P2X purinoceptor 4

Overview
NameP2X purinoceptor 4
Smed IDSMED30012928
Length (bp)1446
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of P2X purinoceptor 4 (SMED30012928) t-SNE clustered cells

Violin plots show distribution of expression levels for P2X purinoceptor 4 (SMED30012928) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of P2X purinoceptor 4 (SMED30012928) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for P2X purinoceptor 4 (SMED30012928) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of P2X purinoceptor 4 vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 245.743 bits (626), Expect = 2.541e-76
Identity = 152/373 (40.75%), Postives = 223/373 (59.79%), Query Frame = 3
Query:   48 FFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGAR--CVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKD--GKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHND 1151
             FEY+T +IV I S+K+G + R  QLL++ Y+IG+V ++ +GYQ++  + SSV  KVKG++ T  S    R+WD++D +IP QE  + FV TN I T+NQTQ +C E   +P A   C +D  C    A    NGV TGRCV     +KTCE+ +WCP+E+DT V P    LK   +FT+L++N I + + +  + N+         K+C+++   +   +CPIF++   +        + +   GGI+ + +NW+C+LD + + C P YSF RLD +D    +S G+NFRFA YY +  G E R L K +G+R    V GKA KF  I   +NIGSG+ALL +ATVLCD I+L+ M  R  Y + KY+   D
Sbjct:   12 LFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPE---IPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHV-PQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGH-SFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVED 377          
BLAST of P2X purinoceptor 4 vs. Ensembl Human
Match: P2RX2 (purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:HGNC:15459])

HSP 1 Score: 241.506 bits (615), Expect = 1.697e-74
Identity = 140/397 (35.26%), Postives = 219/397 (55.16%), Query Frame = 3
Query:    9 STVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIE-TLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGI-KTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTESN 1193
            +T  R       A ++YET K++ + ++++G L+R  QLL+++Y + YV I  + YQ+S     +             + S  ++WD+ + + PP E G+ F     +E T +QTQ  C E   V  A C++D DC+  +  +LGNG+ TGRCV    G  KTCE++ WCP+E+   V   +++    P+FTILI+N+I + + H  + N+    + ++ K C F+   +   YCPIFK+  F+         +L   GG+I VIINW+CDLD   ++C P+YSF RLDPK    S G+NFRFA YY  NG   R L K +G+RI   V G+A KFS I   +N+ + +  + V + LCD+I+L  M   + Y   K++   D  A +    +T ++
Sbjct:   12 ATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQES----ETGPESSIITKVKGITTSEHKVWDVEEYVKPP-EGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASVS--QFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYL-KRCTFHEASDL--YCPIFKLG-FIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCDWILLTFMNKNKVYSHKKFDKMVDTPASEPAQASTPTD 397          
BLAST of P2X purinoceptor 4 vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 238.039 bits (606), Expect = 4.477e-73
Identity = 151/389 (38.82%), Postives = 221/389 (56.81%), Query Frame = 3
Query:   48 FFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXM----------------RGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGAR--CVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKD--GKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHND 1151
             FEY+T +IV I S+K+G + R  QLL++ Y+IG    ++                +GYQ++  + SSV  KVKG++ T  S    R+WD++D +IP QE  + FV TN I T+NQTQ +C E   +P A   C +D  C    A    NGV TGRCV     +KTCE+ +WCP+E+DT V P    LK   +FT+L++N I + + +  + N+         K+C+++   +   +CPIF++   +        + +   GGI+ + +NW+C+LD + + C P YSF RLD +D    +S G+NFRFA YY +  G E R L K +G+R    V GKA KF  I   +NIGSG+ALL +ATVLCD I+L+ M  R  Y + KY+   D
Sbjct:   12 LFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGCYHPHLAEVEMESPRRWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPE---IPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHV-PQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGH-SFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVED 393          
BLAST of P2X purinoceptor 4 vs. Ensembl Human
Match: P2RX2 (purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:HGNC:15459])

HSP 1 Score: 237.269 bits (604), Expect = 3.915e-72
Identity = 137/379 (36.15%), Postives = 212/379 (55.94%), Query Frame = 3
Query:    9 STVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIE-TLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGI-KTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            +T  R       A ++YET K++ + ++++G L+R  QLL+++Y + YV I  + YQ+S     +             + S  ++WD+ + + PP E G+ F     +E T +QTQ  C E   V  A C++D DC+  +  +LGNG+ TGRCV    G  KTCE++ WCP+E+   V   +++    P+FTILI+N+I + + H  + N+    + ++ K C F+   +   YCPIFK+  F+         +L   GG+I VIINW+CDLD   ++C P+YSF RLDPK    S G+NFRFA YY  NG   R L K +G+RI   V G+A KFS I   +N+ + +  + V + LCD+I+L  M   + Y   K++
Sbjct:   12 ATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQES----ETGPESSIITKVKGITTSEHKVWDVEEYVKPP-EGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASVS--QFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYL-KRCTFHEASDL--YCPIFKLG-FIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCDWILLTFMNKNKVYSHKKFD 379          
BLAST of P2X purinoceptor 4 vs. Ensembl Human
Match: P2RX5 (purinergic receptor P2X 5 [Source:HGNC Symbol;Acc:HGNC:8536])

HSP 1 Score: 231.876 bits (590), Expect = 1.248e-70
Identity = 147/387 (37.98%), Postives = 217/387 (56.07%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQD-SYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCV---NSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGK-LSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKY-ELHNDDDAYQELNENT 1184
            + F+Y+T K V   +KK+G L+R  Q  ++ Y++ +V +  +GYQD    L S+V+ KVKG++ T  S   +R+WD++D +IP Q     FV TN I T NQ Q++CAE+  +P   C  D DC   +A+  GNGV TGRC+   N   G  TCEI++WCPLE  T   P++  LKE  DFTI I+N I F + +  +SN+   ++    K+C F P ++   YCPIF++ S +      + + +   GG+I + I WNCDLD + ++C P YSF+RLD K  K +S G+NFRFA YY +  G E+R L K +G+R    V GK   F                      CD ++++L+  RE Y   KY E+   +D+ QE  +  
Sbjct:   12 SLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFLIKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENVFFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARG--TCEIFAWCPLE--TSSRPEEPFLKEAEDFTIFIKNHIRFPKFNFSKSNVMDVKDRSFLKSCHFGPKNH---YCPIFRLGSVI-RWAGSDFQDIALEGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARYYRDAAGVEFRTLMKAYGIRFDVMVNGKGAFF----------------------CDLVLIYLIKKREFYRDKKYEEVRGLEDSSQEAEDEA 368          
BLAST of P2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 254.218 bits (648), Expect = 8.548e-80
Identity = 163/384 (42.45%), Postives = 235/384 (61.20%), Query Frame = 3
Query:   36 VKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDP-DKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKD--GKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE-------LHNDD 1154
            V + FF+Y T+KI+ I SKK+G L RF Q L+I Y+IGYV +Y +GYQD+  + SSV  KVKGI+ T  S    R+WD++D IIPPQE+G+ FV TN I T NQTQS CAE+   P + C +  DC        G+GV TGRCV+    +KTCE+ SWCPLE   +VDP +  +L +  +FT+LI+N I + + +  + N+    N+     C+F+   +    CPIF++   +G     + + +   GG++ V I W+CDLD  ++ C P Y+F RLD KD    ++ G+NFRFA YY N +G E R L K +G+R    V G+A KF+ I   +N+G+G+ALL +  V+CD+I+L  M  ++ Y + KY        LHN+D
Sbjct:   11 VSQCFFDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAEN-PTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEK--IVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTD--PDCPIFRLGDIVGEAEE-DFQIMAVHGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNMGAGLALLGLVNVICDWIVLTFMKRKQHYKEQKYTYVDDFGLLHNED 388          
BLAST of P2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 248.054 bits (632), Expect = 3.389e-77
Identity = 164/393 (41.73%), Postives = 235/393 (59.80%), Query Frame = 3
Query:   36 VKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQ---------ENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDP-DKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKD--GKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE-------LHNDD 1154
            V + FF+Y T+KI+ I SKK+G L RF Q L+I Y+IGYV +Y +GYQD+  + SSV  KVKGI+ T  S    R+WD++D IIPPQ         E+G+ FV TN I T NQTQS CAE+   P + C +  DC        G+GV TGRCV+    +KTCE+ SWCPLE   +VDP +  +L +  +FT+LI+N I + + +  + N+    N+     C+F+   +    CPIF++   +G     + + +   GG++ V I W+CDLD  ++ C P Y+F RLD KD    ++ G+NFRFA YY N +G E R L K +G+R    V G+A KF+ I   +NIG+G+ALL +  V+CD+I+L  M  ++ Y + KY        LHN+D
Sbjct:   11 VSQCFFDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQVVRRLDEEEEDGSFFVLTNMIITTNQTQSKCAEN-PTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEK--IVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTD--PDCPIFRLGDIVGEAEE-DFQIMAVHGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVLTFMKRKQHYKEQKYTYVDDFGLLHNED 397          
BLAST of P2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 246.899 bits (629), Expect = 9.056e-77
Identity = 163/393 (41.48%), Postives = 235/393 (59.80%), Query Frame = 3
Query:   36 VKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQ---------ENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDP-DKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKD--GKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE-------LHNDD 1154
            V + FF+Y T+KI+ I SKK+G L RF Q L+I Y+IGYV +Y +GYQD+  + SSV  KVKGI+ T  S    R+WD++D IIPPQ         E+G+ FV TN I T NQTQS CAE+   P + C +  DC        G+GV TGRCV+    +KTCE+ SWCPLE   +VDP +  +L +  +FT+LI+N I + + +  + N+    N+     C+F+   +    CPIF++   +G     + + +   GG++ V I W+CDLD  ++ C P Y+F RLD KD    ++ G+NFRFA YY N +G E R L K +G+R    V G+A KF+ I   +N+G+G+ALL +  V+CD+I+L  M  ++ Y + KY        LHN+D
Sbjct:   11 VSQCFFDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQVVRRLDEEEEDGSFFVLTNMIITTNQTQSKCAEN-PTPASTCTSHRDCKRGFNDARGDGVRTGRCVSYSASVKTCEVLSWCPLEK--IVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTD--PDCPIFRLGDIVGEAEE-DFQIMAVHGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNMGAGLALLGLVNVICDWIVLTFMKRKQHYKEQKYTYVDDFGLLHNED 397          
BLAST of P2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx4b (purinergic receptor P2X, ligand-gated ion channel, 4b [Source:ZFIN;Acc:ZDB-GENE-030319-4])

HSP 1 Score: 240.35 bits (612), Expect = 2.174e-74
Identity = 153/388 (39.43%), Postives = 223/388 (57.47%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPG--ARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPK--DGKLSKGWNFRFANYYVNN-GREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTESN 1193
              F++ T  I+ ++SKK+GF+FR  QL +IVY+  YV  Y R YQ+   + SSV  KVKG   T  S     +WD S+ +IPPQ   + FV TNAI T  QTQ  C E   +P     C +D DC E    I GNGV TG+CV     IKTCE+ SWCPLENDT++ P   +L    DFT+LI+N I + +   ++ N+    N+   K C FN   +   +CP+F++   + T +  +   +   GGII + I+W+CDLDF+E  C P+YSF RLD K  +  ++ G+NFR+A YY+NN   E R L K FG+R    V G A KF+ +   +N+G+ +ALL +  V+CD+ +L  + + E Y + K++     D  +  +   +S+
Sbjct:   10 CLFDHGTPVILVVSSKKVGFIFRLLQLCIIVYVAVYVCWYKRAYQERDSVISSVSTKVKGNILTNSSALGTHVWDTSEYVIPPQGENSFFVLTNAIVTQGQTQGSCPE---IPSEFTNCQSDSDCKEGLKEIRGNGVQTGKCVQYSETIKTCEVLSWCPLENDTVI-PKPALLSAAEDFTVLIKNNIQYPKFKFRKRNILRHINSTYLKNCTFNHKTD--PHCPVFRLGDIV-TESGEDFSIMALKGGIIGIFIDWSCDLDFNERFCVPKYSFRRLDNKNPENNVAPGYNFRYAKYYMNNENTETRTLIKAFGIRFDVIVFGMAGKFNIVPTIVNVGAALALLNLMKVICDWFMLNCLSDSEYYSKHKFKHLKPKDESETFSFTDQSS 390          
BLAST of P2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx5 (purinergic receptor P2X, ligand-gated ion channel, 5 [Source:ZFIN;Acc:ZDB-GENE-030319-5])

HSP 1 Score: 238.424 bits (607), Expect = 1.181e-72
Identity = 147/370 (39.73%), Postives = 218/370 (58.92%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSY-GLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDG---KLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            +  +Y+T K V   +KK+G LFR FQL +I Y+IG+V I+ +GYQ++   + SSV+ K+KG+  T  S    ++W   D +IPPQ +   FV TN + T NQ    C E   VP   C ND +C+E ++++ G+GV TGRC+N      TCEI +WCP+E+     P + +L +  +FT+ ++N I F +    +SN+    N+   KTC ++ + +   YCPIF +   +   T    + L T GG I + I WNCDLD  E+ C PEYSF RLD  +     ++ G+NFRFA YY +  G+ YR L+KV+G+R    V GKA +FS I   +NIGSG+AL+      CD I+L++M     Y ++K+E
Sbjct:   11 SLLDYKTEKFVIAKNKKVGVLFRLFQLTVIGYLIGWVFIWKKGYQETEEAIQSSVITKLKGVDLTNSSQFGLQLWGAEDYVIPPQGDRVFFVVTNYLVTPNQRLGYCPESPKVPDGFCTNDNECVEGESVLAGHGVKTGRCLNDT---GTCEINAWCPVEHGHA--PVEPMLAKAENFTVYVKNFIKFPKFGFFKSNVLPITNSTYLKTCRYDKDHH--PYCPIFLVGDVI-NWTGYTFQDLATRGGSIGIGIEWNCDLDKDESHCNPEYSFTRLDSSENSQHSVTSGYNFRFARYYNDAAGQTYRNLFKVYGIRFDILVNGKAGRFSIIPTVINIGSGLALMGAGVFACDMILLYMMSKSSFYRETKFE 372          
BLAST of P2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 252.677 bits (644), Expect = 5.378e-79
Identity = 150/374 (40.11%), Postives = 223/374 (59.63%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDS-YGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCV--NSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIF---KISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPK--DGKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            +FF+Y+T K V   +KK+G LFR  QL ++ Y++G+V +  +GYQ++   + SS++ K+KG++ T  S    R+WD+ D +IPPQ     FV TN I T NQ QS C E + +P A C  + DC E + ++ GNGV TGRC+   +V    TCEI++WCP+E          +L +  +FT+ I+N+I F +    ++N+   +N    KTC ++ +D+   YCPIF   KI S+ G+    E + +   GG+I + I WNC+LD   ++C P YSF RLD K  +  +S G+NFRFA YY + NG +YR L K +G+R    V GKA KF+ I   +NIGSG+ALL      CD ++L+L+     Y   K+E
Sbjct:   12 SFFDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKPKTP--LLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH---YCPIFHLGKIVSWAGS----EFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSNFYRDKKFE 376          
BLAST of P2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 253.447 bits (646), Expect = 5.441e-79
Identity = 150/374 (40.11%), Postives = 223/374 (59.63%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDS-YGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCV--NSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIF---KISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPK--DGKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            +FF+Y+T K V   +KK+G LFR  QL ++ Y++G+V +  +GYQ++   + SS++ K+KG++ T  S    R+WD+ D +IPPQ     FV TN I T NQ QS C E + +P A C  + DC E + ++ GNGV TGRC+   +V    TCEI++WCP+E          +L +  +FT+ I+N+I F +    ++N+   +N    KTC ++ +D+   YCPIF   KI S+ G+    E + +   GG+I + I WNC+LD   ++C P YSF RLD K  +  +S G+NFRFA YY + NG +YR L K +G+R    V GKA KF+ I   +NIGSG+ALL      CD ++L+L+     Y   K+E
Sbjct:   12 SFFDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKPKTP--LLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH---YCPIFHLGKIVSWAGS----EFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSNFYRDKKFE 376          
BLAST of P2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 251.906 bits (642), Expect = 1.065e-78
Identity = 150/374 (40.11%), Postives = 223/374 (59.63%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDS-YGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCV--NSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIF---KISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPK--DGKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            +FF+Y+T K V   +KK+G LFR  QL ++ Y++G+V +  +GYQ++   + SS++ K+KG++ T  S    R+WD+ D +IPPQ     FV TN I T NQ QS C E + +P A C  + DC E + ++ GNGV TGRC+   +V    TCEI++WCP+E          +L +  +FT+ I+N+I F +    ++N+   +N    KTC ++ +D+   YCPIF   KI S+ G+    E + +   GG+I + I WNC+LD   ++C P YSF RLD K  +  +S G+NFRFA YY + NG +YR L K +G+R    V GKA KF+ I   +NIGSG+ALL      CD ++L+L+     Y   K+E
Sbjct:   12 SFFDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKPKTP--LLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH---YCPIFHLGKIVSWAGS----EFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSNFYRDKKFE 376          
BLAST of P2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 252.292 bits (643), Expect = 1.555e-78
Identity = 151/385 (39.22%), Postives = 226/385 (58.70%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDS-YGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCV--NSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIF---KISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPK--DGKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQEL 1172
            +FF+Y+T K V   +KK+G LFR  QL ++ Y++G+V +  +GYQ++   + SS++ K+KG++ T  S    R+WD+ D +IPPQ     FV TN I T NQ QS C E + +P A C  + DC E + ++ GNGV TGRC+   +V    TCEI++WCP+E          +L +  +FT+ I+N+I F +    ++N+   +N    KTC ++ +D+   YCPIF   KI S+ G+    E + +   GG+I + I WNC+LD   ++C P YSF RLD K  +  +S G+NFRFA YY + NG +YR L K +G+R    V GKA KF+ I   +NIGSG+ALL      CD ++L+L+     Y   K+E  N    +  +
Sbjct:   12 SFFDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKPKTP--LLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH---YCPIFHLGKIVSWAGS----EFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSNFYRDKKFEEVNKGTPHPPM 387          
BLAST of P2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 252.677 bits (644), Expect = 1.952e-78
Identity = 150/374 (40.11%), Postives = 223/374 (59.63%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDS-YGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCV--NSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIF---KISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPK--DGKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            +FF+Y+T K V   +KK+G LFR  QL ++ Y++G+V +  +GYQ++   + SS++ K+KG++ T  S    R+WD+ D +IPPQ     FV TN I T NQ QS C E + +P A C  + DC E + ++ GNGV TGRC+   +V    TCEI++WCP+E          +L +  +FT+ I+N+I F +    ++N+   +N    KTC ++ +D+   YCPIF   KI S+ G+    E + +   GG+I + I WNC+LD   ++C P YSF RLD K  +  +S G+NFRFA YY + NG +YR L K +G+R    V GKA KF+ I   +NIGSG+ALL      CD ++L+L+     Y   K+E
Sbjct:   12 SFFDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKPKTP--LLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH---YCPIFHLGKIVSWAGS----EFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSNFYRDKKFE 376          
BLAST of P2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx5 (purinergic receptor P2X, ligand-gated ion channel, 5 [Source:MGI Symbol;Acc:MGI:2137026])

HSP 1 Score: 248.825 bits (634), Expect = 6.931e-77
Identity = 153/390 (39.23%), Postives = 227/390 (58.21%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQD-SYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCV---NSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGK-LSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTESNE 1196
            + F+Y+T K V   SKK+G L+R  QL +++Y++ +V +  + YQD    L S+VV KVKG++ T  ++   R+WD++D +IP Q     FV TN I T NQ Q ICAE   +P   C  D DC   ++++ G+G+ TGRC+   NS  G  TCEI++WCP+E  +M  P   +LK+   FTI I+N I F + +  ++N+    N    KTC F+  +    YCPIF++ S +      + + +   GG+I + I W+CDLD + + C P Y FNRLD K  + +S G+NFRFA YY + +G E+R L K +G+R    V GKA KFS I   +NIGSG+AL+      CD ++++L+   E Y   K+E        +E N   E+NE
Sbjct:   12 SLFDYKTAKFVVAKSKKVGLLYRVLQLTILLYLLIWVFLIKKSYQDIDTSLQSAVVTKVKGVAYTNTTMLGERLWDVADFVIPSQGENVFFVVTNLIVTPNQRQGICAEREGIPDGECSEDTDCHAGESVVAGHGLKTGRCLRVGNSTRG--TCEIFAWCPVETKSM--PTDPLLKDAEGFTIFIKNFIRFPKFNFSKANVLETGNKHFLKTCHFSSTN---LYCPIFRLGSIV-RWAGADFQDIALKGGVIGIHIEWDCDLDKAASHCNPHYYFNRLDNKHTQSISSGYNFRFARYYRDPHGVEFRDLMKAYGIRFDVIVNGKAGKFSIIPTVINIGSGLALMGAGAFFCDLVLIYLIRKSEFYRDKKFEKVRGQK--EEDNVEVEANE 391          
BLAST of P2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx2 (purinergic receptor P2X, ligand-gated ion channel, 2 [Source:MGI Symbol;Acc:MGI:2665170])

HSP 1 Score: 234.187 bits (596), Expect = 5.972e-72
Identity = 132/367 (35.97%), Postives = 211/367 (57.49%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYG-IKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYY-VNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            AF++YET K++ + ++++GF+ R  QLL+++Y + YV I  + YQDS     +             ++S  ++WD+ + + PP+      + T    T +QT   C E   V  + C  D DC+  +  + GNG+ TGRCV   +G  KTCE+ +WCP+E+ T    + ++ K  P+FTILI+N+I + +    + N+ + +++++ K C F+ + +   YCPIF++  F+         +L   GG+I VIINWNCDLD SE++C P+YSF RLDPK    S G+NFRFA YY +N     R L K +G+RI   V G+A KFS I   +N+ + +  + V + LCD+I+L  M   + Y   K++
Sbjct:   25 AFWDYETPKVIVVRNRRLGFVHRMVQLLILLYFVWYVFIVQKSYQDS----ETGPESSIITKVKGITMSEHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHLDDDCVAGQLDMQGNGIRTGRCVPYYHGDSKTCEVSAWCPVEDGT--SENHFLGKMAPNFTILIKNSIHYPKFKFSKGNIASQKSDYL-KHCTFDQDSD--PYCPIFRLG-FIVEQAGENFTELAHKGGVIGVIINWNCDLDLSESECNPKYSFRRLDPKYDPASSGYNFRFAKYYKINGTTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSIGVGSFLCDWILLTFMNKNKLYSHKKFD 381          
BLAST of P2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx2 (purinergic receptor P2X, ligand-gated ion channel, 2 [Source:MGI Symbol;Acc:MGI:2665170])

HSP 1 Score: 234.187 bits (596), Expect = 9.877e-72
Identity = 132/367 (35.97%), Postives = 211/367 (57.49%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYG-IKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYY-VNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            AF++YET K++ + ++++GF+ R  QLL+++Y + YV I  + YQDS     +             ++S  ++WD+ + + PP+      + T    T +QT   C E   V  + C  D DC+  +  + GNG+ TGRCV   +G  KTCE+ +WCP+E+ T    + ++ K  P+FTILI+N+I + +    + N+ + +++++ K C F+ + +   YCPIF++  F+         +L   GG+I VIINWNCDLD SE++C P+YSF RLDPK    S G+NFRFA YY +N     R L K +G+RI   V G+A KFS I   +N+ + +  + V + LCD+I+L  M   + Y   K++
Sbjct:   25 AFWDYETPKVIVVRNRRLGFVHRMVQLLILLYFVWYVFIVQKSYQDS----ETGPESSIITKVKGITMSEHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHLDDDCVAGQLDMQGNGIRTGRCVPYYHGDSKTCEVSAWCPVEDGT--SENHFLGKMAPNFTILIKNSIHYPKFKFSKGNIASQKSDYL-KHCTFDQDSD--PYCPIFRLG-FIVEQAGENFTELAHKGGVIGVIINWNCDLDLSESECNPKYSFRRLDPKYDPASSGYNFRFAKYYKINGTTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSIGVGSFLCDWILLTFMNKNKLYSHKKFD 381          
BLAST of P2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 232.261 bits (591), Expect = 2.972e-71
Identity = 144/363 (39.67%), Postives = 218/363 (60.06%), Query Frame = 3
Query:   33 KVKKAF-FEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPG--ARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKD--GKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLM 1103
             V +AF FEY+T +IV I S+K+G + R  QLL++ Y+IG+V ++ +GYQ++  + SSV  K KG++ T  S    R+WD++D ++P QE  + F+ TN I T+NQTQ  C E   +P   + C +D +C    +    +G+ TGRCV     +KTCE+ +WCP+END  V P    LK   +FT+L++N I + + +  + N+         K+C++N   +   +CPIF++   +        +++   GGI+ + I W+C+LD + + C P YSF RLD +D    +S G+NFRFA YY +  G E R L K +G+R    V GKA KF  I   +N+GSG+ALL VATVLCD I+L+ M
Sbjct:    6 SVLRAFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPE---IPDKTSICDSDANCTLGSSDTHSSGIGTGRCVPFNASVKTCEVAAWCPVENDAGV-PTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTD--PFCPIFRLGQIVADAGH-SFQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYCM 361          
BLAST of P2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx2 (purinergic receptor P2X, ligand-gated ion channel, 2 [Source:MGI Symbol;Acc:MGI:2665170])

HSP 1 Score: 233.802 bits (595), Expect = 8.239e-71
Identity = 132/367 (35.97%), Postives = 211/367 (57.49%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYG-IKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYY-VNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            AF++YET K++ + ++++GF+ R  QLL+++Y + YV I  + YQDS     +             ++S  ++WD+ + + PP+      + T    T +QT   C E   V  + C  D DC+  +  + GNG+ TGRCV   +G  KTCE+ +WCP+E+ T    + ++ K  P+FTILI+N+I + +    + N+ + +++++ K C F+ + +   YCPIF++  F+         +L   GG+I VIINWNCDLD SE++C P+YSF RLDPK    S G+NFRFA YY +N     R L K +G+RI   V G+A KFS I   +N+ + +  + V + LCD+I+L  M   + Y   K++
Sbjct:   25 AFWDYETPKVIVVRNRRLGFVHRMVQLLILLYFVWYVFIVQKSYQDS----ETGPESSIITKVKGITMSEHKVWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHLDDDCVAGQLDMQGNGIRTGRCVPYYHGDSKTCEVSAWCPVEDGT--SENHFLGKMAPNFTILIKNSIHYPKFKFSKGNIASQKSDYL-KHCTFDQDSD--PYCPIFRLG-FIVEQAGENFTELAHKGGVIGVIINWNCDLDLSESECNPKYSFRRLDPKYDPASSGYNFRFAKYYKINGTTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSIGVGSFLCDWILLTFMNKNKLYSHKKFD 381          
BLAST of P2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|P51578|P2RX5_RAT (P2X purinoceptor 5 OS=Rattus norvegicus OX=10116 GN=P2rx5 PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 5.178e-77
Identity = 155/401 (38.65%), Postives = 234/401 (58.35%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQD-SYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCV---NSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKD-GKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE--LHNDDDAYQELNENTESNEALDIESIKK 1223
            + F+Y+T K V   SKK+G L+R  QL++++Y++ +V +  + YQD    L S+VV KVKG++ T  ++   R+WD++D +IP Q     FV TN I T NQ Q ICAE   +P   C  D DC   ++++ G+G+ TGRC+   NS  G  TCEI++WCP+E  +M  P   +LK+   FTI I+N I F + +  ++N+   +N    KTC F+  +    YCPIF++ S +      + + +   GG+I + I W+CDLD + ++C P Y FNRLD K    +S G+NFRFA YY + NG E+R L K +G+R    V GKA KFS I   +NIGSG+AL+      CD ++++L+   E Y   K+E      +DA  E+  N    E  + E +++
Sbjct:   12 SLFDYKTAKFVVAKSKKVGLLYRVLQLIILLYLLIWVFLIKKSYQDIDTSLQSAVVTKVKGVAYTNTTMLGERLWDVADFVIPSQGENVFFVVTNLIVTPNQRQGICAEREGIPDGECSEDDDCHAGESVVAGHGLKTGRCLRVGNSTRG--TCEIFAWCPVETKSM--PTDPLLKDAESFTISIKNFIRFPKFNFSKANVLETDNKHFLKTCHFSSTN---LYCPIFRLGSIV-RWAGADFQDIALKGGVIGIYIEWDCDLDKAASKCNPHYYFNRLDNKHTHSISSGYNFRFARYYRDPNGVEFRDLMKAYGIRFDVIVNGKAGKFSIIPTVINIGSGLALMGAGAFFCDLVLIYLIRKSEFYRDKKFEKVRGQKEDANVEVEANEMEQERPEDEPLER 404          
BLAST of P2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q99571|P2RX4_HUMAN (P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX4 PE=1 SV=2)

HSP 1 Score: 245.743 bits (626), Expect = 1.220e-75
Identity = 152/373 (40.75%), Postives = 223/373 (59.79%), Query Frame = 3
Query:   48 FFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGAR--CVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKD--GKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHND 1151
             FEY+T +IV I S+K+G + R  QLL++ Y+IG+V ++ +GYQ++  + SSV  KVKG++ T  S    R+WD++D +IP QE  + FV TN I T+NQTQ +C E   +P A   C +D  C    A    NGV TGRCV     +KTCE+ +WCP+E+DT V P    LK   +FT+L++N I + + +  + N+         K+C+++   +   +CPIF++   +        + +   GGI+ + +NW+C+LD + + C P YSF RLD +D    +S G+NFRFA YY +  G E R L K +G+R    V GKA KF  I   +NIGSG+ALL +ATVLCD I+L+ M  R  Y + KY+   D
Sbjct:   12 LFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPE---IPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHV-PQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGH-SFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYYREKKYKYVED 377          
BLAST of P2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q5E9U1|P2RX4_BOVIN (P2X purinoceptor 4 OS=Bos taurus OX=9913 GN=P2RX4 PE=2 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 3.776e-73
Identity = 147/357 (41.18%), Postives = 218/357 (61.06%), Query Frame = 3
Query:   48 FFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGAR--CVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKD--GKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLM 1103
             FEY+T +IV I S+K+G + R  QLL++ Y+IG+V ++ +GYQ++  + SSV VK KG++ T  S    R+WD++D +IP QE  + F+ TN + T+NQTQ +C E   +PG    C  D +C    A    +GV TGRCV+    +KTCE+ +WCP+E+DT V P    LK   +FT+L++N I + + +  + N+         KTC+++   +   +CPIF++   + +      + +   GGI+ + I WNC+LD + + C P YSF RLD +D    +S G+NFRFA YY +  G E+R L K +G+R    V GKA KF  I   +NIGSG+ALL VATVLCD I+L+ M
Sbjct:   12 LFEYDTPRIVLIRSRKVGLMNRTVQLLILAYVIGWVFVWEKGYQETDSVVSSVTVKAKGVTMTNTSKLGFRIWDVADYVIPAQEENSVFIMTNMVITMNQTQGLCPE---IPGKTTVCETDANCTAGSAGTHSSGVATGRCVSFNGTLKTCEVAAWCPVEDDTEV-PKPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTAYLKTCIYDAKTD--PFCPIFRLGKIVESAGH-SFQDIAIEGGIMGIQIKWNCNLDRAASFCLPRYSFRRLDTRDLAHNVSPGYNFRFAKYYSDLKGAEHRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGVATVLCDVIVLYCM 361          
BLAST of P2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|P51577|P2RX4_RAT (P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2rx4 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 5.376e-72
Identity = 149/360 (41.39%), Postives = 217/360 (60.28%), Query Frame = 3
Query:   48 FFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPG--ARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITP---VEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKD--GKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLM 1103
             FEY+T +IV I S+K+G + R  QLL++ Y+IG+V ++ +GYQ++  + SSV  K KG++ T  S    R+WD++D +IP QE  + F+ TN I T+NQTQS C E   +P   + C +D DC         +GV TGRCV     +KTCE+ +WCP+END  V P    LK   +FT+L++N I + + +  + N+         K+C++N   +   +CPIF+    LGTI        +++   GGI+ + I W+C+LD + + C P YSF RLD +D    +S G+NFRFA YY +  G+E R L K +G+R    V GKA KF  I   +N+GSG+ALL VATVLCD I+L+ M
Sbjct:   12 LFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVIPAQEENSLFIMTNMIVTVNQTQSTCPE---IPDKTSICNSDADCTPGSVDTHSSGVATGRCVPFNESVKTCEVAAWCPVENDVGV-PTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNAQTD--PFCPIFR----LGTIVEDAGHSFQEMAVEGGIMGIQIKWDCNLDRAASLCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGKEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYCM 361          
BLAST of P2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q9UBL9|P2RX2_HUMAN (P2X purinoceptor 2 OS=Homo sapiens OX=9606 GN=P2RX2 PE=1 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 1.880e-71
Identity = 137/379 (36.15%), Postives = 212/379 (55.94%), Query Frame = 3
Query:    9 STVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIE-TLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGI-KTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            +T  R       A ++YET K++ + ++++G L+R  QLL+++Y + YV I  + YQ+S     +             + S  ++WD+ + + PP E G+ F     +E T +QTQ  C E   V  A C++D DC+  +  +LGNG+ TGRCV    G  KTCE++ WCP+E+   V   +++    P+FTILI+N+I + + H  + N+    + ++ K C F+   +   YCPIFK+  F+         +L   GG+I VIINW+CDLD   ++C P+YSF RLDPK    S G+NFRFA YY  NG   R L K +G+RI   V G+A KFS I   +N+ + +  + V + LCD+I+L  M   + Y   K++
Sbjct:   12 ATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQES----ETGPESSIITKVKGITTSEHKVWDVEEYVKPP-EGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASVS--QFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYL-KRCTFHEASDL--YCPIFKLG-FIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCDWILLTFMNKNKVYSHKKFD 379          
BLAST of P2X purinoceptor 4 vs. TrEMBL
Match: A0A267EI98 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018619g1 PE=4 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.521e-93
Identity = 169/386 (43.78%), Postives = 247/386 (63.99%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXT--ADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIK--TCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTES 1190
            A F YET+K+VQI+S K+  ++R  QLL+I Y+IG+V++Y +GYQD   + S V  KVKG+  T    +    R+WD++D ++PPQEN A F+TTNA+ T +QTQ  C ED +V  A C +D DC   K  +LGNGV TGRCV S       +CEI +WCP+E D +      +  E  +FT+LI+++I F    VKR N+  + N+   + C++NP+ +   YCP+F+I   L         ++ T GG++ + +NW+C+LD+  + C P Y F RLD ++ K++KGWNFR+ANYY  N  ++R L K +GLR +  V G+A +F+ I LTMN+GSG+ALL +ATVLCD I+L+L   +  Y  +KYE   DDDAY+ +NE  + 
Sbjct:   20 ALFRYETSKVVQISSIKVSVIYRLIQLLIIAYVIGWVVVYKKGYQDFDDVVSGVTTKVKGVQYTNLTGTSIGARIWDVADYVVPPQENNAFFITTNAVVTRDQTQGACDEDPSV--APCFSDADCPAGKPQMLGNGVNTGRCVPSSQAPNKTSCEILAWCPVEVDQL-PAGGTMFPEAVNFTVLIKDSIEFPLFGVKRRNVLDYYNSSQLQNCVYNPDTDM--YCPVFRIGDILKLAGIDNFTKIATVGGVVSITVNWDCNLDWDASYCNPTYRFRRLDDENTKIAKGWNFRYANYYRINDTDHRTLIKAYGLRFVVYVTGRAGRFNVIPLTMNLGSGLALLGIATVLCDMIVLYLHHKKVIYRGAKYETLEDDDAYRLMNEEDDG 400          
BLAST of P2X purinoceptor 4 vs. TrEMBL
Match: A0A267GN82 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018619g2 PE=4 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.538e-93
Identity = 169/386 (43.78%), Postives = 247/386 (63.99%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXT--ADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIK--TCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTES 1190
            A F YET+K+VQI+S K+  ++R  QLL+I Y+IG+V++Y +GYQD   + S V  KVKG+  T    +    R+WD++D ++PPQEN A F+TTNA+ T +QTQ  C ED +V  A C +D DC   K  +LGNGV TGRCV S       +CEI +WCP+E D +      +  E  +FT+LI+++I F    VKR N+  + N+   + C++NP+ +   YCP+F+I   L         ++ T GG++ + +NW+C+LD+  + C P Y F RLD ++ K++KGWNFR+ANYY  N  ++R L K +GLR +  V G+A +F+ I LTMN+GSG+ALL +ATVLCD I+L+L   +  Y  +KYE   DDDAY+ +NE  + 
Sbjct:   20 ALFRYETSKVVQISSIKVSVIYRLIQLLIIAYVIGWVVVYKKGYQDFDDVVSGVTTKVKGVQYTNLTGTSIGARIWDVADYVVPPQENNAFFITTNAVVTRDQTQGACDEDPSV--APCFSDADCPAGKPQMLGNGVNTGRCVPSSQAPNKTSCEILAWCPVEVDQL-PAGGTMFPEAVNFTVLIKDSIEFPLFGVKRRNVLDYYNSSQLQNCVYNPDTDM--YCPVFRIGDILKLAGIDNFTKIATVGGVVSITVNWDCNLDWDASYCNPTYRFRRLDDENTKIAKGWNFRYANYYRINDTDHRTLIKAYGLRFVVYVTGRAGRFNVIPLTMNLGSGLALLGIATVLCDMIVLYLHHKKVIYRGAKYETLEDDDAYRLMNEEDDG 400          
BLAST of P2X purinoceptor 4 vs. TrEMBL
Match: A0A210PQS5 (P2X purinoceptor 4 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT16670 PE=4 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 3.095e-93
Identity = 170/403 (42.18%), Postives = 249/403 (61.79%), Query Frame = 3
Query:    3 MKSTVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVS---RRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDC--IENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTESN 1193
            M   V+R    +   FFEY+T +IV I SKK+G + RF QL++I YIIGY +I+ +GYQ    + S+V  KVKG++    S        +WD++D ++P QEN A FV TN I T NQ Q IC ED N+PGA C  D  C  +  K++  GNG++TG C  +     TCE+ SWCP+EN     P   +L +  DFT+ I+N I F   ++KR N+   +N+   KTC +NP+D   K+CPIF +   +  +   + K +   GG++QV+INW+C+LD S   C P+Y+F RLD  D  +SKG+NFR+A YY + +G E R LYK FG++ +  V G+A KF+ + L +NIGSG+ LLA+AT+LCD ++L+++  +  Y + KY     DDAY+ +   T++N
Sbjct:    1 MAPNVVRSAISI---FFEYDTPRIVHIKSKKVGVINRFLQLVIIGYIIGYAIIFKKGYQKVDTIQSAVTTKVKGVAFLNGSEVPNIESSLWDVADYVVPAQENNALFVITNLIVTPNQRQGICGEDKNIPGANCTTDATCALMTGKSLPTGNGILTGVCNTTS---NTCEVRSWCPIENGDTKVPKNPVLLQSKDFTVFIKNNIEFPYYNIKRRNILGIQNDSQLKTCRYNPSDPIYKFCPIFVLGDIVA-MAGEDYKNMSQSGGVMQVLINWDCNLDLSLEDCVPKYTFRRLDSADFSISKGFNFRYAKYYRDPDGTEVRTLYKAFGIKYIITVIGQAGKFNVVPLLLNIGSGLGLLAMATILCDVVVLYVLKAKNVYREKKYLNVVGDDAYKTMENETDNN 396          
BLAST of P2X purinoceptor 4 vs. TrEMBL
Match: A0A0R3W512 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5180 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 1.130e-92
Identity = 158/384 (41.15%), Postives = 238/384 (61.98%), Query Frame = 3
Query:   15 VIRQTTKVKKAF----FEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQ--DSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSV--YGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYEL 1142
            +I +T    KAF    F+YET K+VQINS KIGF +R  QL +++Y++ +V+ + +GYQ  D      +  +K    S+  +S     +WD +D +IPPQ+  A FV TN + TL QT   C E ++V G+ C +D DC   + +++G+GV TG CV S     +  CEIY WCP E D +  P  YIL   P+FT++++N+I F + +VKR N+ +W +     TC +NPN+  +KYCPIF+++  +   T  E KQ+   GG++ + I WNC+LD++E QC P+Y+F RLD  D  + KGWNFRF+++Y+ +    R L K +G++    V GK  KF  +T +MN+GSG+ALL +ATVLCD I+L +   RE Y  ++ +L
Sbjct:    1 MIVRTKAFWKAFSSNLFDYETQKVVQINSFKIGFTYRLIQLGIVLYVVLWVMYHEKGYQAFDEAVSGVTAKLKGIAFSNQTNSNLGAIVWDAADYVIPPQQRSAFFVMTNLVTTLGQTLGTCEESHDVAGSGCKSDKDCEAGRIVMIGSGVQTGVCVPSTRKANLSVCEIYGWCPTEYDVL--PSDYILTNAPNFTVMLKNSIEFPKYNVKRRNILSWMDKHFLSTCRYNPNNEKMKYCPIFRLADIM-EYTKAENKQIWNKGGMVSIHIEWNCNLDYNEEQCLPKYTFRRLDDFDNPVGKGWNFRFSHHYIEDKVHKRNLIKAYGIQFFITVYGKGGKFHLLTFSMNLGSGLALLGIATVLCDNIVLNVTKKREIYRNARVDL 381          
BLAST of P2X purinoceptor 4 vs. TrEMBL
Match: A0A1I8J6R2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 6.253e-92
Identity = 168/386 (43.52%), Postives = 248/386 (64.25%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXT--ADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIK--TCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTES 1190
            A F YET+K+VQI+S K+  ++R  QLL+I Y+IG+V++Y +GYQD   + S V  KVKG+  T    +    R+WD++D ++PPQEN A F+TTNA+ T +QTQ  C ED +V  A C +D DC   K  +LGNGV TGRCV S       +CEI +WCP+E D +      +  E  +FT+LI+++I F    VKR N+  + N+   + C++NP+ +   YCP+F+I   L  +  ++    +  GG++ + +NW+C+LD+  + C P Y F RLD ++ K++KGWNFR+ANYY  N  ++R L K +GLR +  V G+A +F+ I LTMN+GSG+ALL +ATVLCD I+L+L   +  Y  +KYE   DDDAY+ +NE  + 
Sbjct:   20 ALFRYETSKVVQISSIKVSVIYRLIQLLIIAYVIGWVVVYKKGYQDFDDVVSGVTTKVKGVQYTNLTGTSIGARIWDVADYVVPPQENNAFFITTNAVVTRDQTQGACDEDPSV--APCFSDADCPAGKPQMLGNGVNTGRCVPSSQAPNKTSCEILAWCPVEVDQL-PAGGTMFPEAVNFTVLIKDSIEFPLFGVKRRNVLDYYNSSQLQNCVYNPDTDM--YCPVFRIGDIL-KLAGIDNFTKIATGGVVSITVNWDCNLDWDASYCNPTYRFRRLDDENTKIAKGWNFRYANYYRINDTDHRTLIKAYGLRFVVYVTGRAGRFNVIPLTMNLGSGLALLGIATVLCDMIVLYLHHKKVIYRGAKYETLEDDDAYRLMNEEDDG 399          
BLAST of P2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:103022360])

HSP 1 Score: 233.802 bits (595), Expect = 5.977e-72
Identity = 159/406 (39.16%), Postives = 234/406 (57.64%), Query Frame = 3
Query:    3 MKSTVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGAR--CVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGK-LSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKY--FQSKYELHNDDDAYQELNENTESNEALD 1205
            MK+++   T  +   FFEYET + V + ++++G + R  QL ++VYIIG+V IY +GYQ       SV  K+KG++ T  S   +++WD+SD + P Q   +  V TN I T+ QTQS C E   +P  +  C +D DC + +    GNG MTG+CVN+     TCEI SWCP+E+D  + PD  +L    ++T+ I+N+I F E +V RSNL    +    KTC+F+P  + L  CPIFK+   +   +     Q+   GG I ++I+W C+LD    +C P+Y F+ L     +  S G+NFR A YYV +  E R L KVFGLRI   V G ARKF  I     IGSGV +  VATV+CD ++L+L+P R+ Y   + KY    D++  ++ +E+     + D
Sbjct:    1 MKNSI---TEAISDFFFEYETPRQVLVRNRRVGVVCRLIQLGVLVYIIGWVFIYEKGYQTEDTAIGSVFTKMKGVAYTNIS-GEQKVWDVSDYVYPDQGAESFVVMTNFIITVGQTQSTCPE---LPDGKNTCHSDEDCKKGEFKRTGNGEMTGKCVNTT---NTCEIMSWCPVEDDRQI-PDPPLLLAAENYTLFIKNSITFPEFNVVRSNLVEGVDQNYIKTCMFHPEKDPL--CPIFKLGD-IAQYSGFNFTQIAQGGGAIGILIDWECNLDLRIQKCIPKYRFHGLYGSSSEGASVGYNFRKAKYYVEDKVEKRTLMKVFGLRIDIIVHGLARKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYLLPKRDFYKNMKFKYTTVQDEENAEDQHEHLTVGSSGD 392          
BLAST of P2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 235.343 bits (599), Expect = 8.493e-72
Identity = 152/375 (40.53%), Postives = 221/375 (58.93%), Query Frame = 3
Query:   36 VKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGK--LSKGWNFRFANYY-VNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHND 1151
            + + FF+Y T K + I SK +G + R  Q L+I YIIGYV ++ +GYQD+  + SSV  KVKGI+ T  S    R+WD++D IIPPQE  + FV TN   T NQTQS C E+   P + C +D DC +       +GV TGRCV+    IKTCE+ +WCPLE      PD  +L E  +FT+LI+N++ + + +  R N+    N+     C+F+ + +    CPIF++   +      + + +   GG++ V I W+CDLD   N C P Y+F RLD KD +  ++ G+NFRFA YY  +NG E R L K +G+R    V GKA KF+ +   +NIG+G+ L+ + TV+CD+ +L  M  R  Y + KY   +D
Sbjct:   75 LTRCFFDYSTPKTLVIRSKTVGAINRLCQALVIAYIIGYVCVWKKGYQDTDTVISSVTTKVKGIALTNTSDLGTRIWDVADYIIPPQEENSFFVLTNLNITPNQTQSHCPENPG-PESSCSSDQDCKKGFRNGRLSGVRTGRCVHFSERIKTCEVLAWCPLEKYDE-PPDPPMLAEAENFTVLIKNSVRYPKFNFSRRNILPHINSTYLSKCVFSRDTD--PDCPIFRLRDIVAEAGE-DFQAMAVHGGVMGVQIRWDCDLDMPANWCVPRYTFRRLDNKDPENNVAPGYNFRFAKYYKSSNGEEIRTLIKGYGIRFDIMVFGKAGKFNVVPTLLNIGAGLGLMGLVTVVCDWFVLVFMRKRHLYRERKYSYVDD 444          
BLAST of P2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx8 (purinergic receptor P2X, ligand-gated ion channel, 8 [Source:ZFIN;Acc:ZDB-GENE-030319-7])

HSP 1 Score: 232.646 bits (592), Expect = 1.158e-71
Identity = 144/372 (38.71%), Postives = 216/372 (58.06%), Query Frame = 3
Query:   51 FEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSY-GLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVY-GIKTCEIYSWCPLE-NDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLD--PKDGKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHN 1148
            F+Y+T K V   +KK+G L+R  QL L+ YIIG+V +  +GYQ++   + SSV+ KVKG+  T  S +  R+W   D +IP Q     F+TTN IET NQ    CAE + V   RC  + DC E +A++ GNGV TGRC+        TCEIY WCP+E +  ++ P   +L +  +FTI I+N I F +    +SN+     +   KTCL++   +   YCPIF++   +   +  + + +   GG I ++I W+CDLD   + C P Y+F RLD       +S G+NFR+A+Y+ N  G  +R L KV+G+R   +V G+A KF+ I   +NIGSG+AL+   +  CD ++L++M     Y + K+E  N
Sbjct:   13 FDYKTEKYVIAKNKKVGILYRVIQLSLLGYIIGWVFLTKKGYQETEESIQSSVITKVKGVLLTNSSGTGPRLWGPEDYVIPQQGEDVLFITTNFIETPNQKLGYCAESFKVLDGRCRKNEDCPEGEAVVAGNGVRTGRCLKKDRNSTGTCEIYGWCPIEKSQRLIVP---LLGKTENFTIYIKNFIRFPKFGFSKSNVLDTAGDSYLKTCLYDAIAH--PYCPIFRLGDIV-LRSGHDFQDMALLGGSIGILIEWHCDLDKGYSHCHPRYTFTRLDFNSTANSVSSGYNFRYAHYFKNPAGETHRTLLKVYGIRFDIQVHGRAGKFNIIPTIINIGSGLALMGAGSFFCDMVLLYMMKKSTLYRERKFEKAN 378          
BLAST of P2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 235.343 bits (599), Expect = 4.096e-71
Identity = 152/375 (40.53%), Postives = 221/375 (58.93%), Query Frame = 3
Query:   36 VKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGK--LSKGWNFRFANYY-VNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHND 1151
            + + FF+Y T K + I SK +G + R  Q L+I YIIGYV ++ +GYQD+  + SSV  KVKGI+ T  S    R+WD++D IIPPQE  + FV TN   T NQTQS C E+   P + C +D DC +       +GV TGRCV+    IKTCE+ +WCPLE      PD  +L E  +FT+LI+N++ + + +  R N+    N+     C+F+ + +    CPIF++   +      + + +   GG++ V I W+CDLD   N C P Y+F RLD KD +  ++ G+NFRFA YY  +NG E R L K +G+R    V GKA KF+ +   +NIG+G+ L+ + TV+CD+ +L  M  R  Y + KY   +D
Sbjct:   75 LTRCFFDYSTPKTLVIRSKTVGAINRLCQALVIAYIIGYVCVWKKGYQDTDTVISSVTTKVKGIALTNTSDLGTRIWDVADYIIPPQEENSFFVLTNLNITPNQTQSHCPENPG-PESSCSSDQDCKKGFRNGRLSGVRTGRCVHFSERIKTCEVLAWCPLEKYDE-PPDPPMLAEAENFTVLIKNSVRYPKFNFSRRNILPHINSTYLSKCVFSRDTD--PDCPIFRLRDIVAEAGE-DFQAMAVHGGVMGVQIRWDCDLDMPANWCVPRYTFRRLDNKDPENNVAPGYNFRFAKYYKSSNGEEIRTLIKGYGIRFDIMVFGKAGKFNVVPTLLNIGAGLGLMGLVTVVCDWFVLVFMRKRHLYRERKYSYVDD 444          
BLAST of P2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:103022360])

HSP 1 Score: 231.491 bits (589), Expect = 5.166e-71
Identity = 155/382 (40.58%), Postives = 224/382 (58.64%), Query Frame = 3
Query:    3 MKSTVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGAR--CVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGK-LSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            MK+++   T  +   FFEYET + V + ++++G + R  QL ++VYIIG+V IY +GYQ       SV  K+KG++ T  S   +++WD+SD + P Q   +  V TN I T+ QTQS C E   +P  +  C +D DC + +    GNG MTG+CVN+     TCEI SWCP+E+D  + PD  +L    ++T+ I+N+I F E +V RSNL    +    KTC+F+P  + L  CPIFK+   +   +     Q+   GG I ++I+W C+LD    +C P+Y F+ L     +  S G+NFR A YYV +  E R L KVFGLRI   V G ARKF  I     IGSGV +  VATV+CD ++L+L+P R+ Y   K++
Sbjct:    1 MKNSI---TEAISDFFFEYETPRQVLVRNRRVGVVCRLIQLGVLVYIIGWVFIYEKGYQTEDTAIGSVFTKMKGVAYTNIS-GEQKVWDVSDYVYPDQGAESFVVMTNFIITVGQTQSTCPE---LPDGKNTCHSDEDCKKGEFKRTGNGEMTGKCVNTT---NTCEIMSWCPVEDDRQI-PDPPLLLAAENYTLFIKNSITFPEFNVVRSNLVEGVDQNYIKTCMFHPEKDPL--CPIFKLGD-IAQYSGFNFTQIAQGGGAIGILIDWECNLDLRIQKCIPKYRFHGLYGSSSEGASVGYNFRKAKYYVEDKVEKRTLMKVFGLRIDIIVHGLARKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYLLPKRDFYKNMKFK 368          
BLAST of P2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008095.1 (pep scaffold:Pmarinus_7.0:GL481209:13988:23244:1 gene:ENSPMAG00000007268.1 transcript:ENSPMAT00000008095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 228.794 bits (582), Expect = 1.328e-70
Identity = 134/370 (36.22%), Postives = 210/370 (56.76%), Query Frame = 3
Query:   51 FEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSR--RRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDD 1154
            FEY+T K++    + +G ++R  QL+++ YIIG+V +  +GYQ++     + V+      +  +S     +R+WD +D +IPPQ     FV TN + T  Q Q +CAE+ NVPGARC  D DC   +    GNG+ TGRCV +    + CE+++WCP+EN     P + +L+E  +FT+ I+ ++ F   +V R N+    ++   K+C F+P  + L  CP+F++   L          + T GG+I V + W+CDLD   + C  +Y F+RLD +  +++ G NFRFA Y   +G E R L KV+G+R    V GKA KFS +   +N+G+G+ALL     LCD  +L+      +Y Q K+E   +D
Sbjct:   14 FEYKTEKLMIARDRSVGVVYRLMQLVILAYIIGWVFVVKKGYQETDPDPETSVITKVKGVALTNSTEGPGQRLWDTADYVIPPQGESRFFVVTNLVSTPRQRQGLCAENPNVPGARCQEDGDCPAGRTFNTGNGICTGRCVPTNGTARVCEVHAWCPVENSPT--PREAVLREAENFTVFIKVSVNFTRFNVHRRNVLEEGDSSYLKSCEFHPERSPL--CPVFRLGE-LAVRAGASFSDMATRGGVIAVHLAWDCDLDRDLSACAAQYRFSRLDSERSRVAAGHNFRFARYSWQDGAETRSLLKVYGVRFDVMVSGKAGKFSIVPTLLNLGAGLALLGAGAFLCDLFLLYASKESPQYRQRKFERSEED 378          
BLAST of P2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007719.1 (pep scaffold:Pmarinus_7.0:GL477301:21784:46999:1 gene:ENSPMAG00000006964.1 transcript:ENSPMAT00000007719.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.014 bits (432), Expect = 2.415e-49
Identity = 126/371 (33.96%), Postives = 183/371 (49.33%), Query Frame = 3
Query:   36 VKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDP--KDGKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            + K +  Y   K  +I S+K   L  F   +++V      +IY  GYQ+  G+ SS   KVKG +     V      D +D +I P+E  + FV TN IET NQ Q  CAED +V  A C +D DC        G GV TG CV      K+CE+ +WCPL  D+  +P K+                          N+     +++ K+C ++   +    CPIF +   +      + K+L   GG+  ++I WNC+LD +E  CKP Y F RLD   ++  +S G+NFRF  YY +  G E R L K +G+R + EV G+A K S +   +++GSGV LL +  V+CD I+LF       Y +  YE
Sbjct:    9 LSKFYLNYTITKKARIKSRKAAIL-TFLVFVMLVISYTGWVIYTHGYQEFDGVVSSSTAKVKGATEVTGMV-----MDAADYVISPEEPNSFFVMTNFIETPNQKQGACAEDPDV--APCSSDTDCRAGVTDPEGEGVFTGLCVPINNTTKSCEVNAWCPLPKDS--NPPKH--------------------------NILGSNASYL-KSCRYHRQSD--PECPIFILGDIVSEAGE-DFKELAIEGGVFSIMIEWNCNLDLNEQACKPNYKFRRLDKENRNKTISPGYNFRFPKYYKDAKGIETRTLVKAYGIRFMVEVIGQAGKASLLRSLISLGSGVGLLGMVWVICDLIVLFCCRKSRIYREQLYE 339          
BLAST of P2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008762.1 (pep scaffold:Pmarinus_7.0:GL477338:26903:57888:-1 gene:ENSPMAG00000007911.1 transcript:ENSPMAT00000008762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.109 bits (331), Expect = 5.713e-35
Identity = 88/254 (34.65%), Postives = 131/254 (51.57%), Query Frame = 3
Query:  258 RMWDISDIIIPPQENGATFVTTNAIETLNQTQ-SICA--EDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTF---GGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANY-YVNNGREYRILYKVFGLRILFEVRGK 998
            R +D +D ++P QE    FV TN I T NQTQ + C   E      + C ND DC  + +  LG+G+ TGRC+      K+CE+  WCP+E  T   P   +L    + T+ I+N + F + + +R N           +C ++P D+    CPIF+    LG IT +      +    GGII ++I+W+C L  SE +C P YSF+RLD ++    +G+NFR   Y  +    + R L K FG+R    V G+
Sbjct:   83 RTFDSADYVVPDQEPNTFFVMTNFIVTKNQTQVTTCCNPEAMKFSVSPCQNDGDCTRDASKHLGSGIQTGRCIRYDATCKSCEVMGWCPVERRTS-PPQPPLLPATENATVYIQNHVYFIKNNKERENFPLNLEGKDLSSCRYHPRDD--PSCPIFR----LGDITAMAGHSFSSMSVQGGIIAIVISWDCKL--SEVECFPAYSFHRLD-RNYTTKRGYNFRSLVYKSMETDVQTRTLVKAFGIRFNILVTGQ 326          
BLAST of P2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000196.1 (pep scaffold:Pmarinus_7.0:GL482356:953:3300:-1 gene:ENSPMAG00000000176.1 transcript:ENSPMAT00000000196.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 8.803e-13
Identity = 36/97 (37.11%), Postives = 53/97 (54.64%), Query Frame = 3
Query:  444 GVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFL 734
            G  TGRCV     + TCE+ +WCP+E +   +  K +L+   +FTILI+N I F + +V + NL    +    K+C  +P  N L  CPIF +   L
Sbjct:    1 GEKTGRCVPFDKNVSTCEVNAWCPVEVEGK-NTGKRLLRSAENFTILIKNNIRFPKFNVSKGNLPENMDKNFLKSCHHHPKHNNL--CPIFSLRDIL 94          
BLAST of P2X purinoceptor 4 vs. Ensembl Nematostella
Match: EDO41363 (P2X purinoceptor [Source:UniProtKB/TrEMBL;Acc:A7S4Q4])

HSP 1 Score: 250.366 bits (638), Expect = 1.219e-78
Identity = 149/394 (37.82%), Postives = 226/394 (57.36%), Query Frame = 3
Query:   33 KVKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQD---SYGLXXXXXXXXXXXXXTADSV----SRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNS--VYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE--LHNDDDAYQELNEN 1181
            KV  +  EY T+KIV I SKK+G + R  QL +I YIIGYV+IY +GYQ+    Y   ++ +      + T +          +WD +D +IPP+EN A FV TN + T +Q Q  C E  ++   +C  D +C   +    G+G  TG+CV S    GIK CE+++WCP+E D    P    LK   +FT+LI+NT+ F    V + N+    +    K+C ++ + + L  CPIF++ +        +  +L   GG+I +II WNCD D     CKP YSF RLD  +  ++KG+NFR ANYYV N   +R L+K +G+R +  V G+  KF+ + L +N+GSG+ALL++ATVLCD ++L+++  +E Y + KY+  + N  D     N++
Sbjct:    7 KVIDSLLEYNTSKIVHIKSKKVGLINRLIQLAIIGYIIGYVIIYKKGYQEVEKPYSSVTTKLKGTSFTNLTGNESFPLYGGPFVWDQADYVIPPEENDAFFVATNMVITPDQRQGTCPESPDIANVKCTRDENCTRMEETSYGHGFQTGKCVPSDQEKGIKVCEVFAWCPVELDITPMPQFPSLK---NFTVLIKNTVQFPSFGVSKRNIAPDADTSTLKSCQYDKDTSPL--CPIFRLETITKEAGQ-DFNKLAYKGGVIGIIITWNCDFDSLLYSCKPVYSFRRLDNANAPIAKGYNFRHANYYVKNDTLHRTLFKAYGIRFVVTVTGQGGKFNVVPLFLNLGSGLALLSIATVLCDVVVLYVLRRKEFYREKKYQYVVENSSDEVSNRNQH 394          
BLAST of P2X purinoceptor 4 vs. Ensembl Nematostella
Match: EDO43233 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ68])

HSP 1 Score: 49.2914 bits (116), Expect = 2.162e-6
Identity = 30/98 (30.61%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  846 EYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYE 1139
            +Y  N++ P  G      +F F +       E R+  K +G++I F   GK  +FS   L + + SGV LL +   + D   L+L+P+R +Y +  YE
Sbjct:  276 DYRINQVIPIIG----ADDFSFTDDKTLTRPEKRLFRKRYGIKIEFHQSGKLGRFSLPALLLKLVSGVGLLTLTATIVDTAALYLLPDRFQYREFVYE 369          
BLAST of P2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx5 (P2X purinoceptor 5 [Source:NCBI gene;Acc:101173001])

HSP 1 Score: 239.58 bits (610), Expect = 2.092e-73
Identity = 147/404 (36.39%), Postives = 227/404 (56.19%), Query Frame = 3
Query:   45 AFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQD-SYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPK-DGKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHN--------DDDAYQELNENTESNEALDIESIKK 1223
            +   Y+T K V   +++IG LFR +QL ++ YIIG+V +  +GYQ+    + +SV+ KVKG+S    S +   +W   D +IPP      F+ TN IET NQ    CAE   VP   C +D DC+E ++I  G+G+MTG C+NS     TCEIY+WCP+E+     P + +L E  +FTI I+N I F +    +SN+    ++   K C ++  ++   YCPIF++   +   T  + + +   GG + ++I WNCDLD   ++C P YSF RLD   +  ++ G+NFR A YY +  G  YR LYKV+G+R    + G+A KF+ +   + IGSGVAL+ +   +CD I+L++M     Y + K+E+ N         +  ++E      + E  D  S+KK
Sbjct:   10 SLLNYKTEKYVIAENRRIGILFRLYQLAVLGYIIGWVFVVKKGYQEKEEAVQTSVITKVKGVSLINSSQTGPYLWSAEDYVIPPNGEQVFFIVTNYIETPNQRLGFCAESPKVPNGMCQSDEDCLEGESIAAGHGIMTGLCLNST---GTCEIYAWCPVEHSKR--PTEALLSEAENFTIYIKNFIRFPKFEFSKSNVLETSDDSYLKKCSYDRENH--PYCPIFRLRDLVRN-TGNDFQDMAAKGGSVGILIEWNCDLDKDSSECNPRYSFTRLDMNLNSSITSGYNFRHARYYKDEKGETYRTLYKVYGIRFDIMINGQAGKFNIVPTIIAIGSGVALMGIGAFVCDMILLYMMNTSSFYRERKFEIINFKKERSKTKEGNHRERRSKKTAAEKDDANSVKK 405          
BLAST of P2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:101169631])

HSP 1 Score: 218.779 bits (556), Expect = 8.233e-66
Identity = 150/381 (39.37%), Postives = 220/381 (57.74%), Query Frame = 3
Query:   48 FFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGAR-CVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRL--DPK---DGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQEL 1172
            FFEYET + V + +K++G + R  QL ++ YIIG+V IY +GYQ +    SSV  KVKG+ ST  S    R+WD SD + PPQ + +  V TN I T NQT   C E   +PG   C +D DC         +G +TG CV      KTCE+ +WCPLE+D  + P+  +L    +FT+ I+N++ F    + RSNL    +    K CLF+P+++ L  CPIFK+   +  ++    + +   GG I ++I+W C+ D+   +CKP+Y F+ L  +P+     K S G+NFR+A YY+ +  E R L KVFG+R    V+   RKF  I     IGSGV +  VATV+CD ++L+++P R+ Y   K++ + D  A QEL
Sbjct:   13 FFEYETPRQVLVRNKRVGVVCRLIQLGVLAYIIGWVFIYEKGYQITETAVSSVFTKVKGVGSTNIS-GVERVWDPSDYVFPPQGDSSFVVMTNYILTENQTMGKCPE---LPGRYICKSDTDCKGGTYNRTVDGKLTGVCVKET---KTCELLAWCPLEDDRNI-PNPPLLMSAENFTLFIKNSVTFPLFGITRSNLVEEIDGKTIKNCLFDPDNSPL--CPIFKLGDIV-KLSGFTFETMAKQGGAIGLVIDWTCNFDYDVKKCKPKYEFHGLYGNPRVKDTSKASVGYNFRYAKYYMGDKMEKRTLMKVFGIRFDIIVQSLGRKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYVLPRRDFYKNMKFK-YTDTAAQQEL 381          
BLAST of P2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx4b (purinergic receptor P2X 4 [Source:NCBI gene;Acc:101168548])

HSP 1 Score: 219.55 bits (558), Expect = 1.328e-65
Identity = 136/364 (37.36%), Postives = 216/364 (59.34%), Query Frame = 3
Query:   51 FEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKD--GKLSKGWNFRFANYYVN-NGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSK 1133
            F+YET K + I    +G +FRF QLL+++Y++GYV +  +GYQ++  + S+V  KVKG + T  S    RMWD++D +IPPQ + + F+ TN + T  QTQS C E  N P   C +D DCIE       NG+ TG C N    +KTCE++SWCPLE DT + P K +L    +FT+LI+N+I + + +    N+    N+     C FN   +    CPIF++   +      + +++   GGI+ ++I+W+CDLD+   +C P+YSF+RLD ++    ++ G+NFRFA +Y   +G E R L K +G+R    V G A KF  +   +N+G+ ++ L++  ++ D+++L  M  R+ Y + K
Sbjct:   15 FDYETAKTLVIPHFGVGIVFRFTQLLVVLYVVGYVCVVQKGYQETDSVISTVTTKVKGFAYTNTSDMDPRMWDVADYVIPPQGDSSFFILTNLVVTPEQTQSHCPELPN-PSTVCKDDCDCIEGYNDPRRNGIRTGLCENFSTTVKTCEVFSWCPLEVDTRL-PKKALLAAAENFTVLIKNSITYPKFNFHGRNILPHVNSSYLAHCEFNRLTD--PDCPIFRLKRIISE-AEADFQEMAVKGGILGILIDWSCDLDWWAGKCLPKYSFHRLDNQNQGNDVAPGYNFRFAKFYKRADGVEERTLIKAYGIRFEVIVFGTAGKFGIVPAIVNLGAALSFLSLVPIVADWVMLTCMRKRDLYTKQK 373          
BLAST of P2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:101169631])

HSP 1 Score: 216.083 bits (549), Expect = 4.084e-65
Identity = 150/387 (38.76%), Postives = 222/387 (57.36%), Query Frame = 3
Query:   48 FFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGAR-CVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRL--DPK---DGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTES 1190
            FFEYET + V + +K++G + R  QL ++ YIIG+V IY +GYQ +    SSV  KVKG+ ST  S    R+WD SD + PPQ + +  V TN I T NQT   C E   +PG   C +D DC         +G +TG CV      KTCE+ +WCPLE+D  + P+  +L    +FT+ I+N++ F    + RSNL    +    K CLF+P+++ L  CPIFK+   +  ++    + +   GG I ++I+W C+ D+   +CKP+Y F+ L  +P+     K S G+NFR+A YY+ +  E R L KVFG+R    V+   RKF  I     IGSGV +  VATV+CD ++L+++P R+ Y   K++    D A Q+ + +T S
Sbjct:   13 FFEYETPRQVLVRNKRVGVVCRLIQLGVLAYIIGWVFIYEKGYQITETAVSSVFTKVKGVGSTNIS-GVERVWDPSDYVFPPQGDSSFVVMTNYILTENQTMGKCPE---LPGRYICKSDTDCKGGTYNRTVDGKLTGVCVKET---KTCELLAWCPLEDDRNI-PNPPLLMSAENFTLFIKNSVTFPLFGITRSNLVEEIDGKTIKNCLFDPDNSPL--CPIFKLGDIV-KLSGFTFETMAKQGGAIGLVIDWTCNFDYDVKKCKPKYEFHGLYGNPRVKDTSKASVGYNFRYAKYYMGDKMEKRTLMKVFGIRFDIIVQSLGRKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYVLPRRDFYKNMKFKYT--DTAAQDPDLDTGS 386          
BLAST of P2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx3b (purinergic receptor P2X 3 [Source:NCBI gene;Acc:101174325])

HSP 1 Score: 194.126 bits (492), Expect = 1.007e-56
Identity = 135/374 (36.10%), Postives = 192/374 (51.34%), Query Frame = 3
Query:   42 KAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTM-VDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGK--LSKGWNFRFANYY-VNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHND 1151
            K FF YET K V + S  IG + R  QLL+I Y IG+V +  + YQ    +  + +            V   ++ D++D + P Q      + T  I T NQ Q +C E        C ND DC   +      G++TGRCV+     KTCEI  WCP E DT+ + P    + E+ +FTI I+N+I F + +  + N     N    K C F+  +N   YCPIF++   +      +  +L   GG+I + I+W CDLD S+  CKP YSFNRLD    K  +S G+NFRFA YY + NG +YR L K + +R    V G A KF+ I   +N+ +    + V TVLCD I+L  +   E+Y   K+E  +D
Sbjct:    6 KNFFTYETTKSVVVKSWTIGIINRVVQLLIITYFIGWVFLCEKAYQ----IIDTAIESSVMTKVKGFGVHNGQVMDVADYVTPTQGASVFCIITKTITTENQVQGLCPESEK--RWICYNDSDCNPQRNKPGDYGILTGRCVSFNDTKKTCEIKGWCPAEIDTVKITP----MMEVENFTIFIKNSIRFPKFNYTKGNFLPSINRTYIKKCNFDKVNN--TYCPIFRVGDVV-HYADQDFSKLADKGGVIGIKISWMCDLDKSDEHCKPSYSFNRLDTMSQKNEVSPGYNFRFAKYYKMENGTDYRTLIKAYAIRFDVIVNGNAGKFNMIPTLINMVAAFTSVGVGTVLCDIILLNFLKGAEQYKAKKFEEVSD 366          
BLAST of P2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000046895.1 (SMESG000046895.1)

HSP 1 Score: 761.525 bits (1965), Expect = 0.000e+0
Identity = 407/407 (100.00%), Postives = 407/407 (100.00%), Query Frame = 3
Query:    3 MKSTVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTESNEALDIESIKK 1223
            MKSTVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQLLLIVYIIGYVLIYMRGYQDSYGLSSSVVVKVKGISSTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTESNEALDIESIKK
Sbjct:    1 MKSTVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQLLLIVYIIGYVLIYMRGYQDSYGLSSSVVVKVKGISSTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTESNEALDIESIKK 407          
BLAST of P2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000046729.1 (SMESG000046729.1)

HSP 1 Score: 404.831 bits (1039), Expect = 1.439e-138
Identity = 212/376 (56.38%), Postives = 276/376 (73.40%), Query Frame = 3
Query:   21 RQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGI-KTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELH 1145
            R  +K     F YETNK+  I+ K IGF+ RFFQ+L++VY+I Y ++Y RGYQD YGLSSSV+VKVKGI  +      R++WDI D ++PPQE  A F+TTNAIET NQ+Q  C ED  V  A C  D DC + K + LGNGVMTGRCV S  G  KTCEI +WCP+ENDT++     +LKE+PDFT+LIRNTI+FD ++V+RSNLF+W    I K C++N +D  LKYCPIFK+S+ +G I+  E+ ++LT GG+I+VII WNC+LD+S + C P YSF+RL   DG  SKGWNFR+ANY+  +  E+R+LYKVFGLRIL EVRGKA KFS +TL+MNIGSG+ALL++A  +CD +I+     ++KY Q KYE+H
Sbjct:    6 RICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKDSDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISNSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKDKY-QYKYEVH 380          
BLAST of P2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000046751.1 (SMESG000046751.1)

HSP 1 Score: 402.134 bits (1032), Expect = 3.328e-137
Identity = 208/398 (52.26%), Postives = 282/398 (70.85%), Query Frame = 3
Query:    3 MKSTVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTESNE 1196
            MKST       ++    +Y T KI  I +  I + FR  Q  +++Y+  Y L   +GYQDSYGLSSSVVVK KG+   + + S+R +WDI+D ++PPQE  A F+TTN +ET NQTQ +C E+  V  + C  D DC   K + LGNG MTG+CVN+   IKTCEI +WCPLENDT  +    I+KE+P++T+LI+NTI+FDE++V+RSNLFA  +  IP +C++N +D+ LKYCPIFK+SSF+GTI   ++ +LL +GGII+VII WNC+LD   + C+PEYSF RL  K GK SKGWNFR+ANYY  N +E+R L+KV+GLRIL EVRGKARK S  TL+MN+GSG+ALL +AT++CDFI+ + +P REKY +  YE H+ ++  +  + N   NE
Sbjct:    1 MKSTCSSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLSSSVVVKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDIKTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDKPPSVNMAINE 398          
BLAST of P2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000046729.1 (SMESG000046729.1)

HSP 1 Score: 384.415 bits (986), Expect = 5.290e-131
Identity = 201/349 (57.59%), Postives = 259/349 (74.21%), Query Frame = 3
Query:   21 RQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSYGLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGI-KTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAV 1064
            R  +K     F YETNK+  I+ K IGF+ RFFQ+L++VY+I Y ++Y RGYQD YGLSSSV+VKVKGI  +      R++WDI D ++PPQE  A F+TTNAIET NQ+Q  C ED  V  A C  D DC + K + LGNGVMTGRCV S  G  KTCEI +WCP+ENDT++     +LKE+PDFT+LIRNTI+FD ++V+RSNLF+W    I K C++N +D  LKYCPIFK+S+ +G I+  E+ ++LT GG+I+VII WNC+LD+S + C P YSF+RL   DG  SKGWNFR+ANY+  +  E+R+LYKVFGLRIL EVRGKA KFS +TL+MNIGSG+ALL++
Sbjct:    6 RICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKDSDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISNSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSI 354          
BLAST of P2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000028996.1 (SMESG000028996.1)

HSP 1 Score: 295.049 bits (754), Expect = 1.230e-95
Identity = 168/377 (44.56%), Postives = 242/377 (64.19%), Query Frame = 3
Query:   54 EYETNKIVQINSKKIGFLFRFFQXXXXXXXXXXXXXXMRGYQDSY-GLXXXXXXXXXXXXXTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGIKTCEIYSWCPLEND-----TMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQ 1166
            EYET KIV I +KKIG +FRF QL+++ Y+IGYV++Y +GYQ++  G+S+ +        +         +WD++D +IPPQE  A F+T+NA+ T  QTQ  C ED N  GA+C  + DC+  + IILG+GV TG C+N+    +TCE+Y+WCP+E+      T+  P   +L  + +FT+ I+N I F +  V RSN+ +  N  +  +C ++ ++     CPIF+I   L  +T      +L  GG+I   INW+C+LD S   C P YSFNRLD  D KL+KGWNFR ANYY  N  +YR L K +G+R +  V  KA KFS I LTMN+GSG+ALLA+AT++CDFI+L+++ NR KY ++KY L  D++ Y+
Sbjct:   16 EYETVKIVSIKNKKIGLIFRFIQLVILSYVIGYVIVYKKGYQETEPGISAVISKVKGVSLTNRSFAGGETIWDVADYVIPPQEENAFFITSNALITKKQTQGKCPEDKNTVGAQCKTNADCVPLEPIILGDGVKTGVCINN----QTCEVYAWCPVESSAEDSKTVKLP---LLNNVNNFTVYIKNNIEFRKFKVFRSNIPSNFNKSMLSSCRYSSSNT---KCPIFQIGMIL-NLTGKSYDDILKTGGVISFSINWDCNLDVSLENCFPTYSFNRLDSDDIKLAKGWNFRHANYYYINETQYRDLIKAYGIRFVISVSSKAGKFSIIPLTMNLGSGLALLAIATIICDFIVLYILRNRSKYIEAKYHLI-DEEPYK 380          
The following BLAST results are available for this feature:
BLAST of P2X purinoceptor 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2RX42.541e-7640.75purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX21.697e-7435.26purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:... [more]
P2RX44.477e-7338.82purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX23.915e-7236.15purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:... [more]
P2RX51.248e-7037.98purinergic receptor P2X 5 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx4a8.548e-8042.45purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a3.389e-7741.73purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a9.056e-7741.48purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4b2.174e-7439.43purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx51.181e-7239.73purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx55.378e-7940.11purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx55.441e-7940.11purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx51.065e-7840.11purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx51.555e-7839.22purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx51.952e-7840.11purinergic receptor P2X, ligand gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2rx56.931e-7739.23purinergic receptor P2X, ligand-gated ion channel,... [more]
P2rx25.972e-7235.97purinergic receptor P2X, ligand-gated ion channel,... [more]
P2rx29.877e-7235.97purinergic receptor P2X, ligand-gated ion channel,... [more]
P2rx42.972e-7139.67purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx28.239e-7135.97purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51578|P2RX5_RAT5.178e-7738.65P2X purinoceptor 5 OS=Rattus norvegicus OX=10116 G... [more]
sp|Q99571|P2RX4_HUMAN1.220e-7540.75P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX... [more]
sp|Q5E9U1|P2RX4_BOVIN3.776e-7341.18P2X purinoceptor 4 OS=Bos taurus OX=9913 GN=P2RX4 ... [more]
sp|P51577|P2RX4_RAT5.376e-7241.39P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 G... [more]
sp|Q9UBL9|P2RX2_HUMAN1.880e-7136.15P2X purinoceptor 2 OS=Homo sapiens OX=9606 GN=P2RX... [more]
back to top
BLAST of P2X purinoceptor 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EI981.521e-9343.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GN821.538e-9343.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A210PQS53.095e-9342.18P2X purinoceptor 4 OS=Mizuhopecten yessoensis OX=6... [more]
A0A0R3W5121.130e-9241.15Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A1I8J6R26.253e-9243.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx15.977e-7239.16purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx4a8.493e-7240.53purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx81.158e-7138.71purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a4.096e-7140.53purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx15.166e-7140.58purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008095.11.328e-7036.22pep scaffold:Pmarinus_7.0:GL481209:13988:23244:1 g... [more]
ENSPMAT00000007719.12.415e-4933.96pep scaffold:Pmarinus_7.0:GL477301:21784:46999:1 g... [more]
ENSPMAT00000008762.15.713e-3534.65pep scaffold:Pmarinus_7.0:GL477338:26903:57888:-1 ... [more]
ENSPMAT00000000196.18.803e-1337.11pep scaffold:Pmarinus_7.0:GL482356:953:3300:-1 gen... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO413631.219e-7837.82P2X purinoceptor [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
EDO432332.162e-630.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx52.092e-7336.39P2X purinoceptor 5 [Source:NCBI gene;Acc:101173001... [more]
p2rx18.233e-6639.37purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx4b1.328e-6537.36purinergic receptor P2X 4 [Source:NCBI gene;Acc:10... [more]
p2rx14.084e-6538.76purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx3b1.007e-5636.10purinergic receptor P2X 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046895.10.000e+0100.00SMESG000046895.1[more]
SMESG000046729.11.439e-13856.38SMESG000046729.1[more]
SMESG000046751.13.328e-13752.26SMESG000046751.1[more]
SMESG000046729.15.290e-13157.59SMESG000046729.1[more]
SMESG000028996.11.230e-9544.56SMESG000028996.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012928 ID=SMED30012928|Name=P2X purinoceptor 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1446bp
CTATGAAATCAACAGTGATAAGACAAACTACAAAAGTTAAGAAAGCATTT
TTTGAATATGAAACAAATAAAATAGTTCAAATTAACAGCAAAAAAATTGG
ATTTCTTTTTCGGTTTTTTCAATTATTATTAATTGTGTACATCATTGGAT
ATGTTTTGATATATATGCGTGGTTATCAAGACAGTTATGGACTGAGTAGT
AGTGTTGTTGTGAAAGTTAAAGGTATTAGTTCTACAGCAGATTCGGTTTC
TCGTCGAAGAATGTGGGATATTTCTGATATTATCATTCCTCCGCAGGAAA
ACGGTGCGACCTTTGTTACAACTAATGCAATTGAAACCCTAAATCAGACC
CAATCGATTTGTGCTGAGGATTATAATGTTCCTGGTGCTCGTTGTGTGAA
CGACTACGATTGCATAGAAAATAAAGCAATAATTCTTGGAAATGGTGTGA
TGACTGGGCGTTGTGTGAACTCGGTGTATGGAATTAAAACGTGTGAAATT
TACTCATGGTGCCCACTTGAAAATGATACCATGGTCGATCCAGATAAATA
TATTTTAAAAGAAATTCCAGATTTTACGATACTTATTCGAAATACGATCT
TATTTGATGAATTACATGTGAAAAGGTCAAATTTATTTGCATGGGAAAAC
AATTGGATTCCAAAAACTTGCCTATTCAATCCAAATGATAACTGGCTTAA
ATATTGCCCAATTTTCAAAATATCGTCATTTTTGGGAACAATAACACCAG
TAGAAATGAAACAACTTCTAACTTTTGGAGGAATTATTCAAGTAATAATC
AATTGGAATTGTGATCTGGATTTTTCTGAGAATCAATGTAAACCAGAATA
TTCTTTTAATAGGCTTGATCCTAAAGATGGAAAACTAAGTAAAGGATGGA
ATTTTAGATTTGCAAATTATTATGTGAATAATGGAAGAGAGTATAGAATT
CTTTATAAGGTATTCGGACTAAGAATATTATTTGAAGTACGAGGTAAAGC
TAGAAAATTCAGTGCAATTACGTTAACAATGAATATTGGTTCCGGTGTAG
CTTTATTAGCTGTCGCCACAGTTCTTTGTGATTTCATAATTCTTTTCCTA
ATGCCTAACAGGGAGAAATATTTCCAATCAAAATATGAGCTTCATAATGA
CGATGATGCTTATCAAGAATTAAATGAAAATACAGAATCAAATGAAGCTC
TCGATATTGAATCAATTAAAAAATAAATTTCATTTTTAAATATTTGCTTT
TGCAGTAATTCGTATTTATTTTTATTACAATATTAATTGCAAATAAATCT
CTACTATGGAGTATTATGCGTGTATTTTATAAGTTAGTGAATTGCATAAT
TTGGTTATTTATATATTATACAAATATTATATAGTGCGGTTTGAATTTAA
TAAATATCATATGATTGAGTTGACCAGGGTTTCATGTACGTATTGT
back to top

protein sequence of SMED30012928-orf-1

>SMED30012928-orf-1 ID=SMED30012928-orf-1|Name=SMED30012928-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=408bp
MKSTVIRQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQLLLIVYIIGY
VLIYMRGYQDSYGLSSSVVVKVKGISSTADSVSRRRMWDISDIIIPPQEN
GATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVM
TGRCVNSVYGIKTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTIL
FDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPV
EMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWN
FRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVA
LLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTESNEAL
DIESIKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0001614purinergic nucleotide receptor activity
GO:0004931extracellular ATP-gated cation channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005887integral component of plasma membrane
GO:0098794postsynapse
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR001429P2X_purnocptor
IPR027309P2X_extracellular_dom_sf
Vocabulary: biological process
TermDefinition
GO:0033198response to ATP
GO:0098655cation transmembrane transport
GO:0035590purinergic nucleotide receptor signaling pathway
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001429P2X purinoreceptorPRINTSPR01307P2XRECEPTORcoord: 162..173
score: 69.57
coord: 252..264
score: 25.42
coord: 297..307
score: 66.01
coord: 316..330
score: 37.68
coord: 86..94
score: 36.23
IPR001429P2X purinoreceptorTIGRFAMTIGR00863TIGR00863coord: 8..378
e-value: 7.5E-116
score: 385.0
IPR001429P2X purinoreceptorPIRSFPIRSF005713P2X_purinoceptorcoord: 4..406
e-value: 6.1E-126
score: 418.1
NoneNo IPR availableGENE3DG3DSA:1.10.287.940coord: 40..360
e-value: 2.4E-112
score: 377.1
NoneNo IPR availablePFAMPF00864P2X_receptorcoord: 17..384
e-value: 3.5E-122
score: 408.0
NoneNo IPR availablePANTHERPTHR10125P2X PURINOCEPTORcoord: 11..394
NoneNo IPR availableTMHMMTMhelixcoord: 33..55
NoneNo IPR availableTMHMMTMhelixcoord: 345..367
IPR027309P2X purinoreceptor extracellular domain superfamilyGENE3DG3DSA:2.60.490.10coord: 60..335
e-value: 2.4E-112
score: 377.1