtKB/TrEMBL;Acc:A0A131MD24])

HSP 1 Score: 135.191 bits (339), Expect = 2.690e-32
Identity = 112/456 (24.56%), Postives = 192/456 (42.11%), Query Frame = 1
Query:  556 LDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSD------RIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQDK---LVLMIKLPIELVEKICXXXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAREY-------GDQI-FGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILAFLPDAGEYALEIYANNPEK 1872
            +DE+AI   ++  +SF  LI  L    S G + ++     A++ W+T KNL+ + F      +D+P  +L GI  G  +Y  +F+ LC Y GL C +I+G++K   Y+PG      +  ++ WNAV +D  W    C+W AR L+     S        ++Y+ D  YFMT+  +  Y  FP +  WQL  + ++L +FE +  V+  FFKYNL    +        DK     + I+LP +    I        +       G +L R+ +Q   +   + T     P +    L ++A          G  I F  +C+++V  +               +  + P P      +G  +    + L        + ++H +  I+  +  +      R +    +S H + +   R LQ  T      D   I    P  G+Y L+IY    ++
Sbjct:  278 IDEVAIHCARNEVASFTDLIRTL----SSGAR-SDVDVARAIYRWITIKNLNTMIFDDSIQ-NDTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGFSKSAGYQPGYSFDDHR-FRNTWNAVFLDGSWRFVQCNWGARHLVNAKDGSHEAKTDGNLRYEYDDHYFMTDSEEFIYEFFPSDHAWQLLPRPLSLLQFERIPFVRSLFFKYNLSFIDNKLESTVYTDKSGAASISIRLPPKGDSLIFHYNLKFFDSEENTISGMSLKRFVMQSVTED--VVTFRVHAPSTRPLLLDIFANSVSSGAYLTGQPIKFKSVCKFKVVCE-------------SLQVIMVPLPECASGEWGPAKATRLFGL--------LPISHPDAIINTGRYVEIRFRMTRPLSEFVASLHRN-RTDDRALQACTRSALKGDMVYIQIEFPGEGQYGLDIYTRQDDQ 702          
BLAST of TGc domain-containing protein vs. Ensembl Fly
Match: Hil (gene:FBgn0050147 transcript:FBtr0086255)

HSP 1 Score: 161.77 bits (408), Expect = 1.899e-40
Identity = 120/457 (26.26%), Postives = 210/457 (45.95%), Query Frame = 1
Query:  556 LDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLM--------GKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHT-QAVLEVQDKLVLMIKLPIELVEKICX----XXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYA-----REY--GDQI-FGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILAF-LPDAGEYALEIYAN 1860
            +D +AI++ +    +F  L+  L+     G    + +K   +F W+T KNL+ + F  +    D+P  +L GI  G  +Y  +F+ LC Y GL C +I+GY+K   Y+PG+K    +  +++WNAV V   W    C+W AR L+        G+  N D ++Y+ D  YF+T+P +  Y  +P +E+WQL K+ ITL EFE+L  V+  FF+Y L        AV+   D     +++ +    + CL                Y+G +L R+ +Q       I       P SG++ L ++A     +EY  G+ + F  +C++++  +  E +T            + P P      +G T+    + L        I +TH +  I   +         R +    ++ H++     +L +  T+  +T+D  +      P+ G+Y L+IY  
Sbjct:  355 VDRIAISVAQEDQKTFTDLVRQLV-----GRCTTDIEKARTIFRWITVKNLNAMHFDDDLRG-DTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSR-FRNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQGRGKN-DSLRYEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSV--IGNIVAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCE--ELQT-----------VMVPLPDCASGEWGPTKATRLFGL--------IPITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGIEEKKLAKYVTH--STLDDIVTFIINFPEEGQYGLDIYTR 778          
BLAST of TGc domain-containing protein vs. Ensembl Fly
Match: Hil (gene:FBgn0050147 transcript:FBtr0086256)

HSP 1 Score: 161.77 bits (408), Expect = 1.899e-40
Identity = 120/457 (26.26%), Postives = 210/457 (45.95%), Query Frame = 1
Query:  556 LDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLM--------GKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHT-QAVLEVQDKLVLMIKLPIELVEKICX----XXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYA-----REY--GDQI-FGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILAF-LPDAGEYALEIYAN 1860
            +D +AI++ +    +F  L+  L+     G    + +K   +F W+T KNL+ + F  +    D+P  +L GI  G  +Y  +F+ LC Y GL C +I+GY+K   Y+PG+K    +  +++WNAV V   W    C+W AR L+        G+  N D ++Y+ D  YF+T+P +  Y  +P +E+WQL K+ ITL EFE+L  V+  FF+Y L        AV+   D     +++ +    + CL                Y+G +L R+ +Q       I       P SG++ L ++A     +EY  G+ + F  +C++++  +  E +T            + P P      +G T+    + L        I +TH +  I   +         R +    ++ H++     +L +  T+  +T+D  +      P+ G+Y L+IY  
Sbjct:  355 VDRIAISVAQEDQKTFTDLVRQLV-----GRCTTDIEKARTIFRWITVKNLNAMHFDDDLRG-DTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSR-FRNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQGRGKN-DSLRYEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSV--IGNIVAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCE--ELQT-----------VMVPLPDCASGEWGPTKATRLFGL--------IPITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGIEEKKLAKYVTH--STLDDIVTFIINFPEEGQYGLDIYTR 778          
BLAST of TGc domain-containing protein vs. Ensembl Zebrafish
Match: ky (kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE-090313-64])

HSP 1 Score: 93.9745 bits (232), Expect = 1.799e-19
Identity = 56/182 (30.77%), Postives = 92/182 (50.55%), Query Frame = 1
Query:  655 NEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLG--ISTGK---TAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLEL 1185
            NE +K+ A++ WL     H +++  E +   S +   L   I  GK   + Y+ +   +CR  G++C  + GY+KG+ Y+    L   + + H WNAV +D  W+L D  W A  +    + S       D FYF+T P++   +HFP ++ WQL    I+++EFE   L    F++  L L
Sbjct:   60 NEVEKLRAIWIWLC----HNIEYDIEGYLGLSQKICSLDEVIRNGKGVCSGYSNLCVEMCREVGIECVEVSGYSKGIGYQARHSLAE-ECSDHEWNAVFIDGQWWLLDACWGAGTV---DMKSKTFVKRYDDFYFLTEPSEFINSHFPDDQTWQLLTTPISIQEFEMRPLRTSAFYQLGLTL 233          
BLAST of TGc domain-containing protein vs. Ensembl Zebrafish
Match: ky (kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE-090313-64])

HSP 1 Score: 87.4261 bits (215), Expect = 3.466e-17
Identity = 45/139 (32.37%), Postives = 73/139 (52.52%), Query Frame = 1
Query:  769 GISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLEL 1185
            G+ +G   Y+ +   +CR  G++C  + GY+KG+ Y+    L   + + H WNAV +D  W+L D  W A  +    + S       D FYF+T P++   +HFP ++ WQL    I+++EFE   L    F++  L L
Sbjct:   41 GVCSG---YSNLCVEMCREVGIECVEVSGYSKGIGYQARHSLAE-ECSDHEWNAVFIDGQWWLLDACWGAGTV---DMKSKTFVKRYDDFYFLTEPSEFINSHFPDDQTWQLLTTPISIQEFEMRPLRTSAFYQLGLTL 172          
BLAST of TGc domain-containing protein vs. Ensembl Xenopus
Match: cnpy1 (canopy FGF signaling regulator 1 [Source:Xenbase;Acc:XB-GENE-981809])

HSP 1 Score: 99.3673 bits (246), Expect = 7.353e-21
Identity = 70/234 (29.91%), Postives = 112/234 (47.86%), Query Frame = 1
Query:  550 KRLDELAITIGKHSFSSFIPLIYHLI-YNRSDGIKCNEYQKVCALFTWLTTKNLHELK-FSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLEL-YSHTQAVLEVQDKLVLMIK 1242
            ++LD  +  +GK S  +   L+  LI   R+D       +KV A++TW+     ++L     ++  S  P   LL        YA +F+ +C + G+QC  I G++KG  Y  G    G  E  HAWNAV ++  W+L D  W A      + NS + +Y+   FYF+T+P      HFP  ++WQL +  +++++FE       +F+   L   Y  T  V  V  K    I+
Sbjct:   88 EKLDAYSAKVGKAS--TVGQLVSSLIRMARTD------LEKVRAIWTWICHHIEYDLDGMEDKSKRSGDPNQTLLSGKGACEGYAGLFENMCSHAGIQCLKIGGFSKGFCYTTGQTFSG--ETNHAWNAVFLNKRWHLLDTTWGAG-FANSSTNSFKFRYNE--FYFLTHPALFIEEHFPDNQNWQLLQVPLSMKQFEGNLCRNSSFYNAGLTASYPETLQVETVNGKATFSIE 308          
BLAST of TGc domain-containing protein vs. Ensembl Xenopus
Match: lmbr1 (limb development membrane protein 1 [Source:Xenbase;Acc:XB-GENE-981846])

HSP 1 Score: 83.9593 bits (206), Expect = 5.048e-16
Identity = 89/369 (24.12%), Postives = 161/369 (43.63%), Query Frame = 1
Query:  655 NEYQKVCALFTWLTTKNLHELKFSSE-----THASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYN-LELYSHTQAVLEVQDKLVLMIKLPIELVEKICXXXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYA-REYGDQIFGGICEYRV-------NAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMAC---------QYNLNCSLENNSIRLTHGEFGISFFKDNKEND 1692
            ++ +K  A++ W+     H +++ +E     +  S  P  VL         Y+ +F+ +C   G++CK + GY+KG  YK G    G  ++ H WN V ++  W+L D  W +      T+++       + FYF+T+P      HFP E   QL +  ++L++FE L   K  F+K   L  +  T  V  V+ K    +   +E    +   F L       + +   LT +G++          L+    K+G   L ++A RE  + ++  I +Y+V       N K+P+      G   +  EK   + P+ Q     TE  C         + ++  +L+++ I++T        F+  +END
Sbjct:   61 SDLEKTRAIWIWIC----HHIEYDTEGLKDLSQVSCDPNDVLRTRKGVCAGYSSLFESMCSIAGVKCKSMSGYSKGGRYKTGQTFSG--DSTHEWNMVYLEGSWHLLDSTWGSV----ATVSTFCFLNLYNEFYFLTHPALFIEDHFPEENKHQLLEPCVSLKQFEKLNR-KCYFYKMGLLSSWPDTVTVETVKGK----VTFTLEGRHHLLFLFHLNKTETPGLMQ---LTEHGMK----------LDVYPQKTGEQILQIFAKREDSEGVYDWILDYKVICKSVDTNMKIPKCLMNPVGPSWL-SEKAGLFQPSHQDPVIYTEDGCCTVSFALKGKLSIFATLDSSEIQMTSDMKHRHIFQTQREND 400          
BLAST of TGc domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000026111.1 (kyphoscoliosis peptidase-like [Source:NCBI gene;Acc:100486532])

HSP 1 Score: 72.0182 bits (175), Expect = 2.958e-12
Identity = 54/186 (29.03%), Postives = 85/186 (45.70%), Query Frame = 1
Query:  655 NEYQKVCALFTWLTTKNLHE-------LKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYS 1191
            N  +K+ A++ WL   N+ E       L FS + +  +   A+  G+ +G   YA +F+ +CR  G+ CK I GY++  +Y  G+     K + H WNAV++D  W+L D  W A  +            DL    F+     LR    P E  WQ  +  +  +EFE        FF+ +L + S
Sbjct:  143 NHLEKIRAIWIWLC-HNISEWYDVEGYLGFSQKVYRPEDVLALGKGVCSG---YAGLFKEMCREIGIGCKEISGYSRTTEYSDGLSFHRTK-SNHMWNAVQLDTDWHLLDACWGAGTV------------DLQEKIFIPR-ISLRPIG-PDEATWQSWESVVPFQEFEQKIFKTSEFFRLHLFITS 309          
BLAST of TGc domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000026106.1 (kyphoscoliosis peptidase-like [Source:NCBI gene;Acc:100486532])

HSP 1 Score: 65.0846 bits (157), Expect = 2.384e-11
Identity = 39/116 (33.62%), Postives = 61/116 (52.59%), Query Frame = 1
Query:  655 NEYQKVCALFTWLTTKNLHELKFSSETHASDS-----PEAVLL---GISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAA 978
            N  +K+ A++ WL     H +++  E +   S     PE VL    G+ +G   YA +F+ +CR  G+ CK I GY++  +Y  G+     K + H WNAV++D  W+L D  W A
Sbjct:   66 NHLEKIRAIWIWLC----HNIRYDVEGYLGFSQKVYRPEDVLALGKGVCSG---YAGLFKEMCREIGIGCKEISGYSRTTEYSDGLSFHRTK-SNHMWNAVQLDTDWHLLDACWGA 173          
BLAST of TGc domain-containing protein vs. Ensembl Mouse
Match: Ky (kyphoscoliosis peptidase [Source:MGI Symbol;Acc:MGI:96709])

HSP 1 Score: 97.0561 bits (240), Expect = 4.431e-20
Identity = 56/198 (28.28%), Postives = 98/198 (49.49%), Query Frame = 1
Query:  655 NEYQKVCALFTWLTTKNLHELKFSSET-HASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFF-KYNLELYSHTQAVLEVQDKLVLMIK 1242
            ++ ++V A++ W+     ++++ + E    +  P  +L    T    YA +F+ +CR  G+QC  + GY+KG  Y+ G    G  E  HAWNAV ++  W+L D  W +  +      + +  +  + FYF+T+P      HFP  ++WQL K   +L +FE+    K  F+ K  L  +  T  +  V  K  + I+
Sbjct:  181 SDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFSG--EFDHAWNAVYLEGRWHLVDSTWGSGLV---DTTTSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSAHPETSMIRTVNGKATITIE 373          
BLAST of TGc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0E908|HIL_DROME (Hillarin OS=Drosophila melanogaster OX=7227 GN=Hil PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.904e-39
Identity = 120/457 (26.26%), Postives = 210/457 (45.95%), Query Frame = 1
Query:  556 LDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLM--------GKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHT-QAVLEVQDKLVLMIKLPIELVEKICX----XXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYA-----REY--GDQI-FGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILAF-LPDAGEYALEIYAN 1860
            +D +AI++ +    +F  L+  L+     G    + +K   +F W+T KNL+ + F  +    D+P  +L GI  G  +Y  +F+ LC Y GL C +I+GY+K   Y+PG+K    +  +++WNAV V   W    C+W AR L+        G+  N D ++Y+ D  YF+T+P +  Y  +P +E+WQL K+ ITL EFE+L  V+  FF+Y L        AV+   D     +++ +    + CL                Y+G +L R+ +Q       I       P SG++ L ++A     +EY  G+ + F  +C++++  +  E +T            + P P      +G T+    + L        I +TH +  I   +         R +    ++ H++     +L +  T+  +T+D  +      P+ G+Y L+IY  
Sbjct:  355 VDRIAISVAQEDQKTFTDLVRQLV-----GRCTTDIEKARTIFRWITVKNLNAMHFDDDLRG-DTPMGLLRGIKYGTESYHVLFKRLCSYAGLHCVVIKGYSKSAGYQPGVKFQDSR-FRNSWNAVYVAGAWRFVQCNWGARHLVNAKEAPKQGRGKN-DSLRYEYDDHYFLTDPREFIYEFYPLQEEWQLLKRPITLREFENLPFVRSLFFRYGLHFADEGYGAVVFTDDTGAATVRIAMPTDMQSCLIFHYNLKFYDSDEELSYDGVSLKRFVMQSV--IGNIVAFRVHAPCSGAFLLDIFANAVTPQEYLTGEPMKFKSVCKFKICCE--ELQT-----------VMVPLPDCASGEWGPTKATRLFGL--------IPITHQDPLIFAGRSLDLQFRMSRPLTDFMATLHKNGIEEKKLAKYVTH--STLDDIVTFIINFPEEGQYGLDIYTR 778          
BLAST of TGc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NBH2|KY_HUMAN (Kyphoscoliosis peptidase OS=Homo sapiens OX=9606 GN=KY PE=1 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 3.214e-19
Identity = 59/197 (29.95%), Postives = 98/197 (49.75%), Query Frame = 1
Query:  658 EYQKVCALFTWLTTKNLHELKFSSET-HASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFF-KYNLELYSHTQAVLEVQDKLVLMIK 1242
            + ++V A++ W+     +++  + E    +  P  +L    T    YA +F+ +CR  G+QC  + GY+KG  Y+ G    G  E  HAWNAV ++  W+L D  W +   +  TI S +  +  + FYF+T+P      HFP  ++WQL K   +L +FE+    K  F+ K  L  +  T  +  V  K  + I+
Sbjct:  182 DLERVRAIWIWICHHIEYDIAAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRLAGVQCMTVPGYSKGFGYQTGQSFSG--EFDHAWNAVYLEGRWHLVDSTWGSG--LVDTITS-KFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENNMYHKSEFYNKGMLSAHPETSMIRTVNGKATVTIE 373          
BLAST of TGc domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C8H8|KY_MOUSE (Kyphoscoliosis peptidase OS=Mus musculus OX=10090 GN=Ky PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.410e-19
Identity = 56/198 (28.28%), Postives = 98/198 (49.49%), Query Frame = 1
Query:  655 NEYQKVCALFTWLTTKNLHELKFSSET-HASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFF-KYNLELYSHTQAVLEVQDKLVLMIK 1242
            ++ ++V A++ W+     ++++ + E    +  P  +L    T    YA +F+ +CR  G+QC  + GY+KG  Y+ G    G  E  HAWNAV ++  W+L D  W +  +      + +  +  + FYF+T+P      HFP  ++WQL K   +L +FE+    K  F+ K  L  +  T  +  V  K  + I+
Sbjct:  181 SDLERVRAIWIWICHHIEYDVEAAQEKDRQAFKPTDILRTQKTNCDGYAGLFERMCRVAGVQCVTVPGYSKGFGYQTGQSFSG--EFDHAWNAVYLEGRWHLVDSTWGSGLV---DTTTSKFTFLYNEFYFLTHPALFIEDHFPDNKNWQLLKPPQSLRQFENSMYHKSEFYNKGMLSAHPETSMIRTVNGKATITIE 373          
BLAST of TGc domain-containing protein vs. UniProt/SwissProt
Match: sp|O14302|CYK3_SCHPO (cytokinesis protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cyk3 PE=1 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 5.763e-6
Identity = 47/196 (23.98%), Postives = 83/196 (42.35%), Query Frame = 1
Query:  676 ALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTA---YAQVFQMLCRYTGLQCKLIRGYAKGVD---YKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQDKLVLMIKL 1245
            A+F +++ +    + F+++T  +D        IS G+      A + + + +   L C++I GY K  D   Y   + +       HAWN V  DN   L D  +A+     + + S       + FYF+  P +  +TH P   D Q     +++     L  V   +F   L+L     ++L + D  VL I+ 
Sbjct:  501 AVFIYISER----ITFTNQTLDNDELRTSTQVISEGQGTPFEVALLVKEMLQALDLWCEVIEGYLKSPDDIYYTRDININ------HAWNVVTFDNEVRLIDASFASPTHPQQALKSS----SSNDFYFLMKPNECIFTHVPENPDQQFIMPDLSMPIVMALPWVSSVYFTLGLKLRKFNTSILHLNDLEVLQIEF 682          
BLAST of TGc domain-containing protein vs. TrEMBL
Match: A0A1S8WJI3 (TGc domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_09607 PE=4 SV=1)

HSP 1 Score: 479.174 bits (1232), Expect = 4.959e-152
Identity = 286/743 (38.49%), Postives = 403/743 (54.24%), Query Frame = 1
Query:  550 KRLDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQD-KLVLMIKLPIELVEKICXXXXXXXXXXXXI--YEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAREY-------------------GDQIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNCIKVLGQLVDVSSTEEETDYSDYLLQQNILSEKELTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQ--RLSSSDVXXXXXXXXXXXXQLSQWKDKCRLYKPINRKIKINKDSETIIQFSLQIPDAYHVAVVVAGEIWNQLSRENESDDVIWTGNVKFDSSTQADSKITVCACYNESITSYSTILEY 2706
            +RLDE A++I +    SF  LI+ LIY R+     +E +KV  +F WL TK+LH++ F  +    D+PE +L+GI TGK+ YAQ+F  LCRY GL CKL+ GYAKG +Y PGM+  G ++ QH+WNAV VD VW L DCHWAARRL+GK  + + ++Y LD+FYF+ NP QL YTHFP + DWQL +  ITL+EFE+L  VK  FFKYNL+L +H  AV+   D ++ ++I  P +  + +  TF L+++       Y G  LTRYG QE +          R P+ G+YKLL+YA+ +                      ++G +CEYR+ A                   + PYPP Q SSYG  E+A  Y +       ++R T G   I F   +      PR+MGRL+ +   D  L   LLQR+    N   + +   FLP+AGEY LEIYANNP K+G+SF+++WQ  I ++  S +  GLP I P A +G  P+F   GL+ +SHPDP+I  +     TG+    L  +  +P    ++++ QL+  S    E         Q IL +     V F +R P  G F+K  IY  P +   E+LP VF+YL+ A Q  R  S  V         +P Q SQWK+ C L+ P++  +  +     +I F L +P A  VAVVV G+ W  L++  +     W G V        + ++ VCA YN    +Y TILEY
Sbjct:  103 RRLDEHAVSISQQQQDSFKQLIWQLIYARN---ITDELEKVRVIFLWLCTKDLHKMNF--DNVKPDTPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMQFSG-RQGQHSWNAVLVDKVWRLVDCHWAARRLIGKRPSPENVRYGLDMFYFLANPGQLIYTHFPHDSDWQLLRHPITLKEFENLAPVKSAFFKYNLDLITHRNAVIVCTDPEVCVVIAFPPQAEKYLSFTFGLSIDNKEGSEEYRGLPLTRYGRQEISVVEHRSLFYVRPPRPGAYKLLIYAKHHQNGPAHQDNGAFDYSSDANSSSMYGAVCEYRLVANF------------HPNCSLPPYPPCQSSSYGPNELAKNYQIQAKQTQCTLRATRGCLEIRFALGSSLGLPPPRMMGRLRCTLVPDEALTRSLLQRSV---NGNREAVFAVFLPEAGEYGLEIYANNPAKDGNSFYVVWQYIILSDSESPV-RGLPTIPP-AYLGPMPRFDSMGLSTVSHPDPFIQAN-----TGELCIQLNQNPDIP----VRMMAQLIHASHDVSED------CSQQILQQMRDNQVYFVVRFPHPG-FFKFQIYALPYSEPGESLPGVFNYLLEATQVHRNRSGQV-------MCFPQQFSQWKEGCYLHSPLDGILSPSAQPSDVIPFKLTVPKAIAVAVVV-GDEWTHLNKVGDR----WEGQVSLKQHWGREHQLAVCANYNTGNGNYGTILEY 794          
BLAST of TGc domain-containing protein vs. TrEMBL
Match: H2KPM4 (Kyphoscoliosis peptidase OS=Clonorchis sinensis OX=79923 GN=CLF_102240 PE=4 SV=1)

HSP 1 Score: 478.789 bits (1231), Expect = 9.933e-151
Identity = 285/743 (38.36%), Postives = 403/743 (54.24%), Query Frame = 1
Query:  550 KRLDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQD-KLVLMIKLPIELVEKICXXXXXXXXXXXXI--YEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAREY-------------------GDQIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNCIKVLGQLVDVSSTEEETDYSDYLLQQNILSEKELTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQ--RLSSSDVXXXXXXXXXXXXQLSQWKDKCRLYKPINRKIKINKDSETIIQFSLQIPDAYHVAVVVAGEIWNQLSRENESDDVIWTGNVKFDSSTQADSKITVCACYNESITSYSTILEY 2706
            +R+DE A++I +    SF  LI+ LIY R+     +E +KV  +F WL TK+LH++ F  +    D+PE +L+GI TGK+ YAQ+F  LCRY GL CKL+ GYAKG +Y PGM+  G ++ QH+WNAV VD VW L DCHWAARRL+GK  + + ++Y LD+FYF+ NP QL YTHFP + DWQL +  ITL+EFE+L  VK  FFKYNL+L +H  AV+   D ++ ++I  P +  + +  TF L+++       Y G  LTRYG QE +          R P+ G+YKLL+YA+ +                      ++G +CEYR+ A                   + PYPP Q SSYG  E+A  Y +       ++R T G   I F   +      PR+MGRL+ +   D  L   LLQR+    N   + +   FLP+AGEY LEIYANNP K+G+SF+++WQ  I ++  S +  GLP I P A +G  P+F   GL+ +SHPDP+I  +     TG+    L  +  +P    ++++ QL+  S    E         Q IL +     V F +R P  G F+K  IY  P +   E+LP VF+YL+ A Q  R  S  V         +P Q SQWK+ C L+ P++  +  +     +I F L +P A  VAVVV G+ W  L++  +     W G V        + ++ VCA YN    +Y TILEY
Sbjct:  192 RRVDEHAVSISQQQQDSFKQLIWQLIYARN---ITDELEKVRVIFLWLCTKDLHKMNF--DNVKPDTPEEILMGIRTGKSTYAQIFYTLCRYAGLHCKLLIGYAKGAEYAPGMQFSG-RQGQHSWNAVLVDKVWRLVDCHWAARRLIGKRPSPENVRYGLDMFYFLANPGQLIYTHFPHDSDWQLLRHPITLKEFENLAPVKSAFFKYNLDLITHRNAVIVCTDPEVCVVIAFPPQAEKYLSFTFGLSIDNKEGSEEYRGLPLTRYGRQEISVVEHRSLFYVRPPRPGAYKLLIYAKHHQNGPAHQDNGAFDYSSDANSSSMYGAVCEYRLVANF------------HPNCSLPPYPPCQSSSYGPNELAKNYQIQAKQTQCTLRATRGCLEIRFALGSALGLPPPRMMGRLRCTLVPDEALTRSLLQRSV---NGNREAVFAVFLPEAGEYGLEIYANNPAKDGNSFYVVWQYIILSDSESPV-RGLPTIPP-AYLGPMPRFDSMGLSTVSHPDPFIQAN-----TGELCIQLNQNPDIP----VRMMAQLIHASHDVSED------CSQQILQQMRDNQVYFVVRFPHPG-FFKFQIYALPYSEPGESLPGVFNYLLEATQVHRNRSGQV-------MCFPQQFSQWKEGCYLHSPLDGILSPSAQPSDVIPFKLTVPKAIAVAVVV-GDEWTHLNKVGDR----WEGQVSLKQHWGREHQLAVCANYNTGNGNYGTILEY 883          
BLAST of TGc domain-containing protein vs. TrEMBL
Match: A0A5K3F1I3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 1.919e-148
Identity = 285/792 (35.98%), Postives = 416/792 (52.53%), Query Frame = 1
Query:  445 DPPEDFKPDLVEQVGKEVIPLENEIPSE--------DDYNIPEKRLDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQDKLV-LMIKLPIELVEKICXXXXXXXXXXXXI--YEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYA--REYGD------------------QIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNCIKVLGQLVDVSSTEEETDYSDYLLQQNILSEKELTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQRLSSSDVXXXXXXXXXXXXQLSQW-KDKCRLYKPINRKIKINKDSETI------IQFSLQIPDAYHVAVVVAGEIWNQLSRENESDDVIWTGNVKFDSSTQADSKITVCACYNESITSYSTILEY 2706
            +PP++F P L++       P  + IPS         DD     +++DE A+ +     +SF  LI+ LIY R+     ++ ++V A+F WL TK+LH++ F++ +    SPE +L+GI TGK+ YAQ+FQ LCRY  L CKL+ GYAKG DY PGM+  G    QH+WNAV VD  W L DCHWAARRL+ K  + + ++Y LD FYF+ NP+QL YTHFP ++DWQL    ITLEEFE L LVK  FFKYNL L SH  AV+   D  V +++  P +       T  L+ +       Y+  +L RY  QE   +        R P+ G+YKLL+YA  R+ G                    ++G +CEYR+ A++P                + P+PP Q  +YG TEMA ++N+    +  ++R   G   + F          PR+M RL  S   D  L + +LQR   +     + +I  FLPDAGE+ LE+YAN+PE++GSSFF IWQ  I +E  S    GLP++ P + +G   +F E GL  +SHPDP I           +  +L + +       +K++ QL+  S+   + D+S  +LQQ       +  V F +RIP+ G F+KL IY  P  +  ++LP V++YLI A     +           P+P Q + W +  C L  P    + ++     +      + FSL +P A+ VAVVV  + W  L    +     W GNV   +     S+++VCACY+E   ++ST+LEY
Sbjct:   54 EPPKEFVPQLLDPEPAYQKPAPDAIPSRAPAYPTQGDDAFKAFQKVDEHAMAVSYQEQNSFNQLIWQLIYARN---ITSDIERVRAIFLWLCTKDLHQMNFNNVS--PGSPEEILMGIRTGKSTYAQIFQTLCRYANLHCKLLLGYAKGADYSPGMRFSGASTGQHSWNAVLVDGTWRLVDCHWAARRLIVKRASVENVRYILDTFYFLANPSQLIYTHFPHDKDWQLLHHPITLEEFETLPLVKSAFFKYNLSLLSHRTAVILFSDPEVRVVVGFPKDAENSFLFTIGLSFDDNDSAEHYKNVSLMRYTRQEVIAQESCVAFYIRPPRPGAYKLLIYAKQRDSGSNQDVETASVGSNASSGEKNLYGAVCEYRLMARVPANAC------------LPPFPPCQTGNYGATEMAKRFNVVPHTQEATLRAQGGIAEVRFGLAPGTRQPMPRIMSRLHCSLMSDDALENCILQRVVKDGT---ETVITVFLPDAGEFGLEVYANDPERDGSSFFAIWQFLITSEVPSAA-RGLPNL-PASYLGPAARFYELGLQTVSHPDPLIKA---------DAGELRIQLAYQPQRPLKMMAQLIYASNNASD-DHSQMVLQQ-----MRVGQVYFMVRIPRLG-FFKLQIYALPEGDRNDSLPGVYNYLIEA-----TKTTHRVRGQLMPFPQQFAHWRRSGCFLDSPTEGILGLDASGRLMANPPAELPFSLAVPSAHTVAVVVDDD-WTYLEARGDR----WEGNVPMRAHWGRQSRLSVCACYSEHDATFSTLLEY 797          
BLAST of TGc domain-containing protein vs. TrEMBL
Match: A0A5K3EYU7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 1.874e-147
Identity = 285/792 (35.98%), Postives = 416/792 (52.53%), Query Frame = 1
Query:  445 DPPEDFKPDLVEQVGKEVIPLENEIPSE--------DDYNIPEKRLDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQDKLV-LMIKLPIELVEKICXXXXXXXXXXXXI--YEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYA--REYGD------------------QIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNCIKVLGQLVDVSSTEEETDYSDYLLQQNILSEKELTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQRLSSSDVXXXXXXXXXXXXQLSQW-KDKCRLYKPINRKIKINKDSETI------IQFSLQIPDAYHVAVVVAGEIWNQLSRENESDDVIWTGNVKFDSSTQADSKITVCACYNESITSYSTILEY 2706
            +PP++F P L++       P  + IPS         DD     +++DE A+ +     +SF  LI+ LIY R+     ++ ++V A+F WL TK+LH++ F++ +    SPE +L+GI TGK+ YAQ+FQ LCRY  L CKL+ GYAKG DY PGM+  G    QH+WNAV VD  W L DCHWAARRL+ K  + + ++Y LD FYF+ NP+QL YTHFP ++DWQL    ITLEEFE L LVK  FFKYNL L SH  AV+   D  V +++  P +       T  L+ +       Y+  +L RY  QE   +        R P+ G+YKLL+YA  R+ G                    ++G +CEYR+ A++P                + P+PP Q  +YG TEMA ++N+    +  ++R   G   + F          PR+M RL  S   D  L + +LQR   +     + +I  FLPDAGE+ LE+YAN+PE++GSSFF IWQ  I +E  S    GLP++ P + +G   +F E GL  +SHPDP I           +  +L + +       +K++ QL+  S+   + D+S  +LQQ       +  V F +RIP+ G F+KL IY  P  +  ++LP V++YLI A     +           P+P Q + W +  C L  P    + ++     +      + FSL +P A+ VAVVV  + W  L    +     W GNV   +     S+++VCACY+E   ++ST+LEY
Sbjct:  128 EPPKEFVPQLLDPEPAYQKPAPDAIPSRAPAYPTQGDDAFKAFQKVDEHAMAVSYQEQNSFNQLIWQLIYARN---ITSDIERVRAIFLWLCTKDLHQMNFNNVS--PGSPEEILMGIRTGKSTYAQIFQTLCRYANLHCKLLLGYAKGADYSPGMRFSGASTGQHSWNAVLVDGTWRLVDCHWAARRLIVKRASVENVRYILDTFYFLANPSQLIYTHFPHDKDWQLLHHPITLEEFETLPLVKSAFFKYNLSLLSHRTAVILFSDPEVRVVVGFPKDAENSFLFTIGLSFDDNDSAEHYKNVSLMRYTRQEVIAQESCVAFYIRPPRPGAYKLLIYAKQRDSGSNQDVETASVGSNASSGEKNLYGAVCEYRLMARVPANAC------------LPPFPPCQTGNYGATEMAKRFNVVPHTQEATLRAQGGIAEVRFGLAPGTRQPMPRIMSRLHCSLMSDDALENCILQRVVKDGT---ETVITVFLPDAGEFGLEVYANDPERDGSSFFAIWQFLITSEVPSAA-RGLPNL-PASYLGPAARFYELGLQTVSHPDPLIKA---------DAGELRIQLAYQPQRPLKMMAQLIYASNNASD-DHSQMVLQQ-----MRVGQVYFMVRIPRLG-FFKLQIYALPEGDRNDSLPGVYNYLIEA-----TKTTHRVRGQLMPFPQQFAHWRRSGCFLDSPTEGILGLDASGRLMANPPAELPFSLAVPSAHTVAVVVDDD-WTYLEARGDR----WEGNVPMRAHWGRQSRLSVCACYSEHDATFSTLLEY 871          
BLAST of TGc domain-containing protein vs. TrEMBL
Match: A0A0V0J7E0 (TGc domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR125061 PE=4 SV=1)

HSP 1 Score: 462.225 bits (1188), Expect = 2.609e-145
Identity = 284/787 (36.09%), Postives = 415/787 (52.73%), Query Frame = 1
Query:  445 DPPEDFKPDLVEQVGKEVIPLENEIPSEDDYNIP----------EKRLDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQD---KLVLMIKLPIELVEKICXXXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAR--------------EYGDQIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNCIKVLGQLVDVSSTEEETDYSDYLLQQNILSEKELTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQRLSSSDVXXXXXXXXXXXXQLSQWKDKCRLYKPINRKIKINKDSETIIQ------FSLQIPDAYHVAVVVAGEIWNQLSRENESDDVIWTGNVKFDSSTQADSKITVCACYNESITSYSTILEY 2706
            +PP++F+P +++       P     P+E D N             +R+DE A+ + +    +F  LI+ LIY R+     ++ ++V A+F WL TK+LH++ F  +    DSPE +L+GI TGK+ YAQ+F  LCRY  L CKLI GYAKG DY PGM+  G    QH+WNAV +D  W L DCHWAARRL+ K  + + I+Y LD FYF+ NP+QL YTHFP + DWQL    +TLEEFE L LVK  FFKYNL L S+  AV+   D   ++V+      E      L  T   +   E Y    L RY  QE  +K        R P+ G+YKLL+YA+              E  + ++G +CEYR+ A++                 + P+PP Q  +YG+TEMA ++N+       ++R   G   +  F     N   PRLMG+LK +      L   +LQR    ++      +L FLP+AGEY LE+YAN+P ++GSS+F IWQ  + +++ S +  GLP + P A +G  P+F E GL+ +SH DP+I        TG+    L     LPL    K++ QL+  ++   E D S  +LQQ  +++     V F +R P++G F+KL +Y  P  +  ++LP V++YLI A      S+         P+P Q + W+  C L  P    + +  +     Q      FS+ IP+A+ VAVVV G+ W QL  + +     W G++        + K+ VCA Y  +  +YST+LEY
Sbjct:   71 EPPKEFRPQMLDPEPANRKPTPTAYPAELDRNSAILQGEESFKAFRRVDEHAMLVSQQQQDNFTQLIWQLIYARN---ITSDLERVRAIFLWLCTKDLHKMNF--DNVKPDSPEEILMGIRTGKSTYAQIFLTLCRYANLHCKLILGYAKGADYSPGMRFTGSV-GQHSWNAVLIDGTWRLVDCHWAARRLIVKRASVENIRYVLDTFYFLANPSQLIYTHFPHDTDWQLLHHPVTLEEFESLALVKSAFFKYNLSLLSYRNAVIVFTDPEIRIVVGFPPGSENFLSFTLGLTFDDQDFTEHYNSVPLIRYARQEVLEKESCVAFYVRPPRPGAYKLLIYAKHKQGETAIASSDPPESTENLYGAVCEYRLMARVSHNVC------------LPPFPPCQTGNYGQTEMAKRFNIRAVCREPAVRAIQGTVELR-FASTDPNRPLPRLMGQLKCALLYAEALDHCILQRTLSTESA-----LLIFLPEAGEYGLEVYANDPARDGSSYFAIWQYLLTSDRASPV-RGLPSLPP-AYLGPGPKFSELGLSTVSHSDPFIRAD-----TGELCVHLAFQQNLPL----KLMAQLLFATNDASE-DCSHMILQQTRMNQ-----VYFLLRFPRTG-FFKLQLYALPENDRNDSLPGVYNYLIEA------SECHRLRGQVMPFPQQFAHWRRGCYLETPTEGILGLEANGRLSSQPPDSLPFSVSIPNAFAVAVVV-GDEWTQLDPKGDR----WEGSIPMKGHWGIERKLAVCASYAANDVNYSTLLEY 804          
BLAST of TGc domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000040397.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:312137:330052:1 gene:ENSAMXG00000039459.1 transcript:ENSAMXT00000040397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 1.579e-24
Identity = 102/392 (26.02%), Postives = 169/392 (43.11%), Query Frame = 1
Query:  385 NIAIQEETKNEETVPDLLYPDPPEDFKPDLVEQVGKEVI-PLENEIPSEDDYNIPEKRLDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELK-FSSETHASDSPEAVLLGISTGK---TAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAA------RRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQD---KLVLMIKLPIELVEKICXXXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICT-----LNFRF--PKSGSYKLLLYAREYG-DQIFGGICEYRVNAKLPE 1494
            N+ I+EE        D      P+D + +L + +  +    L  E+ +  D++    R+D   I  GK      I  +  +     +G   N+ +++ A++ WL     ++++ F   T    SP+ V   I TGK   + YA V   LC   G++C+ + GY KGV Y+PG K  G     HAWNAV ++  W+L D  W A      +R+  K  N          FYF+T+P +    H+P EE WQL ++ + L+EFE        F++  L L    Q  L+ ++    + + +  P      I                GS  T     E +K  G+ T     +  R   P +GS+++ L+AR  G    +  +C + +    P+
Sbjct:  135 NMVIEEEPTRRNAQIDTSQLSKPKDSRDNLNKLIKPQSSRKLFQELIANTDFS----RVDTYVINAGKELKRKKIYSVETIAQTIINGTT-NDLERLRAVWIWLCDNIEYDVEGFLGVTKKLYSPDDV---IRTGKAVCSGYAGVCLQLCNVVGIECREVNGYGKGVGYEPGQKCQG---TNHAWNAVNLEGHWHLLDSCWGAGNCDMSQRVFNKCYNE---------FYFLTDPEEFINDHYPAEEKWQLLERPVNLKEFEKKVTKSAQFYRLGLTLIHPKQCSLDTENGEATISMGLSEPANFTYTISQC------------NGSKKT-----ELSKSRGLLTITKSSMKLRVIPPTAGSFEVELFARAAGVTGSYSHLCSFLLKCAKPK 489          
BLAST of TGc domain-containing protein vs. Ensembl Cavefish
Match: ky (uncharacterized LOC103044048 [Source:NCBI gene;Acc:103044048])

HSP 1 Score: 111.309 bits (277), Expect = 1.716e-24
Identity = 96/361 (26.59%), Postives = 158/361 (43.77%), Query Frame = 1
Query:  445 DPPEDFKP-DLVEQVGKEVIPLENEIPSEDDYNIPEKRL----------DELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSP-----EAVL---LGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKY--DLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQD---KLVLMIKLPIELVEKICXXXXXXXXXXXXIYEGS----NLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAREYGD 1443
            +P +   P D   Q GK  +P+     S      P ++L          D LAI+ G+      +     +    + G   NE +K+ A++ WL     H +++  E +   SP     E V+    G+ +G   ++ +   +CR  G+QC+ + GY+KG+ + PG KL   + + H+WN V V + W L D  W A      T+N +   +    D FYF+T+P++   +HFP E+ WQL    I+LE+FE   L    F+   L L   TQ  +  +D    + +    P+    ++      T        + S    ++TR G+          +L    P  G Y+L L+AR  GD
Sbjct:  152 EPAKPLSPTDPGRQPGKACLPI-----SSSSQRKPRRQLFSSTGVFHKVDTLAISAGRELKEQGVFSAQSIARAITQGA-INELEKLRAIWVWLC----HNIEYDLEGYLGLSPKLCTPEEVIKQGRGVCSG---FSSICLEMCREVGVQCEEVSGYSKGIGHSPGRKLAQDR-SDHSWNVVWVKDRWGLLDACWGA-----GTVNMETKTFVKRFDDFYFLTDPSEFINSHFPDEQHWQLLDTPISLEKFELGPLKTSAFYTLGLTLQQPTQYKITTEDGEATVSVTSSRPLTFAYELRQRDVQTGVPGQREVDSSCGLLSVTRQGM----------SLRLLPPDPGDYELKLFARAEGD 483          
BLAST of TGc domain-containing protein vs. Ensembl Cavefish
Match: ky (uncharacterized LOC103044048 [Source:NCBI gene;Acc:103044048])

HSP 1 Score: 111.309 bits (277), Expect = 1.716e-24
Identity = 96/361 (26.59%), Postives = 158/361 (43.77%), Query Frame = 1
Query:  445 DPPEDFKP-DLVEQVGKEVIPLENEIPSEDDYNIPEKRL----------DELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSP-----EAVL---LGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKY--DLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQD---KLVLMIKLPIELVEKICXXXXXXXXXXXXIYEGS----NLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAREYGD 1443
            +P +   P D   Q GK  +P+     S      P ++L          D LAI+ G+      +     +    + G   NE +K+ A++ WL     H +++  E +   SP     E V+    G+ +G   ++ +   +CR  G+QC+ + GY+KG+ + PG KL   + + H+WN V V + W L D  W A      T+N +   +    D FYF+T+P++   +HFP E+ WQL    I+LE+FE   L    F+   L L   TQ  +  +D    + +    P+    ++      T        + S    ++TR G+          +L    P  G Y+L L+AR  GD
Sbjct:  152 EPAKPLSPTDPGRQPGKACLPI-----SSSSQRKPRRQLFSSTGVFHKVDTLAISAGRELKEQGVFSAQSIARAITQGA-INELEKLRAIWVWLC----HNIEYDLEGYLGLSPKLCTPEEVIKQGRGVCSG---FSSICLEMCREVGVQCEEVSGYSKGIGHSPGRKLAQDR-SDHSWNVVWVKDRWGLLDACWGA-----GTVNMETKTFVKRFDDFYFLTDPSEFINSHFPDEQHWQLLDTPISLEKFELGPLKTSAFYTLGLTLQQPTQYKITTEDGEATVSVTSSRPLTFAYELRQRDVQTGVPGQREVDSSCGLLSVTRQGM----------SLRLLPPDPGDYELKLFARAEGD 483          
BLAST of TGc domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000032424.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000151.1:316716:330052:1 gene:ENSAMXG00000039459.1 transcript:ENSAMXT00000032424.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.842 bits (268), Expect = 1.419e-23
Identity = 65/194 (33.51%), Postives = 100/194 (51.55%), Query Frame = 1
Query:  655 NEYQKVCALFTWLTTKNLHELK-FSSETHASDSPEAVLLGISTGK---TAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRI-KYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQD 1221
            N+ +++ A++ WL     ++++ F   T    SP+ V   I TGK   + YA V   LC   G++C+ + GY KGV Y+PG K  G     HAWNAV ++  W+L D  W A    G    S R+     + FYF+T+P +    H+P EE WQL ++ + L+EFE        F++  L L    Q  L+ ++
Sbjct:   60 NDLERLRAVWIWLCDNIEYDVEGFLGVTKKLYSPDDV---IRTGKAVCSGYAGVCLQLCNVVGIECREVNGYGKGVGYEPGQKCQG---TNHAWNAVNLEGHWHLLDSCWGA----GNCDMSQRVFNKCYNEFYFLTDPEEFINDHYPAEEKWQLLERPVNLKEFEKKVTKSAQFYRLGLTLIHPKQCSLDTEN 243          
BLAST of TGc domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009155.1 (pep scaffold:Pmarinus_7.0:GL483885:156116:165500:-1 gene:ENSPMAG00000008280.1 transcript:ENSPMAT00000009155.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 2.938e-17
Identity = 47/171 (27.49%), Postives = 87/171 (50.88%), Query Frame = 1
Query:  658 EYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTA-YAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFF 1167
            E +K+ +++ W+     +++K+      S+  +  +L   T   A YA +   +CR+ G++C+ + GY K + + P       ++  HAWNAV++   WYL D  W A  +  +T + +R     + FYF+ +P +   +H+P    WQL +  ++ E+FE   L    FF
Sbjct:   13 ELEKLRSIWIWVCHNIEYDVKYWFGKDKSNYKKEDVLSSRTAICAGYAGLVNEMCRHVGVECEEVVGYGKTLGHVPFQI----EDPNHAWNAVRIGGRWYLLDACWGAGAVSNETQSFNR---RYNEFYFLADPKKFVESHWPKISKWQLMEHLVSREDFEYRVLKDFRFF 176          
BLAST of TGc domain-containing protein vs. Ensembl Nematostella
Match: EDO40037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B7])

HSP 1 Score: 93.5893 bits (231), Expect = 2.220e-19
Identity = 60/205 (29.27%), Postives = 93/205 (45.37%), Query Frame = 1
Query:  655 NEYQKVCALFTWLTTKNLHELKFSSETHASDS------PEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVL-EVQDKLVLMIKLP 1248
            ++  +  AL+ W+T      + F SE +   +       E+VL+  S     +A +FQ LC    +Q + + G+AKG  Y  G ++ G K A H WN ++    W + D  W +   +G  +   R     +  YFM  P      HFP +  WQL    I+ EEFE+L +  P  F   L L SH      E  D +V+ ++ P
Sbjct:  210 SQRSRAFALYRWITLN----VSFDSEGYFGRAEKKECRAESVLVTRSAVSQGFANLFQALCMEADIQARSVDGFAKGYGYCAGDEIQGSKFA-HTWNILRTRVGWTICDVTWGSG-FLGDDLMFHR---QPNAHYFMVTPELAISDHFPLDTKWQLLDAVISKEEFENLIVPSPAIFSSGLRLESHKNCFYQEESDSIVITLRAP 405          
BLAST of TGc domain-containing protein vs. Ensembl Nematostella
Match: EDO32609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUI9])

HSP 1 Score: 85.8853 bits (211), Expect = 4.041e-17
Identity = 68/262 (25.95%), Postives = 109/262 (41.60%), Query Frame = 1
Query:  658 EYQKVCALFTWLTTKNLHELK--FSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEV-QDKLVLMIKLP---IELVEKICXXXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLY 1425
            + +K  A++ WLT    +++   F      S S E VL   ++    YA ++  L    GL+   + GYAKG  +K G +  G     HAWN +KVDN WY+ D  W A    G   +      + + + F+  P +  + H P EE WQ     I    FE          +  +EL SH     E   D + +    P   + L+ K+           G+  EG    R   +  ++      +  +FP +G+YK+ +Y
Sbjct:  227 DREKAFAIYRWLTFNVAYDVDGFFGRSEKKSTSAEDVLSSRTSVCAGYASLYTALGEAAGLEIHNVSGYAKGYGHKLGQRFEG---VNHAWNVLKVDNTWYVSDATWGA----GFVGDDMLFTKNPNTYRFLQVPDEAIFDHLPEEEKWQFLDPTIDKASFERSAKPSCEMLEMGIELESHKDYAYETPTDTIDMTFYCPGRKMLLMGKV-------KTSSGQALEGRERVRLRFKGLHQ----IEMRAQFPNAGTYKVEVY 470          
BLAST of TGc domain-containing protein vs. Ensembl Medaka
Match: ky (kyphoscoliosis peptidase [Source:NCBI gene;Acc:101165522])

HSP 1 Score: 98.2117 bits (243), Expect = 1.853e-20
Identity = 127/524 (24.24%), Postives = 204/524 (38.93%), Query Frame = 1
Query:  553 RLDELAITIG-----KHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELK-FSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYS--HTQAVLEVQDKLV-LMIKLPIELVEKICXXXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAR-EYGDQIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNL-NCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMG-LPDINPGAAIGSQPQFQEFGLTVLSHPDPYI-TISNKVETTGQEKHDL 2085
            R+D   I  G     +H +   +  I H I   S     NE  ++ A++ WL     +++  +   +    S E V+        +Y+ +   +CR  G++C+ + G++KGV Y+ G  L     + H WNAV +   W+L D  W A R+    +  +      D FYF+T+P +   +HFP EE WQL    I LE+FE        FF   L L +  H   V +  +  V +    P     +I     L   G  E  E S+ + +GI   + ++    L    P +GSY   ++AR E        +C + V    P         + ME   V P  P    S+G   +A    + +CS       +  G F +             R +  L    H   ++ + L +R    +   D  +     P  G Y L ++  + EK    F       +   KG    +  L   N G+A G   +  + GL+  SH    + T   K   T   + DL
Sbjct:  177 RIDSRVIRTGLELKERHVYD--VKTIVHSITRESR----NELDRLRAIWVWLCHNIEYDVSGYLGRSEKLSSLEEVIAAGRGVCCSYSSLCLEMCREVGIECQEVPGHSKGVGYRQGQSLRH-VNSDHLWNAVLLGGQWFLLDACWGAGRV---DMEHESFVRRFDDFYFLTDPEEFIESHFPEEEKWQLLDTPIILEDFEKRVFKTSAFFTLGLRLINPHHFHIVTDDGEANVSIGFSSPTTFTYEITQHRDLLHCGALEQKESSS-SSFGILTVSHRS--MNLQLLPPATGSYDCKVFARHEKASTPLVWVCSFTVECLAP---------RAME---VIPENPYL--SWGMQPVAASLGVADCSQSREVAEVDKGVFDLVL--------KTSRPLMVLCELVH--PQMEAALAKRCLATQIQPDILLCHVLCPFPGFYRLSVFVRDYEKSELKFQNAANFLLHC-KGKVFHVDELFPPNLGSACGPGTRTAQAGLSKFSHNASVVSTQQGKCNITFHNQRDL 662          
BLAST of TGc domain-containing protein vs. Ensembl Medaka
Match: ky (kyphoscoliosis peptidase [Source:NCBI gene;Acc:101165522])

HSP 1 Score: 97.8265 bits (242), Expect = 2.381e-20
Identity = 86/324 (26.54%), Postives = 138/324 (42.59%), Query Frame = 1
Query:  553 RLDELAITIG-----KHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELK-FSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYS--HTQAVLEVQDKLV-LMIKLPIELVEKICXXXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAR-EYGDQIFGGICEYRVNAKLPE 1494
            R+D   I  G     +H +   +  I H I   S     NE  ++ A++ WL     +++  +   +    S E V+        +Y+ +   +CR  G++C+ + G++KGV Y+ G  L     + H WNAV +   W+L D  W A R+    +  +      D FYF+T+P +   +HFP EE WQL    I LE+FE        FF   L L +  H   V +  +  V +    P     +I     L   G  E  E S+ + +GI   + ++    L    P +GSY   ++AR E        +C + V    P 
Sbjct:  177 RIDSRVIRTGLELKERHVYD--VKTIVHSITRESR----NELDRLRAIWVWLCHNIEYDVSGYLGRSEKLSSLEEVIAAGRGVCCSYSSLCLEMCREVGIECQEVPGHSKGVGYRQGQSLRH-VNSDHLWNAVLLGGQWFLLDACWGAGRV---DMEHESFVRRFDDFYFLTDPEEFIESHFPEEEKWQLLDTPIILEDFEKRVFKTSAFFTLGLRLINPHHFHIVTDDGEANVSIGFSSPTTFTYEITQHRDLLHCGALEQKESSS-SSFGILTVSHRS--MNLQLLPPATGSYDCKVFARHEKASTPLVWVCSFTVECLAPR 487          
BLAST of TGc domain-containing protein vs. Planmine SMEST
Match: SMESG000080370.1 (SMESG000080370.1)

HSP 1 Score: 1585.85 bits (4105), Expect = 0.000e+0
Identity = 810/814 (99.51%), Postives = 811/814 (99.63%), Query Frame = 1
Query:  274 MGNACSCVSXXXXXXXXXXXXXXILPKEEVNEALEDANIAIQEETKNEETVPDLLYPDPPEDFKPDLVEQVGKEVIPLENEIPSEDDYNIPEKRLDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQDKLVLMIKLPIELVEKICXXXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAREYGDQIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNCIKVLGQLVDVSSTEEETDYSDYLLQQNILSEKELTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQRLSSSDVXXXXXXXXXXXXQLSQWKDKCRLYKPINRKIKINKDSETIIQFSLQIPDAYHVAVVVAGEIWNQLSRENESDDVIWTGNVKFDSSTQADSKITVCACYNESITSYSTILEYYTC 2715
            MGNACSCVSKNKELDKKEENNNKILPKEEVNEALEDANIAIQEETKNEETVPDLLYPDPPEDFKPDLVEQVGKEVIPLENEIPSEDDYNIPEKRLDELAITIGKHSFSSFIPLIYHLIYNR+DGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQDKLVLMIKLPIELVEKICLTFTLTLEGLGEIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAREYGDQIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKN IDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNCIKVLGQLVDVSSTEEETDYSDYLLQQNILSEKELTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQRLSSSDVPYYGSGEGPYPYQLSQWKDKCRLYKPINRKIKINKDSETIIQFSLQIPDAYHVAVVVAGE WNQLSRENESDDVIWTGNVKFDSST ADSKITVCACYNESITSYSTILEYYTC
Sbjct:    1 MGNACSCVSKNKELDKKEENNNKILPKEEVNEALEDANIAIQEETKNEETVPDLLYPDPPEDFKPDLVEQVGKEVIPLENEIPSEDDYNIPEKRLDELAITIGKHSFSSFIPLIYHLIYNRTDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQDKLVLMIKLPIELVEKICLTFTLTLEGLGEIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAREYGDQIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNIIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNCIKVLGQLVDVSSTEEETDYSDYLLQQNILSEKELTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQRLSSSDVPYYGSGEGPYPYQLSQWKDKCRLYKPINRKIKINKDSETIIQFSLQIPDAYHVAVVVAGENWNQLSRENESDDVIWTGNVKFDSSTPADSKITVCACYNESITSYSTILEYYTC 814          
BLAST of TGc domain-containing protein vs. Planmine SMEST
Match: SMESG000073008.1 (SMESG000073008.1)

HSP 1 Score: 493.041 bits (1268), Expect = 3.868e-160
Identity = 302/827 (36.52%), Postives = 462/827 (55.86%), Query Frame = 1
Query:  349 PKEEVNEALEDA--NIAIQEETKNEETVPDLLYPDPPEDFKPDLVEQVGKEVIPLENEIPSEDDYNIPEKRLDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSS-------ETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIK-YDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQDKLVLMIKLP-IELVEKIC-XXXXXXXXXXXXIYEGSNLTRYGIQE---TNKKTGICTLNFRFPKSGSYKLLLYAREYGDQIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKEND--NFPRLMGRLKSSFHEDSKLVSRLLQR------NTYEKN--TIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNC----------IKVLGQLVDVSST--EEETDYSDYLLQQNILSE-KELTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQRLSSSDVXXXXXXXXXXXXQLSQWKDKCRLYKPINRKI---KINKDSETIIQFSLQIPDAYHVAVVVAGEIWNQLSRENESDDVIWTGNVKFDSSTQADSKITVCACYNESITSYSTILEY 2706
            P E VNE   D+  N    +    + +   + + + P+ FK ++ E+V +  IP    I  +   +  EK  D +A+ + +    +F  L++ LI+  +  +K  +  K  A+FTWLT  N  E  F         +   ++SP   L G+ TG+  YAQ FQ+LCR+ G++CKL+RGYAKG D+KPGMKL GGK AQHAWN+V++   WYL D HW ARRL G+  N  +     LDLFYF+ +P  ++Y+HFPF++ WQL    I+LE FE L +VKP FF++ L  ++  +A+++  + + + +K P  +  EKI       T     + ++   L+R+G+ E   T++   I     RFP+SGSYK++++A+   DQ+F G+CEY + A +  ++T          EKV P+PPTQQ+ YGKTE+  +YN+  S  N +I+          FK  K  D  + PRLM RLK +  +DS+L  +LL R      + Y+ +  ++++  I  +LPD  EYALEIYANNPE EGSSFFLIWQ  I   K   L   +P ++ G  +G+Q +F+E GL  LS+PDP IT++   +       D+++ +GLP+             I++LGQL+D S T  +++ DYS+ LLQQ  + +   L  V F IR+     FYKL+IY      E +T+P+  +YLI     +    +   G   G +P Q SQWK+ CRL +P+N+ +    +N D +    F + IP A  VA V+  E W Q S E++ ++  W G++  +SS ++ S +T+ A +N    SY  +LEY
Sbjct:   50 PTESVNEDHTDSLSNGITNKIPACDRSAKSITFAETPQYFKLNMAEEVSETEIPNPESI-EQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIH-ENPSVK-TDLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQT----------EKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVC-KAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVN---QCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHL--KGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEIFEVIIPQAMKVASVIDEE-WFQFS-ESKEEESKWIGSMSLNSSMKSGSLLTIFANFNSRYNSYIPLLEY 855          
BLAST of TGc domain-containing protein vs. Planmine SMEST
Match: SMESG000073008.1 (SMESG000073008.1)

HSP 1 Score: 490.345 bits (1261), Expect = 5.646e-153
Identity = 295/803 (36.74%), Postives = 453/803 (56.41%), Query Frame = 1
Query:  415 EETVPDLLYPDPPEDFKPDLVEQVGKEVIPLENEIPSEDDYNIPEKRLDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSS-------ETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIK-YDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQDKLVLMIKLP-IELVEKIC-XXXXXXXXXXXXIYEGSNLTRYGIQE---TNKKTGICTLNFRFPKSGSYKLLLYAREYGDQIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKEND--NFPRLMGRLKSSFHEDSKLVSRLLQR------NTYEKN--TIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNC----------IKVLGQLVDVSST--EEETDYSDYLLQQNILSEKE-LTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQRLSSSDVXXXXXXXXXXXXQLSQWKDKCRLYKPINRKI---KINKDSETIIQFSLQIPDAYHVAVVVAGEIWNQLSRENESDDVIWTGNVKFDSSTQADSKITVCACYNESITSYSTILEY 2706
            + +   + + + P+ FK ++ E+V +  IP    I  +   +  EK  D +A+ + +    +F  L++ LI+  +  +K  +  K  A+FTWLT  N  E  F         +   ++SP   L G+ TG+  YAQ FQ+LCR+ G++CKL+RGYAKG D+KPGMKL GGK AQHAWN+V++   WYL D HW ARRL G+  N  +     LDLFYF+ +P  ++Y+HFPF++ WQL    I+LE FE L +VKP FF++ L  ++  +A+++  + + + +K P  +  EKI       T     + ++   L+R+G+ E   T++   I     RFP+SGSYK++++A+   DQ+F G+CEY + A +  ++T          EKV P+PPTQQ+ YGKTE+  +YN+  S  N +I+          FK  K  D  + PRLM RLK +  +DS+L  +LL R      + Y+ +  ++++  I  +LPD  EYALEIYANNPE EGSSFFLIWQ  I   K   L   +P ++ G  +G+Q +F+E GL  LS+PDP IT++   +       D+++ +GLP+             I++LGQL+D S T  +++ DYS+ LLQQ  + +   L  V F IR+     FYKL+IY      E +T+P+  +YLI     +    +   G   G +P Q SQWK+ CRL +P+N+ +    +N D +    F + IP A  VA V+  E W Q S E++ ++  W G++  +SS ++ S +T+ A +N    SY  +LEY
Sbjct:  700 DRSAKSITFAETPQYFKLNMAEEVSETEIPNPESI-EQSRISPSEKYFDPVALNLCQKKIVTFETLVFQLIH-ENPSVKT-DLDKARAVFTWLTNINATEAHFDYINERKDFKNDEAESPIVYLHGLCTGQYTYAQFFQLLCRFAGIRCKLLRGYAKGNDFKPGMKLEGGKAAQHAWNSVEISGTWYLCDTHWTARRLAGRNSNQGKQNSTQLDLFYFLIHPDDMKYSHFPFDKSWQLVPNPISLETFEKLAIVKPAFFRFELSFHNQFEAIVKTNNDIKIELKFPNNDSTEKITFTYTFQTEGKAVDSFKDIPLSRFGLVEIVKTDETFSIVRFWIRFPESGSYKIMIFAKAVEDQLFSGVCEYYIIADISTEQT----------EKVKPFPPTQQTCYGKTELLSKYNIKSSWNNEAIKTLESSIFEIQFKSTKRTDCTSCPRLMARLKCNSIDDSELSKKLLIRIIAPTEDKYKSDVSSVEEVHIRGYLPDINEYALEIYANNPETEGSSFFLIWQHLIVC-KAILLDQPIPHLSQGFILGAQERFKELGLRALSYPDPLITVN---QCPIHPDADVSIKLGLPIVKALNSSSNHKPGIRILGQLLDASRTNQDDDNDYSNLLLQQAYVGDNNSLKEVEFMIRLTDKSKFYKLYIYAMSLDKELDTVPLAMTYLIQLDTNIDYDHL--KGKKYGEFPQQTSQWKEDCRLIRPMNKILTLPSVNGDGKREEIFEVIIPQAMKVASVIDEE-WFQFS-ESKEEESKWIGSMSLNSSMKSGSLLTIFANFNSRYNSYIPLLEY 1481          
BLAST of TGc domain-containing protein vs. Planmine SMEST
Match: SMESG000061907.1 (SMESG000061907.1)

HSP 1 Score: 440.269 bits (1131), Expect = 9.030e-133
Identity = 293/794 (36.90%), Postives = 429/794 (54.03%), Query Frame = 1
Query:  400 EETKNEETVPDLLYPDPPEDF--KP-DLVEQVGK-EVIPLENEIPSEDDYNIPE-----KRLDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQ-DKLVLMIKLPIELVEKICXXXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAR----------EYGDQIFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSR--LLQRNTYEKNTIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEKGSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQEKHDLTVSIGLPLSNCIKVLGQLVDVSSTEEETDYSDYLLQQNILSEKELTSVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQRLSSSDVXXXXXXXXXXXXQLSQWKDKCRLYKPINRKIKINKDSETIIQFSLQIPDAYHVAVVVAGEIWNQLSRENESDDVIWTGNVKFDSSTQADSKITVCACYN---ESITSYSTILEY 2706
            E T N  + P  +  +PP++F  KP +L E++ K E+  L +E+P++   +  E     +++DE A+ +      +F  LI+ LIY R+     +E +KV  +F WL TK+LH++ F  +    DSPE +L+GI TGK+ YAQ+F  LCRY GL CKLI GYAKG DY PGMK  G ++ +H+WNAV ++ VW L DCHWAARRL+GK    + ++Y+LD+FYF+ NP+QL YTHFP + DWQL    I +EEFE L  VK  FFKYNL+L +H  AV++    +  L I  P  + E++  TFTL+     E Y   +L RYG QE +          R P  GSYKLL+YA+              ++FG ICEY++++             H+ ++ + P+PP Q S+YG  EM  QY +      +S  + +G   + F     +     R+M +L S   ++S  ++   +LQR        D+ II  FLP+AGEY LE+YAN+ +K G+SF+ +WQ FI +   S +  GLP + PG     +P+F ++GL+  SH DP+I     V  TG    D+ + +       I+++ QL+  S    E   SD  LQ   L    +  V F IR+P  G F+K  I+  P +   E+LP VF+YLI   Q  S  +V         +P Q  QWK+ C LY+P N  +  N   + I  F + +  A  +AVV     W  L +   S D IWTG+V   +  +   K  +  C N   E+  +Y+TIL+Y
Sbjct: 1088 ESTANWASGP--MQKEPPKNFEAKPIELEEEIYKPEIQALPSEMPTKVAISPEETSKIFQKVDEHAMQVSSQQQDNFNQLIWQLIYARN---ITDELEKVRVIFLWLCTKDLHKMNF--DNIKQDSPEEILMGIRTGKSTYAQIFLTLCRYAGLHCKLIVGYAKGADYVPGMKFQG-RQGEHSWNAVLIEGVWRLIDCHWAARRLIGKEHKPENVRYELDMFYFLANPSQLIYTHFPHDNDWQLLHHSINIEEFESLAPVKSMFFKYNLDLVTHKNAVIQTNAPEFELRIAFPKGIEERLLFTFTLSFNDGSEKYNEVSLLRYGRQELDFINNHSCFCIRTPIPGSYKLLIYAKLINVEPNVQENDSQKMFGAICEYKIDSNF-----------HL-KQALPPFPPCQSSTYGPNEMYKQYPIESENVQSSFYIDNGTVEVKFLIKKPD----IRVMAKLFSCNVKNSDQLTEQCVLQRLIGN----DEAIINVFLPNAGEYGLEVYANDSKKNGNSFYAVWQYFIVSSTAS-IVSGLPSLQPGYLGPYEPKFSDYGLSTYSHKDPFI-----VANTG----DICIQLKTTRDKPIRIMAQLIHCSHNVSEM-CSDQFLQ---LGRDSV--VYFLIRLPHQG-FFKFQIFALPYSEMGESLPGVFNYLIEGNQS-SQYNV--------GFPQQFGQWKEGCYLYEPTNGVLGFNGKPDKIT-FRMDVMRAKSLAVVDNDNNWTHLEK---SSDGIWTGDVDMRNIWKKPGKNELSVCGNFGMEADANYATILKY 1823          

HSP 2 Score: 205.682 bits (522), Expect = 7.932e-54
Identity = 145/480 (30.21%), Postives = 229/480 (47.71%), Query Frame = 1
Query:  550 KRLDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQD---KLVLMIKLPIELVEKICXXXXXXXXXXXXIYEGSNLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAREYGDQ--------IFGGICEYRVNAKLPEKETEKNGEKHMEEEKVFPYPPT-QQSSYGKT-EMACQYNLNCSLENNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRNTYEKNTIDQFIILA----------FLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTE 1920
            +++D  AI + ++S+ +F  L++ L +      + ++ +K   +F W+T  ++++L F++ +H  + PE VLL +   K +YA  F+ +C Y GL C  I G+AKGVDYKPG  +    E  H WN + + N W L D HWA R L       D I Y  D FYF+  P Q  Y+HFP + +WQL +K +TL +FE+L L K  FFK  ++  S    V+  +D   K+ L    P     K+              +EG +L  Y +QET          FRFP +G + L ++A+E  +          F   CEY++        ++K    H       PYP T   +++G +  +   Y L    E+  I +T          +NK       +  +L+    ED  L+ +L +    +++ +DQ+I +A           LP+ GEY LEIYAN P  EG ++  I Q  +  E
Sbjct:   39 EKVDGHAIRVSQNSYPTFKDLLWDLAFR----YQLSDLEKARVIFRWMTACDMNKLDFAN-SHP-NGPEEVLLSLKNLKGSYANAFEFMCSYAGLCCLTISGFAKGVDYKPG-DVFKKDEFNHTWNVIHLQNSWQLIDAHWATRYLTSGKNTQDSIVYQYDDFYFIMEPQQAVYSHFPEKTEWQLLEKPLTLNQFENLPLTKSQFFKCGMDFRSQHHGVVHSKDGYLKMNLGFWKPDSFTYKLQTDENKDQ------FEGVSLRYYVLQETVNNQ--INFFFRFPTAGVFYLTIFAQELNEHNQPVTQENTFRAACEYKI-------ISDKAAANHS------PYPMTCHDANWGPSWSLISHYQLTPQQEDGVISITS--------PNNKPFVKTEIVFDKLR----EDVSLLCKLRKNGVDDEDILDQYIEIAEKPNKTSFSISLPEPGEYGLEIYANEPS-EGDTYTHICQYLLDFE 477          
BLAST of TGc domain-containing protein vs. Planmine SMEST
Match: SMESG000060198.1 (SMESG000060198.1)

HSP 1 Score: 134.035 bits (336), Expect = 1.969e-31
Identity = 75/247 (30.36%), Postives = 125/247 (50.61%), Query Frame = 1
Query:  556 LDELAITIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKFSSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVDYKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAAR-------------RLMGKTINSDRI--KYDLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKYNLELYSHTQAVLEVQD-KLVLMIKLP 1248
            +D + I +     ++F  L+ +L  + S  +     +KV A+F W+TT ++  + F      +D+   VL  I  G+ +  ++F  +CRY G+ C+ I GY+KG  Y+PGM +   +  ++ W AV V   W   +C+W AR              L+ +T  S  +  K   D FYF+T+  Q  + HFP ++ WQL  + ITL++F  L +VK  FF  NL    +   VL+ +  K+ + I +P
Sbjct: 1025 VDNMVIEVMLLEPTTFTELVLYLTKDCSKDV-----EKVRAIFRWITTYDIKSVNFDPAA-PNDTLVGVLRAIKCGQMSNNELFFRMCRYAGIHCQFISGYSKGAGYRPGMAIKDNRMFRNVWTAVYVAGAWRFVNCNWGARYLTSRLQELPSSGTLLSRTSQSQYLENKIRSDEFYFLTDAKQHIFEHFPDKKRWQLLTRPITLDQFMALPIVKSPFFNANLSFKRNYAEVLQTKKGKVTVKINMP 1265          
The following BLAST results are available for this feature:
BLAST of TGc domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
KY8.299e-2029.95kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:H... [more]
KY8.876e-2029.95kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:H... [more]
KY4.429e-1130.56kyphoscoliosis peptidase [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ltd-12.553e-3324.58Lim and Transglutaminase Domain [Source:UniProtKB... [more]
ltd-12.690e-3224.56Lim and Transglutaminase Domain [Source:UniProtKB... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hil1.899e-4026.26gene:FBgn0050147 transcript:FBtr0086255[more]
Hil1.899e-4026.26gene:FBgn0050147 transcript:FBtr0086256[more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ky1.799e-1930.77kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE... [more]
ky3.466e-1732.37kyphoscoliosis peptidase [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cnpy17.353e-2129.91canopy FGF signaling regulator 1 [Source:Xenbase;A... [more]
lmbr15.048e-1624.12limb development membrane protein 1 [Source:Xenbas... [more]
ENSXETT00000026111.12.958e-1229.03kyphoscoliosis peptidase-like [Source:NCBI gene;Ac... [more]
ENSXETT00000026106.12.384e-1133.62kyphoscoliosis peptidase-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ky4.431e-2028.28kyphoscoliosis peptidase [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of TGc domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q0E908|HIL_DROME1.904e-3926.26Hillarin OS=Drosophila melanogaster OX=7227 GN=Hil... [more]
sp|Q8NBH2|KY_HUMAN3.214e-1929.95Kyphoscoliosis peptidase OS=Homo sapiens OX=9606 G... [more]
sp|Q8C8H8|KY_MOUSE3.410e-1928.28Kyphoscoliosis peptidase OS=Mus musculus OX=10090 ... [more]
sp|O14302|CYK3_SCHPO5.763e-623.98cytokinesis protein 3 OS=Schizosaccharomyces pombe... [more]
back to top
BLAST of TGc domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8WJI34.959e-15238.49TGc domain-containing protein (Fragment) OS=Opisth... [more]
H2KPM49.933e-15138.36Kyphoscoliosis peptidase OS=Clonorchis sinensis OX... [more]
A0A5K3F1I31.919e-14835.98Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EYU71.874e-14735.98Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0V0J7E02.609e-14536.09TGc domain-containing protein OS=Schistocephalus s... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000040397.11.579e-2426.02pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ky1.716e-2426.59uncharacterized LOC103044048 [Source:NCBI gene;Acc... [more]
ky1.716e-2426.59uncharacterized LOC103044048 [Source:NCBI gene;Acc... [more]
ENSAMXT00000032424.11.419e-2333.51pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009155.12.938e-1727.49pep scaffold:Pmarinus_7.0:GL483885:156116:165500:-... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TGc domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO400372.220e-1929.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326094.041e-1725.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TGc domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ky1.853e-2024.24kyphoscoliosis peptidase [Source:NCBI gene;Acc:101... [more]
ky2.381e-2026.54kyphoscoliosis peptidase [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of TGc domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080370.10.000e+099.51SMESG000080370.1[more]
SMESG000073008.13.868e-16036.52SMESG000073008.1[more]
SMESG000073008.15.646e-15336.74SMESG000073008.1[more]
SMESG000061907.19.030e-13336.90SMESG000061907.1[more]
SMESG000060198.11.969e-3130.36SMESG000060198.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012935 ID=SMED30012935|Name=TGc domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2918bp
TAAAATGAAACATTACAGGCGCACACACACTTACCGTTCTTACTGTATAA
ACAGACAGTCAAATATAATTTCTACTTCATTTTCAGAGTATTTTAGTATG
AAATATTTCTCTTCCATAAACCTTCACATACAAACTATTTATCGATTTCT
TTAAGTGAATAAATAAATGGGATCTATATATTTGAATTTTTACAGTGCTT
AAGTGATTATAGTGGAATTTAACCAGTGGAATTATTTTTAATTTTATTAC
CATCATATTTTCATTTAAACGCAATGGGAAACGCTTGCTCATGTGTCTCG
AAAAACAAAGAGTTGGATAAGAAAGAAGAAAACAATAACAAAATATTACC
AAAGGAAGAAGTAAACGAAGCACTTGAAGATGCTAATATAGCCATCCAAG
AAGAAACAAAAAATGAAGAAACAGTACCTGATTTATTGTATCCCGATCCA
CCTGAAGACTTTAAGCCAGATTTAGTCGAACAAGTTGGGAAAGAAGTGAT
TCCATTAGAAAATGAAATTCCAAGTGAAGATGATTACAATATTCCAGAGA
AGCGGCTTGACGAATTAGCTATAACAATTGGAAAGCACAGTTTCAGCTCA
TTTATCCCGCTGATATATCACTTAATTTACAACAGATCAGATGGAATTAA
ATGCAATGAATATCAAAAAGTCTGTGCCTTATTTACTTGGTTAACAACCA
AAAATCTACACGAATTAAAATTTTCAAGTGAAACTCATGCGTCAGATTCA
CCGGAAGCGGTTTTATTGGGAATTTCTACCGGAAAAACAGCATATGCACA
AGTTTTTCAAATGCTGTGCAGATATACTGGCCTTCAATGTAAATTAATTA
GAGGATATGCAAAAGGTGTGGATTATAAACCTGGCATGAAACTAGGTGGA
GGCAAAGAAGCCCAGCATGCTTGGAACGCAGTGAAAGTAGATAATGTGTG
GTATTTGTTTGATTGCCATTGGGCTGCAAGACGGTTAATGGGAAAAACTA
TAAATTCTGATAGGATAAAATATGATCTTGATTTATTTTATTTTATGACG
AATCCAACTCAATTACGTTATACTCATTTTCCATTTGAAGAAGATTGGCA
ATTAACCAAGAAAAAAATTACATTAGAAGAATTTGAAGATTTAACTTTAG
TTAAACCAACATTTTTCAAGTATAACTTGGAACTGTATTCTCACACACAA
GCCGTCTTAGAAGTCCAAGACAAATTGGTTCTCATGATTAAACTACCGAT
AGAATTAGTGGAAAAGATATGTCTGACGTTTACTCTCACATTAGAAGGAT
TGGGAGAAATATATGAAGGATCAAATCTAACGAGATATGGAATCCAGGAA
ACAAATAAAAAAACAGGAATATGTACTTTAAATTTTAGGTTTCCAAAATC
AGGATCGTACAAATTATTGTTATATGCTCGTGAATACGGTGACCAAATTT
TCGGTGGAATATGTGAATACAGAGTAAATGCAAAATTGCCCGAGAAAGAA
ACAGAGAAAAACGGAGAGAAACACATGGAAGAGGAAAAGGTTTTCCCTTA
TCCACCTACTCAACAGTCTTCCTATGGAAAAACAGAAATGGCATGTCAAT
ATAATTTAAATTGTTCTTTAGAAAATAATTCTATAAGATTAACTCACGGT
GAATTTGGAATTTCGTTTTTTAAGGATAATAAAGAAAATGATAATTTTCC
TAGACTAATGGGAAGACTTAAAAGTTCTTTTCATGAAGACAGCAAACTTG
TTAGTCGGTTGTTACAAAGAAACACTTATGAAAAGAATACCATCGATCAA
TTTATTATCTTAGCGTTTTTGCCAGATGCTGGCGAATACGCATTAGAAAT
TTACGCCAACAATCCAGAAAAAGAAGGTTCATCTTTCTTTTTGATCTGGC
AAATATTTATTCAAACGGAAAAAGGCAGTGATCTGCCAATGGGCCTTCCA
GATATTAATCCTGGTGCAGCAATTGGGTCTCAACCGCAATTTCAAGAATT
TGGATTAACTGTTTTATCTCATCCAGACCCATACATTACAATTTCAAATA
AAGTTGAAACTACTGGCCAAGAAAAGCATGATCTCACAGTATCTATAGGT
CTTCCATTGTCTAATTGTATAAAGGTTTTGGGTCAGCTTGTAGATGTGAG
TTCAACTGAAGAAGAAACTGACTATAGTGATTATCTATTACAGCAAAATA
TCCTTTCTGAGAAAGAGCTGACTTCTGTATCTTTTCACATCAGAATTCCT
AAAAGCGGTTGTTTTTATAAACTTCATATTTATGGTGCTCCTTCTACAAA
TGAAACTGAAACTTTGCCAATGGTATTTTCATACTTGATTAATGCTCCTC
AACGGTTGAGCAGTTCTGATGTTCCATATTACGGTAGTGGAGAAGGACCG
TATCCATATCAATTGTCACAATGGAAAGATAAATGTCGACTTTATAAGCC
TATTAATCGGAAGATTAAAATTAATAAAGATTCTGAAACAATCATACAAT
TTTCTTTACAAATACCCGATGCCTATCATGTTGCCGTTGTGGTCGCCGGA
GAAATTTGGAATCAATTATCAAGAGAGAATGAAAGTGATGATGTCATTTG
GACTGGAAATGTTAAATTCGATTCATCAACACAAGCCGATTCGAAAATAA
CCGTTTGTGCGTGCTACAATGAATCGATTACGAGCTATAGCACTATTTTA
GAATATTATACTTGTTAAATTTTATGTTATTTAAAAGTTTGATTTTCGTA
CTGTCTAGTCTATACGTGAATTATTTTTCGGTTCCTATAATTTTATTATT
TGAAGCTTAAAGTTTCTTTGATAGAAATTTATTAATCAATATGTTATAGA
AATTATTAATTATTCAAAGAAATGGTTTCAGTATTTTACTTGTGGATCTG
GCTGTATGTCATTATTTG
back to top

protein sequence of SMED30012935-orf-1

>SMED30012935-orf-1 ID=SMED30012935-orf-1|Name=SMED30012935-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=815bp
MGNACSCVSKNKELDKKEENNNKILPKEEVNEALEDANIAIQEETKNEET
VPDLLYPDPPEDFKPDLVEQVGKEVIPLENEIPSEDDYNIPEKRLDELAI
TIGKHSFSSFIPLIYHLIYNRSDGIKCNEYQKVCALFTWLTTKNLHELKF
SSETHASDSPEAVLLGISTGKTAYAQVFQMLCRYTGLQCKLIRGYAKGVD
YKPGMKLGGGKEAQHAWNAVKVDNVWYLFDCHWAARRLMGKTINSDRIKY
DLDLFYFMTNPTQLRYTHFPFEEDWQLTKKKITLEEFEDLTLVKPTFFKY
NLELYSHTQAVLEVQDKLVLMIKLPIELVEKICLTFTLTLEGLGEIYEGS
NLTRYGIQETNKKTGICTLNFRFPKSGSYKLLLYAREYGDQIFGGICEYR
VNAKLPEKETEKNGEKHMEEEKVFPYPPTQQSSYGKTEMACQYNLNCSLE
NNSIRLTHGEFGISFFKDNKENDNFPRLMGRLKSSFHEDSKLVSRLLQRN
TYEKNTIDQFIILAFLPDAGEYALEIYANNPEKEGSSFFLIWQIFIQTEK
GSDLPMGLPDINPGAAIGSQPQFQEFGLTVLSHPDPYITISNKVETTGQE
KHDLTVSIGLPLSNCIKVLGQLVDVSSTEEETDYSDYLLQQNILSEKELT
SVSFHIRIPKSGCFYKLHIYGAPSTNETETLPMVFSYLINAPQRLSSSDV
PYYGSGEGPYPYQLSQWKDKCRLYKPINRKIKINKDSETIIQFSLQIPDA
YHVAVVVAGEIWNQLSRENESDDVIWTGNVKFDSSTQADSKITVCACYNE
SITSYSTILEYYTC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR002931Transglutaminase-like
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0030018Z disc
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007517muscle organ development
GO:0007528neuromuscular junction development
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 27..47
NoneNo IPR availableGENE3DG3DSA:3.10.620.30coord: 108..244
e-value: 7.7E-9
score: 37.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 10..29
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..29
NoneNo IPR availablePANTHERPTHR47020FAMILY NOT NAMEDcoord: 12..811
IPR002931Transglutaminase-likeSMARTSM00460TG_5coord: 164..233
e-value: 5.6E-4
score: 29.2
IPR002931Transglutaminase-likePFAMPF01841Transglut_corecoord: 122..230
e-value: 1.2E-7
score: 32.2
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 85..236