Family S33 non-peptidase homologue (S33 family)

Overview
NameFamily S33 non-peptidase homologue (S33 family)
Smed IDSMED30012889
Length (bp)1301
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Family S33 non-peptidase homologue (S33 family) (SMED30012889) t-SNE clustered cells

Violin plots show distribution of expression levels for Family S33 non-peptidase homologue (S33 family) (SMED30012889) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Family S33 non-peptidase homologue (S33 family) (SMED30012889) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Family S33 non-peptidase homologue (S33 family) (SMED30012889) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012889

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30012889SMESG000021236.1 dd_Smed_v4_1414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30012889SMESG000021236.1 dd_Smed_v4_1414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012889SMESG000021236.1 dd_Smed_v4_1414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012889SMESG000021236.1 dd_Smed_v4_1414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012889SMESG000021236.1 dd_Smed_v4_1414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012889SMESG000021236.1 dd_Smed_v4_1414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012889SMESG000021236.1 dd_Smed_v4_1414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012889SMESG000021236.1 dd_Smed_v4_1414_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012889SMESG000021236.1 Contig28682newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012889SMESG000021236.1 Contig28682uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012889SMESG000058104.1 SMESG000030735.1 SMESG000023051.1 SMESG000021236.1 SMESG000000712.1 Contig36315newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012889SMESG000058104.1 SMESG000030735.1 SMESG000023051.1 SMESG000021236.1 SMESG000000712.1 Contig36315uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pigment cellSMED30012889SMESG000021236.1 dd_Smed_v6_1414_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012889SMESG000021236.1 dd_Smed_v4_1414_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012889SMESG000021236.1 SMED_00375_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30012889SMESG000021236.1 SMED_00375_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Human
Match: NDRG3 (NDRG family member 3 [Source:HGNC Symbol;Acc:HGNC:14462])

HSP 1 Score: 108.227 bits (269), Expect = 1.822e-25
Identity = 89/336 (26.49%), Postives = 144/336 (42.86%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYID-FLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADD-VKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            G +   I G    N   ILT HDIG NH    + F     M+ +       +V  PGQ    P  P+ Y YPTM ++A+ L   +  LS+  +I  G GAGA IL+R A++  E + G VL+N        V+      I W  S + G+T++  + ++ H FG    L+++ DL   I  Y+  +    N  NL  ++ SY  R +L                            E+E     +  +K  T+KC  L + G  +   +  V+C          N      +   +++ +C  +  V +  ++ E+ +YFLQG G + SA   R++
Sbjct:   28 GVVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAGAYILSRFALNHPELVEGLVLIN--------VDPCAKGWIDWAASKLSGLTTNVVDIILAHHFG-QEELQANLDL---IQTYRMHIAQDINQDNLQLFLNSYNGRRDL----------------------------EIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVEC----------NSRLNPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLA 313          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Human
Match: NDRG3 (NDRG family member 3 [Source:HGNC Symbol;Acc:HGNC:14462])

HSP 1 Score: 108.227 bits (269), Expect = 2.112e-25
Identity = 89/336 (26.49%), Postives = 144/336 (42.86%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYID-FLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADD-VKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            G +   I G    N   ILT HDIG NH    + F     M+ +       +V  PGQ    P  P+ Y YPTM ++A+ L   +  LS+  +I  G GAGA IL+R A++  E + G VL+N        V+      I W  S + G+T++  + ++ H FG    L+++ DL   I  Y+  +    N  NL  ++ SY  R +L                            E+E     +  +K  T+KC  L + G  +   +  V+C          N      +   +++ +C  +  V +  ++ E+ +YFLQG G + SA   R++
Sbjct:   40 GVVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAGAYILSRFALNHPELVEGLVLIN--------VDPCAKGWIDWAASKLSGLTTNVVDIILAHHFG-QEELQANLDL---IQTYRMHIAQDINQDNLQLFLNSYNGRRDL----------------------------EIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVEC----------NSRLNPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLA 325          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Human
Match: NDRG1 (N-myc downstream regulated 1 [Source:HGNC Symbol;Acc:HGNC:7679])

HSP 1 Score: 107.842 bits (268), Expect = 4.220e-25
Identity = 91/375 (24.27%), Postives = 159/375 (42.40%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNH-TQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYDNPKGASNITYNPKRKYSESEN 1215
            G +   + GT   N   ILT HDIG NH T Y     +  M+ +       +V  PGQ       P+ Y YP+M Q+A+ L   +    +  +I  G GAGA IL R A++  E + G VL+N        ++    KI GW       T +  + +V H FG   + +N+E       +++ Y++ + +  N  NLH ++ +Y +R                              R++E E R    +   T++CP L + G  +   D V      ++   K +P +      +++ +C  +  + +  ++AE+ +YF+QG G +   PS  M+  +R       S+   D  +  S+ +   + +   SE 
Sbjct:   42 GSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGW-------TQALPDMVVSHLFGKEEMQSNVE-------VVHTYRQHIVNDMNPGNLHLFINAYNSR------------------------------RDLEIE-RPMPGTHTVTLQCPALLVVGDSSPAVDAV------VECNSKLDPTK---TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYM---PSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEG 359          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Human
Match: NDRG1 (N-myc downstream regulated 1 [Source:HGNC Symbol;Acc:HGNC:7679])

HSP 1 Score: 107.842 bits (268), Expect = 4.220e-25
Identity = 91/375 (24.27%), Postives = 159/375 (42.40%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNH-TQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYDNPKGASNITYNPKRKYSESEN 1215
            G +   + GT   N   ILT HDIG NH T Y     +  M+ +       +V  PGQ       P+ Y YP+M Q+A+ L   +    +  +I  G GAGA IL R A++  E + G VL+N        ++    KI GW       T +  + +V H FG   + +N+E       +++ Y++ + +  N  NLH ++ +Y +R                              R++E E R    +   T++CP L + G  +   D V      ++   K +P +      +++ +C  +  + +  ++AE+ +YF+QG G +   PS  M+  +R       S+   D  +  S+ +   + +   SE 
Sbjct:   42 GSVHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGW-------TQALPDMVVSHLFGKEEMQSNVE-------VVHTYRQHIVNDMNPGNLHLFINAYNSR------------------------------RDLEIE-RPMPGTHTVTLQCPALLVVGDSSPAVDAV------VECNSKLDPTK---TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYM---PSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGTRSRSHTSEG 359          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Human
Match: NDRG2 (NDRG family member 2 [Source:HGNC Symbol;Acc:HGNC:14460])

HSP 1 Score: 103.99 bits (258), Expect = 5.761e-24
Identity = 92/348 (26.44%), Postives = 150/348 (43.10%), Query Frame = 1
Query:   73 TKMTTINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECI-GILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDL---STMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
             K  ++ T Y G +TF + GT      AILT HD+G N+   +    +   M+ +    V  +V  PG     P  P  Y YP++ Q+A D+I C+   L+ S +I  G GAGA ILAR A++  + + G VL+N   +    ++    K+        G+TSS    ++ H F       S E+L   S +I  Y+  +    N  N+  Y  SY NR +L   N     DI                                T++CP++ + G  A + D V      ++   K +P +   ++    D+     + +  ++ E+ +YFLQG G + S+   R+S
Sbjct:   24 AKTHSVETPY-GSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLA-DMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKL-------TGLTSSIPEMILGHLF-------SQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDL---NFERGGDI--------------------------------TLRCPVMLVVGDQAPHEDAV------VECNSKLDPTQTSFLKMA--DSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLS 312          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Celegans
Match: ZK1073.1 (pep chromosome:WBcel235:X:16124151:16128865:-1 gene:WBGene00014213.1 transcript:ZK1073.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK1073.1)

HSP 1 Score: 151.369 bits (381), Expect = 5.331e-42
Identity = 105/370 (28.38%), Postives = 168/370 (45.41%), Query Frame = 1
Query:   76 KMTTINTKYCGKLTFYIEGT--RSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLV------GSAPSRRMSSTVRPIGNRKISMEEYDNPK 1161
            +M  +  + CG L  Y++G       +  ILTVHDIG NH  ++ F+ H SM T+  + ++ +V +PGQ  N  D   D+  PT+  I DDL   +    +   I FGEG GANI+ R AM    RI+G VL++C  +T  ++E  K+K++  +L    M+    +YL+ H+FG           S     Y + L+ T N KNL  Y+ ++  R++L   + TI                                +K  T+    L ++GS A++   V   ++ +          K+    + +DN A+V+ E  D++A SL    +G G++      G    R +SS          SMEE D P+
Sbjct:    7 QMVVVQAQNCGVLHVYVQGNLEERGGKTIILTVHDIGTNHKSFVRFVNHPSMATVKEKAIFLHVCVPGQEDNSADFFGDF--PTLDGIGDDLSAVLDKFEVKSAIAFGEGVGANIICRFAMGHPNRIMGIVLVHCTSTTAGIIEYCKEKVMNMRLENSIMSDGAWDYLLAHKFG---------GESKSRQEYLEELKATLNPKNLSKYLVAFTKRTDL---SSTI-------------------------------GTKLETVDA--LLVTGSKASHLHTVYTTHKSMN---------KKKTTLLVVDNVADVMQEAPDKLARSLILLCKGCGVLSGVAIPGMERQRTLSS----------SMEEADRPR 310          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Celegans
Match: ZK1073.1 (pep chromosome:WBcel235:X:16123942:16128815:-1 gene:WBGene00014213.1 transcript:ZK1073.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK1073.1)

HSP 1 Score: 151.369 bits (381), Expect = 5.331e-42
Identity = 105/370 (28.38%), Postives = 168/370 (45.41%), Query Frame = 1
Query:   76 KMTTINTKYCGKLTFYIEGT--RSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLV------GSAPSRRMSSTVRPIGNRKISMEEYDNPK 1161
            +M  +  + CG L  Y++G       +  ILTVHDIG NH  ++ F+ H SM T+  + ++ +V +PGQ  N  D   D+  PT+  I DDL   +    +   I FGEG GANI+ R AM    RI+G VL++C  +T  ++E  K+K++  +L    M+    +YL+ H+FG           S     Y + L+ T N KNL  Y+ ++  R++L   + TI                                +K  T+    L ++GS A++   V   ++ +          K+    + +DN A+V+ E  D++A SL    +G G++      G    R +SS          SMEE D P+
Sbjct:    7 QMVVVQAQNCGVLHVYVQGNLEERGGKTIILTVHDIGTNHKSFVRFVNHPSMATVKEKAIFLHVCVPGQEDNSADFFGDF--PTLDGIGDDLSAVLDKFEVKSAIAFGEGVGANIICRFAMGHPNRIMGIVLVHCTSTTAGIIEYCKEKVMNMRLENSIMSDGAWDYLLAHKFG---------GESKSRQEYLEELKATLNPKNLSKYLVAFTKRTDL---SSTI-------------------------------GTKLETVDA--LLVTGSKASHLHTVYTTHKSMN---------KKKTTLLVVDNVADVMQEAPDKLARSLILLCKGCGVLSGVAIPGMERQRTLSS----------SMEEADRPR 310          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Celegans
Match: Y48G10A.3 (pep chromosome:WBcel235:I:13471683:13474185:-1 gene:WBGene00013020.1 transcript:Y48G10A.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y48G10A.3)

HSP 1 Score: 119.783 bits (299), Expect = 4.054e-30
Identity = 94/349 (26.93%), Postives = 158/349 (45.27%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRS-TNEVAILTVHDIGCN-HTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEI-DNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGN 1125
            +NT + G +   I G R+   +V ++T HD+G +  + + +F +  S+   A +   +NV  PGQ ++   LP ++TYPTM  IA  +        ++  I FG G GAN+L R A     R++  VL+NC       VE   +K     L  +GMT  T +YL+ H FG       D     ++  Y+ F +   N  +L  ++ SY+ R+ L      IS+D +   Q                            +K P+L + G+ + + +D       ++   K +P    H ++++I D+C  VL +R D V ES+  FLQG G   +    +M+  ++   N
Sbjct:   29 VNTAF-GAIKVSIYGDRNDPKKVPMVTFHDLGLDSESNFQNFFQFVSIAEFADKFCIYNVNAPGQEMDAQPLPENFTYPTMDGIAKTIESVADHFKLNQFIGFGVGVGANVLLRYAAQNQNRVIALVLVNCCSGKSGWVEWGYEKWNTSYLRKVGMTKFTVDYLMWHHFG----RNYDRCSPDIVRQYRVFFQHLPNPNSLAEFIESYIQRTPL-----PISRDGTTGVQ----------------------------LKVPVLQLVGAGSAHVEDT------VEVNTKLDP---AHADWIKISDSCGLVLDDRPDAVTESMMLFLQGLGYFPTLNVMKMTKKMQETQN 330          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0078674)

HSP 1 Score: 181.415 bits (459), Expect = 8.294e-53
Identity = 113/384 (29.43%), Postives = 185/384 (48.18%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNE--VAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFG-VMNNLESDE-DLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLV-----------------------GSAPSRRMSSTVRPIGNRKISMEEYDNP 1158
            I+T+ CG LT  ++G  S  E     +TVHD+GCNH  + +F+    M  +  R  + +V +PG + N   L   + +P++Q + +DL+  +  L + ++I  GEGAGAN+LAR  ++   R+LG +L+N  GS  ++V+S K+K I WK   +    S E++L+ H+FG VM  +  +  D   ++  Y+K L  + NSKN+  YV ++MNR +L  K                                      C   K  ++ I+G L+ YA  V+ L+ D++         K  +  ++I+   +VL +   +VA+S+  F +GQGL+                       G+  SRR+S        R ISME+YD P
Sbjct:   24 ISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEV--AQSAESFLMYHKFGHVMEQIVGENPDKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLKG-------------------------------------C---KVDVILITGMLSPYASMVEKLHRDVE---------KERVTILKIERAGDVLADAPGKVAQSILLFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLS--------RGISMEDYDKP 348          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0300910)

HSP 1 Score: 181.415 bits (459), Expect = 8.294e-53
Identity = 113/384 (29.43%), Postives = 185/384 (48.18%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNE--VAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFG-VMNNLESDE-DLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLV-----------------------GSAPSRRMSSTVRPIGNRKISMEEYDNP 1158
            I+T+ CG LT  ++G  S  E     +TVHD+GCNH  + +F+    M  +  R  + +V +PG + N   L   + +P++Q + +DL+  +  L + ++I  GEGAGAN+LAR  ++   R+LG +L+N  GS  ++V+S K+K I WK   +    S E++L+ H+FG VM  +  +  D   ++  Y+K L  + NSKN+  YV ++MNR +L  K                                      C   K  ++ I+G L+ YA  V+ L+ D++         K  +  ++I+   +VL +   +VA+S+  F +GQGL+                       G+  SRR+S        R ISME+YD P
Sbjct:   24 ISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEV--AQSAESFLMYHKFGHVMEQIVGENPDKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLKG-------------------------------------C---KVDVILITGMLSPYASMVEKLHRDVE---------KERVTILKIERAGDVLADAPGKVAQSILLFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLS--------RGISMEDYDKP 348          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0300906)

HSP 1 Score: 181.03 bits (458), Expect = 1.396e-52
Identity = 113/384 (29.43%), Postives = 185/384 (48.18%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNE--VAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFG-VMNNLESD-EDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLV-----------------------GSAPSRRMSSTVRPIGNRKISMEEYDNP 1158
            I+T+ CG LT  ++G  S  E     +TVHD+GCNH  + +F+    M  +  R  + +V +PG + N   L   + +P++Q + +DL+  +  L + ++I  GEGAGAN+LAR  ++   R+LG +L+N  GS  ++V+S K+K I WK   +    S E++L+ H+FG VM  +  +  D   ++  Y+K L  + NSKN+  YV ++MNR +L  K                                      C   K  ++ I+G L+ YA  V+ L+ D++         K  +  ++I+   +VL +   +VA+S+  F +GQGL+                       G+  SRR+S        R ISME+YD P
Sbjct:   28 ISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEV--AQSAESFLMYHKFGHVMEQIVGENPDKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLKG-------------------------------------C---KVDVILITGMLSPYASMVEKLHRDVE---------KERVTILKIERAGDVLADAPGKVAQSILLFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLS--------RGISMEDYDKP 352          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0078672)

HSP 1 Score: 179.489 bits (454), Expect = 3.811e-52
Identity = 111/382 (29.06%), Postives = 183/382 (47.91%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNE--VAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLV-----------------------GSAPSRRMSSTVRPIGNRKISMEEYDNP 1158
            I+T+ CG LT  ++G  S  E     +TVHD+GCNH  + +F+    M  +  R  + +V +PG + N   L   + +P++Q + +DL+  +  L + ++I  GEGAGAN+LAR  ++   R+LG +L+N  GS  ++V+S K+K I WK   +    S E++L+ H+FG    +  + D   ++  Y+K L  + NSKN+  YV ++MNR +L  K                                      C   K  ++ I+G L+ YA  V+ L+ D++         K  +  ++I+   +VL +   +VA+S+  F +GQGL+                       G+  SRR+S        R ISME+YD P
Sbjct:   24 ISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEV--AQSAESFLMYHKFG-HQIVGENPDKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLKG-------------------------------------C---KVDVILITGMLSPYASMVEKLHRDVE---------KERVTILKIERAGDVLADAPGKVAQSILLFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLS--------RGISMEDYDKP 345          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Fly
Match: CG2082 (gene:FBgn0027608 transcript:FBtr0300909)

HSP 1 Score: 179.489 bits (454), Expect = 3.811e-52
Identity = 111/382 (29.06%), Postives = 183/382 (47.91%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNE--VAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLV-----------------------GSAPSRRMSSTVRPIGNRKISMEEYDNP 1158
            I+T+ CG LT  ++G  S  E     +TVHD+GCNH  + +F+    M  +  R  + +V +PG + N   L   + +P++Q + +DL+  +  L + ++I  GEGAGAN+LAR  ++   R+LG +L+N  GS  ++V+S K+K I WK   +    S E++L+ H+FG    +  + D   ++  Y+K L  + NSKN+  YV ++MNR +L  K                                      C   K  ++ I+G L+ YA  V+ L+ D++         K  +  ++I+   +VL +   +VA+S+  F +GQGL+                       G+  SRR+S        R ISME+YD P
Sbjct:   24 ISTEKCGDLTVIVQGDLSQQEKRAVFITVHDLGCNHNSFQEFVSSPCMTEIKERSCFIHVDVPGHADNAEALADGFPFPSLQSLGEDLVTVLDYLHVKYVIGLGEGAGANVLARFGLAHPSRVLGLILINATGSAASVVQSFKNKFISWKSDEV--AQSAESFLMYHKFG-HQIVGENPDKEKIVAEYQKRLHRSLNSKNIGLYVKAFMNRKDLTLKG-------------------------------------C---KVDVILITGMLSPYASMVEKLHRDVE---------KERVTILKIERAGDVLADAPGKVAQSILLFCKGQGLLTSVVMPGVDRGRAFSTASSGSLEGANGSRRLS--------RGISMEDYDKP 345          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Zebrafish
Match: ndrg1b (N-myc downstream regulated 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1648])

HSP 1 Score: 110.153 bits (274), Expect = 2.277e-26
Identity = 86/337 (25.52%), Postives = 144/337 (42.73%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            G++   ++G    N   ILT HDIG NH   +     H  M  +       +V  PGQ      L +DYTYP+M Q+++ L   +    +  +I  G GAGANILAR A+   + + G VL+N        ++    KI  W       T +  + ++ H FG   + NN E       +I  +++ + +  N  NL  +V SY +R +L                E ++ V+ G                  T++CP L I G  +   D V      +    +  P       F+++ +C  +  V++  ++ E+ +YF+QG G + SA   R++
Sbjct:   25 GRVHCTMKGVPKGNRPTILTFHDIGLNHKSCFESMFHHKDMHEILQHFAVCHVDAPGQQEGASTLSTDYTYPSMDQLSESLPMVLNHFGLKSVIGMGVGAGANILARFALKHPDMVEGLVLINMSTQAEGFMDWAAQKITSW-------THALPDTVISHLFGKEEIHNNHE-------LIATFRQLITNNINQSNLQQFVKSYKSRKDL----------------EIERPVQGGNV-------------NTKTLQCPALLIVGDNSPAVDAV------VDSNSRMNPTT---TTFLKMADCGGLPQVDQPGKLIEAFKYFIQGMGYMPSASMTRLA 309          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Zebrafish
Match: ndrg4 (NDRG family member 4 [Source:ZFIN;Acc:ZDB-GENE-060512-226])

HSP 1 Score: 107.457 bits (267), Expect = 1.563e-25
Identity = 90/348 (25.86%), Postives = 150/348 (43.10%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRP 1116
            I T Y G L   I G    N+ AILT HD+G NH   +  F ++  M  +    V  +V  PGQ +  P +P  Y YPTM Q+A  L   +       ++  G GAGA ILA+ A+   + + G VLLN        ++      I W  + + G+TS+  + ++ H F    +M+N E       ++ NY++ + +T N  NL  +   Y +R +L    M  S  + +++                            T++CP++ + G  A   + V      ++   K +P     ++    D+     + +  ++ E+ +YFLQG G +     RRMS    P
Sbjct:   11 IETPY-GMLHVVIRGAPKGNKPAILTYHDVGLNHKLCFNSFFQNEDMLEITKHFVVCHVDAPGQHIGAPQMPQGYQYPTMDQLAGMLPSVVQHFGFKSIVGIGVGAGAYILAKFALIFPDLVEGLVLLN--------IDPNGKGWIDWAATKLSGLTSTLPDTVLTHLFSQEELMSNTE-------VVQNYRQQINNTINQFNLQLFWNMYNSRRDL---EMNRSGSVINAK----------------------------TLRCPVMLVVGDNAPAEEGV------VECNSKLDPTNTTFLKM--ADSGGMPQITQPGKLTEAFKYFLQGMGYIAYMKDRRMSGGPVP 303          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Zebrafish
Match: ndrg4 (NDRG family member 4 [Source:ZFIN;Acc:ZDB-GENE-060512-226])

HSP 1 Score: 103.99 bits (258), Expect = 2.395e-24
Identity = 88/343 (25.66%), Postives = 150/343 (43.73%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            I T Y G L   I G    N+ AILT HD+G NH   +  F ++  M  +    V  +V  PGQ +  P +P  Y YPTM Q+A  L   +       ++  G GAGA ILA+ A+   + + G VLLN        ++      I W  + + G+TS+  + ++ H F    +M+N E       ++ NY++ + +T N  NL  +   Y +R +L    M  S  + +++                            T++CP++ + G  A   + V      ++   K +P     ++    D+     + +  ++ E+ +YFLQG G + SA   R++
Sbjct:   11 IETPY-GMLHVVIRGAPKGNKPAILTYHDVGLNHKLCFNSFFQNEDMLEITKHFVVCHVDAPGQHIGAPQMPQGYQYPTMDQLAGMLPSVVQHFGFKSIVGIGVGAGAYILAKFALIFPDLVEGLVLLN--------IDPNGKGWIDWAATKLSGLTSTLPDTVLTHLFSQEELMSNTE-------VVQNYRQQINNTINQFNLQLFWNMYNSRRDL---EMNRSGSVINAK----------------------------TLRCPVMLVVGDNAPAEEGV------VECNSKLDPTNTTFLKM--ADSGGMPQITQPGKLTEAFKYFLQGMGYMPSASMTRLA 298          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Zebrafish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 100.908 bits (250), Expect = 5.171e-23
Identity = 85/335 (25.37%), Postives = 138/335 (41.19%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFL-KHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADD-VKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            G L   + GT   N   ILT HDIG NH    + L     M+ +       +V  PGQ  + P  P+ + YPTM ++A+ L   +  L I+ +I  G GAGA IL R A++    + G VL+N        ++    K+ GW       TS+  + ++ H F      E+ E    +I  Y+  +    N  NL  +  SY +R +L                            E+E        +   T+KCP L I G  +   +  V+C          N          +++ +C  +  V +  ++AE+ +YF+QG G + +A   R++
Sbjct:   40 GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQESAPPFPTGFLYPTMDELAEMLPSVLTHLKINSVIGIGVGAGAYILTRFALNEPALVEGLVLINVDPCAKGWIDWAASKLSGW-------TSNLIDIVMAHHFSTDELTENQE----IIQTYRLHIAQDINQDNLALFCQSYNSRRDL----------------------------EIERPVLGMNENAVKTLKCPALLIVGDTSPAVEAVVEC----------NSRLNPTKTTLLKMADCGGLPQVVQPGKLAEAFKYFVQGMGYMPTASMTRLA 325          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Zebrafish
Match: ndrg3b (ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5606])

HSP 1 Score: 100.908 bits (250), Expect = 5.171e-23
Identity = 85/335 (25.37%), Postives = 138/335 (41.19%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFL-KHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADD-VKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            G L   + GT   N   ILT HDIG NH    + L     M+ +       +V  PGQ  + P  P+ + YPTM ++A+ L   +  L I+ +I  G GAGA IL R A++    + G VL+N        ++    K+ GW       TS+  + ++ H F      E+ E    +I  Y+  +    N  NL  +  SY +R +L                            E+E        +   T+KCP L I G  +   +  V+C          N          +++ +C  +  V +  ++AE+ +YF+QG G + +A   R++
Sbjct:   40 GVLHVTLRGTPKGNRPVILTYHDIGLNHKSCFNTLFNFEDMQEITQHFAVVHVDAPGQQESAPPFPTGFLYPTMDELAEMLPSVLTHLKINSVIGIGVGAGAYILTRFALNEPALVEGLVLINVDPCAKGWIDWAASKLSGW-------TSNLIDIVMAHHFSTDELTENQE----IIQTYRLHIAQDINQDNLALFCQSYNSRRDL----------------------------EIERPVLGMNENAVKTLKCPALLIVGDTSPAVEAVVEC----------NSRLNPTKTTLLKMADCGGLPQVVQPGKLAEAFKYFVQGMGYMPTASMTRLA 325          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Xenopus
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:448335])

HSP 1 Score: 107.842 bits (268), Expect = 3.735e-25
Identity = 96/347 (27.67%), Postives = 145/347 (41.79%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTV 1110
            I T Y G L   I GT   N  AILT HD+G NH   +  F  +  M+ +    V  +V  PGQ V     P  Y YPTM+Q+A  L   +       +I  G GAGA +LA+ A+   E + G VL+N     PN         I W  S + G+TSS    ++ H F    +MNN E       ++ NY++ +    N  NL  +   Y +R +L                            EM   +R        T++ P++ + G  A   D   C+ E       N      +  F+++ +   +  V +  ++ E+ +YFLQG G + S   RR S++ 
Sbjct:   62 IETPY-GMLHVVIRGTPKGNRPAILTYHDVGLNHKLCFNTFFNYEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQYPTMEQLAAMLPSVMQHFGFQSIIGIGVGAGAYVLAKFALIFPELVEGMVLVNI---DPN-----GKGWIDWAASKLSGLTSSLPETVLSHLFSQEELMNNTE-------LVQNYRQQISSCVNQSNLQLFWNMYNSRRDL----------------------------EM---SRPGTVPNAKTLRAPVMLVVGDNAPAED---CVVE------CNSKLDPTNTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIASLKDRRQSASA 352          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Xenopus
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:448335])

HSP 1 Score: 107.842 bits (268), Expect = 3.785e-25
Identity = 96/347 (27.67%), Postives = 145/347 (41.79%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTV 1110
            I T Y G L   I GT   N  AILT HD+G NH   +  F  +  M+ +    V  +V  PGQ V     P  Y YPTM+Q+A  L   +       +I  G GAGA +LA+ A+   E + G VL+N     PN         I W  S + G+TSS    ++ H F    +MNN E       ++ NY++ +    N  NL  +   Y +R +L                            EM   +R        T++ P++ + G  A   D   C+ E       N      +  F+++ +   +  V +  ++ E+ +YFLQG G + S   RR S++ 
Sbjct:   64 IETPY-GMLHVVIRGTPKGNRPAILTYHDVGLNHKLCFNTFFNYEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQYPTMEQLAAMLPSVMQHFGFQSIIGIGVGAGAYVLAKFALIFPELVEGMVLVNI---DPN-----GKGWIDWAASKLSGLTSSLPETVLSHLFSQEELMNNTE-------LVQNYRQQISSCVNQSNLQLFWNMYNSRRDL----------------------------EM---SRPGTVPNAKTLRAPVMLVVGDNAPAED---CVVE------CNSKLDPTNTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYIASLKDRRQSASA 354          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Xenopus
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:448335])

HSP 1 Score: 104.375 bits (259), Expect = 2.891e-24
Identity = 93/344 (27.03%), Postives = 144/344 (41.86%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYID-FLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVL-VERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            I T Y G L   I GT   N  AILT HD+G NH    + F  +  M+ +    V  +V  PGQ V     P  Y YPTM+Q+A  L   +       +I  G GAGA +LA+ A+   E + G VL+N        ++      I W  S + G+TSS    ++ H F    +MNN E       ++ NY++ +    N  NL  +   Y +R +L                            EM   +R        T++ P++ + G  A   D   C+ E       N      +  F+++ +   +  V +  ++ E+ +YFLQG G + SA   R++
Sbjct:   11 IETPY-GMLHVVIRGTPKGNRPAILTYHDVGLNHKLCFNTFFNYEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQYPTMEQLAAMLPSVMQHFGFQSIIGIGVGAGAYVLAKFALIFPELVEGMVLVN--------IDPNGKGWIDWAASKLSGLTSSLPETVLSHLFSQEELMNNTE-------LVQNYRQQISSCVNQSNLQLFWNMYNSRRDL----------------------------EM---SRPGTVPNAKTLRAPVMLVVGDNAPAED---CVVE------CNSKLDPTNTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLA 298          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Xenopus
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:448335])

HSP 1 Score: 104.375 bits (259), Expect = 4.631e-24
Identity = 95/344 (27.62%), Postives = 144/344 (41.86%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYID-FLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            I T Y G L   I GT   N  AILT HD+G NH    + F  +  M+ +    V  +V  PGQ V     P  Y YPTM+Q+A  L   +       +I  G GAGA +LA+ A+   E + G VL+N     PN         I W  S + G+TSS    ++ H F    +MNN E       ++ NY++ +    N  NL  +   Y +R +L                            EM   +R        T++ P++ + G  A   D   C+ E       N      +  F+++ +   +  V +  ++ E+ +YFLQG G + SA   R++
Sbjct:   62 IETPY-GMLHVVIRGTPKGNRPAILTYHDVGLNHKLCFNTFFNYEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQYPTMEQLAAMLPSVMQHFGFQSIIGIGVGAGAYVLAKFALIFPELVEGMVLVNI---DPN-----GKGWIDWAASKLSGLTSSLPETVLSHLFSQEELMNNTE-------LVQNYRQQISSCVNQSNLQLFWNMYNSRRDL----------------------------EM---SRPGTVPNAKTLRAPVMLVVGDNAPAED---CVVE------CNSKLDPTNTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLA 349          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Xenopus
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:448335])

HSP 1 Score: 100.908 bits (250), Expect = 8.104e-23
Identity = 90/343 (26.24%), Postives = 136/343 (39.65%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYID-FLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            I T Y G L   I GT   N  AILT HD+G NH    + F  +  M+ +    V  +V  PGQ V     P  Y YPTM+Q+A  L   +       +I  G GAGA +LA+ A+   E + G VL+N        ++      I W  S + G+TSS    ++ H F    +MNN E       ++ NY++ +    N  NL  +   Y +R +L                            EM   +R        T++ P++ + G                     N P     +E     +  N    +  ++ E+ +YFLQG G + SA   R++
Sbjct:   68 IETPY-GMLHVVIRGTPKGNRPAILTYHDVGLNHKLCFNTFFNYEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQYPTMEQLAAMLPSVMQHFGFQSIIGIGVGAGAYVLAKFALIFPELVEGMVLVN--------IDPNGKGWIDWAASKLSGLTSSLPETVLSHLFSQEELMNNTE-------LVQNYRQQISSCVNQSNLQLFWNMYNSRRDL----------------------------EM---SRPGTVPNAKTLRAPVMLVVG--------------------DNAPAEDCVVECNSKLDPTNTTFLKPGKLTEAFKYFLQGMGYMPSASMTRLA 343          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Mouse
Match: Ndrg1 (N-myc downstream regulated gene 1 [Source:MGI Symbol;Acc:MGI:1341799])

HSP 1 Score: 115.931 bits (289), Expect = 3.647e-28
Identity = 96/389 (24.68%), Postives = 167/389 (42.93%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNH-TQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISME-------EYDNPKGASNITYNPKRKYSESEN*KIILLP 1236
            G L   + GT   N   ILT HDIG NH T Y        M+ +       +V  PGQ    P  P  Y YP+M Q+A+ L   +    +  +I  G GAGA IL R A++  E + G VL+N        ++    KI GW       T +  + +V H FG   + NN+E       +++ Y++ + +  N  NLH ++++Y +R                              R++E E R    +   T++CP L + G  +   D V      ++   K +P +      +++ +C  +  + +  ++AE+ +YF+QG G + SA   R+  +    G+   S+E         + P+  S+ +   + +   SE+ ++ + P
Sbjct:   42 GSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHQFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKISGW-------TQALPDMVVSHLFGKEEIHNNVE-------VVHTYRQHILNDMNPSNLHLFISAYNSR------------------------------RDLEIE-RPMPGTHTVTLQCPALLVVGDNSPAVDAV------VECNSKLDPTK---TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLEGTRSRSHTSEGPRSRSHTSEGSRSRSHTSEDARLNITP 376          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Mouse
Match: Ndrg3 (N-myc downstream regulated gene 3 [Source:MGI Symbol;Acc:MGI:1352499])

HSP 1 Score: 105.145 bits (261), Expect = 1.887e-24
Identity = 86/335 (25.67%), Postives = 146/335 (43.58%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYID-FLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            G +   I G    N   ILT HDIG NH    + F     M+ +       +V  PGQ    P  P+ Y YPTM ++A+ L   +  LS+  +I  G GAGA IL+R A++  E + G VL+N        ++      I W  S + G T++  + ++ H FG    L+++ DL   I  Y+  +    N +NL  ++ SY  R +L                            E+E     +  ++  T+KC  L + G      D+   +   ++   + +P    +   +++ +C  +  V +  ++ E+ +YFLQG G + SA   R++
Sbjct:   40 GMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLIN--------IDPCAKGWIDWAASKLSGFTTNIVDIILAHHFG-QEELQANLDL---IQTYRLHIAQDINQENLQLFLGSYNGRRDL----------------------------EIERPILGQNDNRLKTLKCSTLLVVG------DNSPAVEAVVECNSRLDP---INTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLA 325          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Mouse
Match: Ndrg2 (N-myc downstream regulated gene 2 [Source:MGI Symbol;Acc:MGI:1352498])

HSP 1 Score: 104.375 bits (259), Expect = 3.430e-24
Identity = 92/349 (26.36%), Postives = 155/349 (44.41%), Query Frame = 1
Query:   70 QTKMTTINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECI-GILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDL---STMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            Q +  ++ T Y G +TF + GT      AI T HD+G N+   +    +   M+ +    V  +V  PG     P  P  Y YP++ Q+A D+I CI   L+ S +I  G GAGA IL+R A++  + + G VL+N   +    ++    K+        G+TSS  + ++ H F       S E+L   S +I  Y+  ++   N +N+  Y  SY NR +L                      ++G       ET         T+KCP++ + G  A + D V      ++   K +P +   ++    D+     + +  ++ E+ +YFLQG G + S+   R+S
Sbjct:   37 QGQTHSVETPY-GSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLA-DMIPCILQYLNFSTIIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKL-------TGLTSSIPDMILGHLF-------SQEELSGNSELIQKYRGIIQHAPNLENIELYWNSYNNRRDL--------------------NFERG------GET---------TLKCPVMLVVGDQAPHEDAV------VECNSKLDPTQTSFLKMA--DSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLS 326          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Mouse
Match: Ndrg2 (N-myc downstream regulated gene 2 [Source:MGI Symbol;Acc:MGI:1352498])

HSP 1 Score: 103.99 bits (258), Expect = 3.768e-24
Identity = 92/348 (26.44%), Postives = 154/348 (44.25%), Query Frame = 1
Query:   73 TKMTTINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECI-GILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDL---STMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
             K  ++ T Y G +TF + GT      AI T HD+G N+   +    +   M+ +    V  +V  PG     P  P  Y YP++ Q+A D+I CI   L+ S +I  G GAGA IL+R A++  + + G VL+N   +    ++    K+        G+TSS  + ++ H F       S E+L   S +I  Y+  ++   N +N+  Y  SY NR +L                      ++G       ET         T+KCP++ + G  A + D V      ++   K +P +   ++    D+     + +  ++ E+ +YFLQG G + S+   R+S
Sbjct:   24 AKTHSVETPY-GSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLA-DMIPCILQYLNFSTIIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKL-------TGLTSSIPDMILGHLF-------SQEELSGNSELIQKYRGIIQHAPNLENIELYWNSYNNRRDL--------------------NFERG------GET---------TLKCPVMLVVGDQAPHEDAV------VECNSKLDPTQTSFLKMA--DSGGQPQLTQPGKLTEAFKYFLQGMGYMASSCMTRLS 312          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Mouse
Match: Ndrg3 (N-myc downstream regulated gene 3 [Source:MGI Symbol;Acc:MGI:1352499])

HSP 1 Score: 101.679 bits (252), Expect = 3.378e-23
Identity = 86/340 (25.29%), Postives = 145/340 (42.65%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYID-FLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRP 1116
            G +   I G    N   ILT HDIG NH    + F     M+ +       +V  PGQ    P  P+ Y YPTM ++A+ L   +  LS+  +I  G GAGA IL+R A++  E + G VL+N        ++      I W  S + G T++  + ++ H FG    L+++ DL   I  Y+  +    N +NL  ++ SY  R +L                            E+E     +  ++  T+KC  L + G      D+   +   ++   + +P    +   +++ +C  +  V +  ++ E+ +YFLQG G +       +SS   P
Sbjct:   40 GMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLIN--------IDPCAKGWIDWAASKLSGFTTNIVDIILAHHFG-QEELQANLDL---IQTYRLHIAQDINQENLQLFLGSYNGRRDL----------------------------EIERPILGQNDNRLKTLKCSTLLVVG------DNSPAVEAVVECNSRLDP---INTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPYVQLSHLSSESVP 330          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. UniProt/SwissProt
Match: sp|O02485|YDJ1_CAEEL (Uncharacterized protein ZK1073.1 OS=Caenorhabditis elegans OX=6239 GN=ZK1073.1 PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 6.782e-41
Identity = 105/370 (28.38%), Postives = 168/370 (45.41%), Query Frame = 1
Query:   76 KMTTINTKYCGKLTFYIEGT--RSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLV------GSAPSRRMSSTVRPIGNRKISMEEYDNPK 1161
            +M  +  + CG L  Y++G       +  ILTVHDIG NH  ++ F+ H SM T+  + ++ +V +PGQ  N  D   D+  PT+  I DDL   +    +   I FGEG GANI+ R AM    RI+G VL++C  +T  ++E  K+K++  +L    M+    +YL+ H+FG           S     Y + L+ T N KNL  Y+ ++  R++L   + TI                                +K  T+    L ++GS A++   V   ++ +          K+    + +DN A+V+ E  D++A SL    +G G++      G    R +SS          SMEE D P+
Sbjct:    7 QMVVVQAQNCGVLHVYVQGNLEERGGKTIILTVHDIGTNHKSFVRFVNHPSMATVKEKAIFLHVCVPGQEDNSADFFGDF--PTLDGIGDDLSAVLDKFEVKSAIAFGEGVGANIICRFAMGHPNRIMGIVLVHCTSTTAGIIEYCKEKVMNMRLENSIMSDGAWDYLLAHKFG---------GESKSRQEYLEELKATLNPKNLSKYLVAFTKRTDL---SSTI-------------------------------GTKLETVDA--LLVTGSKASHLHTVYTTHKSMN---------KKKTTLLVVDNVADVMQEAPDKLARSLILLCKGCGVLSGVAIPGMERQRTLSS----------SMEEADRPR 310          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. UniProt/SwissProt
Match: sp|Q62433|NDRG1_MOUSE (Protein NDRG1 OS=Mus musculus OX=10090 GN=Ndrg1 PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.551e-27
Identity = 96/389 (24.68%), Postives = 167/389 (42.93%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNH-TQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISME-------EYDNPKGASNITYNPKRKYSESEN*KIILLP 1236
            G L   + GT   N   ILT HDIG NH T Y        M+ +       +V  PGQ    P  P  Y YP+M Q+A+ L   +    +  +I  G GAGA IL R A++  E + G VL+N        ++    KI GW       T +  + +V H FG   + NN+E       +++ Y++ + +  N  NLH ++++Y +R                              R++E E R    +   T++CP L + G  +   D V      ++   K +P +      +++ +C  +  + +  ++AE+ +YF+QG G + SA   R+  +    G+   S+E         + P+  S+ +   + +   SE+ ++ + P
Sbjct:   42 GSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHQFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKISGW-------TQALPDMVVSHLFGKEEIHNNVE-------VVHTYRQHILNDMNPSNLHLFISAYNSR------------------------------RDLEIE-RPMPGTHTVTLQCPALLVVGDNSPAVDAV------VECNSKLDPTK---TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLEGTRSRSHTSEGPRSRSHTSEGSRSRSHTSEDARLNITP 376          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. UniProt/SwissProt
Match: sp|Q6JE36|NDRG1_RAT (Protein NDRG1 OS=Rattus norvegicus OX=10116 GN=Ndrg1 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.239e-26
Identity = 95/389 (24.42%), Postives = 167/389 (42.93%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNH-TQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISME-------EYDNPKGASNITYNPKRKYSESEN*KIILLP 1236
            G L   + GT   N   ILT HDIG NH T Y        M+ +       +V  PGQ    P  P  Y YP+M Q+A+ L   +    +  +I  G GAGA IL R A++  E + G VL+N        ++    KI GW       T +  + +V H FG   + +N+E       +++ Y++ + +  N  NLH ++++Y +R                              R++E E R    +   T++CP L + G  +   D V      ++   K +P +      +++ +C  +  + +  ++AE+ +YF+QG G + SA   R+  +    G+   S+E         + P+  S+ +   + +   SE+ ++ + P
Sbjct:   42 GSLHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNSEDMQEITQHFAVCHVDAPGQQDGAPSFPVGYMYPSMDQLAEMLPGVLHKFGLKSVIGMGTGAGAYILTRFALNNPEMVEGLVLMNVNPCAEGWMDWAASKISGW-------TQALPDMVVSHLFGKEEIHSNVE-------VVHTYRQHILNDMNPSNLHLFISAYNSR------------------------------RDLEIE-RPMPGTHTVTLQCPALLVVGDNSPAVDAV------VECNSKLDPTK---TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLEGTRSRSHTSEGPRSRSHTSEGSRSRSHTSEDARLNITP 376          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. UniProt/SwissProt
Match: sp|Q5RA95|NDRG3_PONAB (Protein NDRG3 OS=Pongo abelii OX=9601 GN=NDRG3 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 4.093e-25
Identity = 89/336 (26.49%), Postives = 144/336 (42.86%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYID-FLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADD-VKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            G +   I G    N   ILT HDIG NH    + F     M+ +       +V  PGQ    P  P+ Y YPTM ++A+ L   +  LS+  +I  G GAGA IL+R A++  E + G VL+N        V+      I W  S + G+T++  + ++ H FG    L+++ DL   I  Y+  +    N  NL  ++ SY  R +L                            E+E     +  +K  T+KC  L + G  +   +  V+C          N      +   +++ +C  +  V +  ++ E+ +YFLQG G + SA   R++
Sbjct:   40 GMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAGAYILSRFALNHPELVEGLVLIN--------VDPCAKGWIDWAASKLSGLTTNVVDIILAHHFG-QEELQANPDL---IQTYRMHIAQDINQDNLQLFLNSYNGRRDL----------------------------EIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVEC----------NSRLNPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLA 325          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. UniProt/SwissProt
Match: sp|Q9UGV2|NDRG3_HUMAN (Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=1 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 1.014e-24
Identity = 89/336 (26.49%), Postives = 144/336 (42.86%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYID-FLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADD-VKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            G +   I G    N   ILT HDIG NH    + F     M+ +       +V  PGQ    P  P+ Y YPTM ++A+ L   +  LS+  +I  G GAGA IL+R A++  E + G VL+N        V+      I W  S + G+T++  + ++ H FG    L+++ DL   I  Y+  +    N  NL  ++ SY  R +L                            E+E     +  +K  T+KC  L + G  +   +  V+C          N      +   +++ +C  +  V +  ++ E+ +YFLQG G + SA   R++
Sbjct:   40 GVVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEMLPPVLTHLSLKSIIGIGVGAGAYILSRFALNHPELVEGLVLIN--------VDPCAKGWIDWAASKLSGLTTNVVDIILAHHFG-QEELQANLDL---IQTYRMHIAQDINQDNLQLFLNSYNGRRDL----------------------------EIERPILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVEC----------NSRLNPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLA 325          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. TrEMBL
Match: C7TZF8 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 GN=EWB00_003869 PE=2 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 1.508e-105
Identity = 157/375 (41.87%), Postives = 238/375 (63.47%), Query Frame = 1
Query:   85 TINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYDNPKGASNITYNPKRKYSES 1209
             ++T+ CGKL  +++G R+TN VA LTVHD+GCNH + + FL H SME LA RC W +V +PGQ   + DLP DYT+P++QQ+A+ + E    L + H++VFGEGAGANIL R+ M   + +LGAVL++C G+T  L ESL+D++IGWKL+T+GM  + E+YL++HRFG   + E + +L  ++  +++ LR   N +NL+ Y+ S+M+R+ +++    + Q                                   I+CP+L ++G+LA++   V  LY  +   ++N+P  +  +E ++IDN ANVL E+ ++VA+ LQYF+QG GL G   +RRMSST+    NR +SMEEYD PKGASN  ++  RKYS +
Sbjct:    8 VVDTESCGKLNVFMQGPRNTN-VAFLTVHDLGCNHNEMVHFLAHESMEPLANRCTWIHVDVPGQGDGESDLPPDYTFPSVQQLAEGMSEVCNALRLQHIVVFGEGAGANILVRLVMLRYDLVLGAVLIHCTGTTAGLSESLRDRLIGWKLNTVGMNPAAESYLLMHRFGSAADAEDEVELREVLVKFRQSLRTAINPRNLNKYIMSFMSRTKILEH---VDQ-----------------------------------IRCPVLLLTGTLASHNHTVLRLYNALLSAVRNDPILQGKVELVQIDNVANVLSEQPEKVADCLQYFIQGLGLAGGLVNRRMSSTIPVARNRSLSMEEYDQPKGASNCIFHKNRKYSTT 343          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. TrEMBL
Match: A0A3Q0KUE1 (Family S33 non-peptidase homologue (S33 family) OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 3.189e-105
Identity = 153/375 (40.80%), Postives = 240/375 (64.00%), Query Frame = 1
Query:   85 TINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYDNPKGASNITYNPKRKYSES 1209
             +NT+ CGK+  +I+G R+T +VA LTVHD+GCNH + ++FL H SME L  RC W +V +PGQ   + DLP+DYT+P++QQ+A+ + E    L + +++VFGEGAGANIL R+ M   + +LGAVL++C G+T  L E+L+D++IGWKL+T+GM  + E+YL++HRFG   + E + ++  ++  +++ LR   N +NL+ ++ S+M+R+ +++                                          I+CP+LF++G+LA++   V  LY  +   ++N+P+ +  +E +++DN ANVL E+ ++VAESLQ+F+QG GL G   SRRMSST+    NR +SMEEYD PKGASN  ++  RKYS +
Sbjct:    8 VVNTESCGKINVFIQGPRNT-KVAFLTVHDLGCNHNEIVNFLAHESMEPLVNRCTWVHVDVPGQGDGESDLPADYTFPSVQQLAEGMSEVCNALRLQYVVVFGEGAGANILVRLVMLRYDIVLGAVLIHCTGTTAGLSENLRDRLIGWKLNTVGMNPAAESYLLMHRFGSAADSEDEVEVREVLIKFRQSLRTAINPRNLNKFIMSFMSRTKILE--------------------------------------HVDQIRCPVLFLTGALASHNHTVFRLYNAVLSAVRNDPNLQGKVELIQLDNVANVLSEQPEKVAESLQFFIQGLGLAGGLVSRRMSSTIPVARNRSLSMEEYDQPKGASNCIFHKNRKYSTT 343          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. TrEMBL
Match: A0A0R3SRI5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7785 PE=4 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 3.758e-101
Identity = 156/376 (41.49%), Postives = 229/376 (60.90%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSST--VRPIGNRKISMEEYDNPKGASNITYNPKRKYSES 1209
            + TK CG LT Y+ G R   +VA LTVHD+GCN  ++ DF+ H  M  L  R  W ++ +PGQ  NDPDLP+++ +PTMQ+IA+ + E    L + H++V GEGAGANI+AR+AM   +  LGA+L++C G+T   +ESL+D++  WKL++IGM  S ENYL++HRFG+  N  ++ +L T   N+   LR+  N KNL+ ++ ++M   N + +   I   I  SR      +                      +KCP+LFI+GSLA++   V  LY  +   LK+EP RK ++E +EID  ANV+ ER ++VAE +Q F+QG G+   A +RR+SST  V    NR  SM+EYD P G  N+ Y+  R+YS++
Sbjct:   11 VETKSCGPLTAYLHGGRVGKDVAALTVHDLGCNFKEFFDFVNHEHMSQLTQRVFWIHIEVPGQGDNDPDLPAEWKFPTMQKIAEGIAELCDSLELKHVVVIGEGAGANIVARVAMLRGDICLGAILIHCTGTTAGFMESLRDRMNAWKLNSIGMNPSVENYLMLHRFGIFVNASTEAELRTATRNFLHSLRENINPKNLNKFIQAFMVYPNFMKRKNLIKILIYFSRTNITDSIG--------------------NLKCPVLFITGSLASFNHTVYTLYNALMNSLKDEPARKANVEILEIDGVANVMRERPEKVAECVQNFMQGLGVASGAVNRRLSSTGSVPRNRNRSASMDEYDQPIGVKNLIYDNARRYSKA 366          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. TrEMBL
Match: A0A0R3UIC1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7164 PE=4 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 7.917e-101
Identity = 153/380 (40.26%), Postives = 232/380 (61.05%), Query Frame = 1
Query:   76 KMTTINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSST--VRPIGNRKISMEEYDNPKGASNITYNPKRKYSES 1209
            K   ++TK CG LT Y+ G R   +VA LTVHD+GCNH ++ +F+ H  M  L  RC W +V +PGQ  N PDLPSD+ +PTMQ+I++ + E    L + H++V G+GAGANI+AR A++ ++  LGA+L++C G+T   +ESL+D++  WKL +IGM  S ENYLV+HRFGV     ++ +L   I ++ + LR+  N KNL+ ++ ++M R+N       I++ I +                               +KCP+LFI+GSLA++   V  LY  +   LK+ P R+  +E +EID  ANV+ ER ++VAES+Q F+QG G+ G A +RR+S+T  +    NR  SM+EYD P G  N+ ++  R+YS++
Sbjct:    5 KKIVVDTKACGPLTAYLHGGRVGKDVAALTVHDLGCNHKEFYEFVNHEHMSQLTQRCFWIHVEVPGQGDNMPDLPSDWKFPTMQKISEGISELCDSLELKHVVVIGDGAGANIVARFAIAREDICLGAILIHCTGTTAGFMESLRDRVNAWKLKSIGMNPSVENYLVLHRFGVFKKATTEAELHGAIKSFLQSLREDINPKNLNKFIQAFMERTN-------ITETIGN-------------------------------LKCPVLFITGSLASFNHTVYTLYNALLNSLKDNPARRADVEILEIDGVANVMRERPERVAESVQNFMQGLGIAGGAINRRLSATGNIPRNRNRSASMDEYDQPVGVKNLIFDTTRRYSKA 346          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. TrEMBL
Match: Q86EV0 (Clone ZZD1393 mRNA sequence OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.992e-100
Identity = 152/362 (41.99%), Postives = 229/362 (63.26%), Query Frame = 1
Query:  124 IEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYDNPKGASNITYNPKRKYSES 1209
            ++G R+TN VA LTVHD+GCNH + + FL H SME LA RC W +V +PGQ   + DLP DYT+P++QQ+A+ + E    L + H++VFGEGAGANIL R+ M   + +LGAVL++C G+T  L ESL+D++IGWKL+T+GM  + E+YL++HRFG   + E + +L  ++  +++ LR   N +NL+ Y+ S+M+R+ +++    + Q                                   I+CP+L ++G+LA++   V  LY  +   ++N+P  +  +E ++IDN ANVL E+ ++VA+ LQYF+QG GL G   +RRMSST+    NR +SMEEYD PKGASN  ++  RKYS +
Sbjct:    1 MQGPRNTN-VAFLTVHDLGCNHNEMVHFLAHESMEPLANRCTWIHVDVPGQGDGESDLPPDYTFPSVQQLAEGMSEVCNALRLQHIVVFGEGAGANILVRLVMLRYDLVLGAVLIHCTGTTAGLSESLRDRLIGWKLNTVGMNPAAESYLLMHRFGSAADAEDEVELREVLVKFRQSLRTAINPRNLNKYIMSFMSRTKILEH---VDQ-----------------------------------IRCPVLLLTGTLASHNHTVLRLYNALLSAVRNDPILQGKVELVQIDNVANVLSEQPEKVADCLQYFIQGLGLAGGLVNRRMSSTIPVARNRSLSMEEYDQPKGASNCIFHKNRKYSTT 323          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Cavefish
Match: ndrg1b (protein NDRG1 [Source:NCBI gene;Acc:103037827])

HSP 1 Score: 112.464 bits (280), Expect = 4.011e-27
Identity = 96/372 (25.81%), Postives = 162/372 (43.55%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFL-KHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYDNPKGASNITYNPKRKYSESE 1212
            G +   + G    N   ILT HDIG NH    D L  H  M+ +       +V  PGQ      LP+ +TYP+M Q+A+ L   +   +I+ ++    GAGA ILAR A++  + + G VL+N        + +  +  + W    + G+  ++   ++ H FG    ++++ DL   I  ++  +  + N  NL  +V SY +R NL         DI          VK                    T+KCP L + G  +   D V      +    +  P +     F+++ +C  +  V++  ++AE+L+YF+QG G + SA   R+S +    G    SME   N   +   T + +R  S ++
Sbjct:   26 GTVHCTLTGVVRENRPVILTYHDIGLNHKTCFDTLFSHEDMQEITRHFAVCHVNAPGQQEGASTLPTGFTYPSMDQLAETLPIVLKHFNITSIVGLAIGAGAYILARFALNHPDLVEGLVLIN--------INAQAEGWMDWAAHKLSGLAHASPEIVISHLFG-KEEIQNNHDL---IATFRHHITTSINQTNLQQFVKSYNSRRNL---------DIERPAPTGNANVK--------------------TLKCPALLVVGDSSPAVDAV------VDCNSRMNPTKT---TFLKMADCGGLPQVDQPAKLAEALKYFIQGLGYMSSAGMTRLSRSRTTSGTSVSSMEASRNRTRSRAHTGDEQRGRSHTD 347          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Cavefish
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:103041944])

HSP 1 Score: 107.071 bits (266), Expect = 1.940e-25
Identity = 90/348 (25.86%), Postives = 153/348 (43.97%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSS-METLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRP 1116
            I+T Y G L   I G    N+ AILT HD+G NH    + L H+  M+ +    V  +V  PGQ +  P +P+ Y YPTM Q+A  L   +       ++  G GAGA ILA+ A+   + + G VLLN        ++      I W  + + G+TS+  + ++ H F    +M+N E       ++ +Y++ + +T N  NL  +   Y +R +L    M  S  + +++                            T++CP++ + G  A   + V      ++   K +P     ++    D+     + +  ++ E+ +YFLQG G +     RRMS    P
Sbjct:   11 IDTPY-GMLHVVIRGAPKGNKPAILTYHDVGLNHKLCFNTLFHNEDMQEITKHFVVCHVDAPGQHIGAPQMPAGYQYPTMDQLAGMLPSVVQHFGFKSIVGIGVGAGAYILAKFALIFPDLVEGLVLLN--------IDPNGKGWIDWAATKLSGLTSTLPDIVLPHLFSQEELMSNTE-------LVQSYRQQINNTINQFNLQLFWNMYNSRRDL---EMNRSGTVLNAK----------------------------TLRCPVMLVVGDNAPAEEGV------VECNSKLDPTNTTFLKMA--DSGGLPQITQPGKLTEAFKYFLQGMGYIAYIKDRRMSGGPVP 303          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Cavefish
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:103041944])

HSP 1 Score: 107.457 bits (267), Expect = 3.155e-25
Identity = 90/348 (25.86%), Postives = 153/348 (43.97%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSS-METLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRP 1116
            I+T Y G L   I G    N+ AILT HD+G NH    + L H+  M+ +    V  +V  PGQ +  P +P+ Y YPTM Q+A  L   +       ++  G GAGA ILA+ A+   + + G VLLN        ++      I W  + + G+TS+  + ++ H F    +M+N E       ++ +Y++ + +T N  NL  +   Y +R +L    M  S  + +++                            T++CP++ + G  A   + V      ++   K +P     ++    D+     + +  ++ E+ +YFLQG G +     RRMS    P
Sbjct:   72 IDTPY-GMLHVVIRGAPKGNKPAILTYHDVGLNHKLCFNTLFHNEDMQEITKHFVVCHVDAPGQHIGAPQMPAGYQYPTMDQLAGMLPSVVQHFGFKSIVGIGVGAGAYILAKFALIFPDLVEGLVLLN--------IDPNGKGWIDWAATKLSGLTSTLPDIVLPHLFSQEELMSNTE-------LVQSYRQQINNTINQFNLQLFWNMYNSRRDL---EMNRSGTVLNAK----------------------------TLRCPVMLVVGDNAPAEEGV------VECNSKLDPTNTTFLKM--ADSGGLPQITQPGKLTEAFKYFLQGMGYIAYIKDRRMSGGPVP 364          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Cavefish
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:103041944])

HSP 1 Score: 107.071 bits (266), Expect = 6.166e-25
Identity = 90/348 (25.86%), Postives = 153/348 (43.97%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSS-METLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRP 1116
            I+T Y G L   I G    N+ AILT HD+G NH    + L H+  M+ +    V  +V  PGQ +  P +P+ Y YPTM Q+A  L   +       ++  G GAGA ILA+ A+   + + G VLLN        ++      I W  + + G+TS+  + ++ H F    +M+N E       ++ +Y++ + +T N  NL  +   Y +R +L    M  S  + +++                            T++CP++ + G  A   + V      ++   K +P     ++    D+     + +  ++ E+ +YFLQG G +     RRMS    P
Sbjct:  120 IDTPY-GMLHVVIRGAPKGNKPAILTYHDVGLNHKLCFNTLFHNEDMQEITKHFVVCHVDAPGQHIGAPQMPAGYQYPTMDQLAGMLPSVVQHFGFKSIVGIGVGAGAYILAKFALIFPDLVEGLVLLN--------IDPNGKGWIDWAATKLSGLTSTLPDIVLPHLFSQEELMSNTE-------LVQSYRQQINNTINQFNLQLFWNMYNSRRDL---EMNRSGTVLNAK----------------------------TLRCPVMLVVGDNAPAEEGV------VECNSKLDPTNTTFLKM--ADSGGLPQITQPGKLTEAFKYFLQGMGYIAYIKDRRMSGGPVP 412          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Cavefish
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:103041944])

HSP 1 Score: 104.375 bits (259), Expect = 6.176e-24
Identity = 88/345 (25.51%), Postives = 154/345 (44.64%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSS-METLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFG---VMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSST 1107
            I+T Y G L   I G    N+ AILT HD+G NH    + L H+  M+ +    V  +V  PGQ +  P +P+ Y YPTM Q+A  L   +       ++  G GAGA ILA+ A+   + + G VLLN        ++      I W  + + G+TS+  + ++ H F    +M+N E       ++ +Y++ + +T N  NL  +   Y +R +L    M  S  + +++                            T++CP++ + G  A   + V      ++   K +P     ++    D+     + +  ++ E+ +YFLQG G + SA   R++ +
Sbjct:  120 IDTPY-GMLHVVIRGAPKGNKPAILTYHDVGLNHKLCFNTLFHNEDMQEITKHFVVCHVDAPGQHIGAPQMPAGYQYPTMDQLAGMLPSVVQHFGFKSIVGIGVGAGAYILAKFALIFPDLVEGLVLLN--------IDPNGKGWIDWAATKLSGLTSTLPDIVLPHLFSQEELMSNTE-------LVQSYRQQINNTINQFNLQLFWNMYNSRRDL---EMNRSGTVLNAK----------------------------TLRCPVMLVVGDNAPAEEGV------VECNSKLDPTNTTFLKM--ADSGGLPQITQPGKLTEAFKYFLQGMGYMPSASMTRLARS 409          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010056.1 (pep scaffold:Pmarinus_7.0:GL493425:6271:8327:1 gene:ENSPMAG00000009100.1 transcript:ENSPMAT00000010056.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 2.073e-9
Identity = 26/77 (33.77%), Postives = 40/77 (51.95%), Query Frame = 1
Query:  205 FLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMS 435
               +  M+ +      +++  PGQ    P  P  Y YP+M Q+AD L   +   S+  +I  G GAG+ +LARMA+S
Sbjct:    7 LFNYEDMQEIIKNFAVYHIDAPGQQPGAPLFPQGYQYPSMDQLADMLPGVMTHFSLKSIIGIGVGAGSYVLARMAVS 83          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Nematostella
Match: EDO32493 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUY2])

HSP 1 Score: 140.198 bits (352), Expect = 4.605e-38
Identity = 98/347 (28.24%), Postives = 168/347 (48.41%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEV----------AILTVHDIGCNH-TQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSG--DERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSST 1107
            G LT YIEG  + ++            ++T HD+G NH T +  FL H  ++++  R V +++  PGQ     +L +DY YPT+ ++AD + + +   ++  ++ FG G+GANIL  +A++    ERILG +L+   G+T +  E  + K+  W+L+  G T  T NYL  H F       + E    ++ N+   ++   N  NL  ++ SYM+R N+++              E KQ VK                 K  +    I+ ++G  + + +  +  +  +        DRK++   ++ D   +VL E+ D +AE L  F+QG GLV +  +R MS T
Sbjct:   15 GDLTVYIEGEEAKDKTDEKENVKKKDVMITFHDLGMNHKTCFEKFLMHEDIKSIKDRFVIYHLDAPGQETGAENLSNDYQYPTINELADMVGKVLDHFALDDVVCFGVGSGANILCHLALASKWKERILGLILVEPCGATSSFKEWGEAKVKKWQLNAKGFTEGTANYLKWHHFERKTGKPNIE----LMENFCDEMKKNINPHNLAAFLNSYMHRPNILN--------------EAKQSVK----------------DKSVSTTAYIMVVTGEHSPHKEQSEQFFRVLSPV-----DRKKY-SILKPDCGTSVLEEKPDTMAEGLLLFIQGLGLVPTLRTRSMSRT 321          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Nematostella
Match: EDO40164 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S803])

HSP 1 Score: 127.102 bits (318), Expect = 2.975e-33
Identity = 94/310 (30.32%), Postives = 150/310 (48.39%), Query Frame = 1
Query:  154 AILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLI-ECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLV 1074
            AI+T HDIG NHT  ++ F     ++ L      +++  PGQ   +  LP  + YPTM+++AD ++ E +  LSIS  I  G GAGAN+L R  +   + +   VL+N        +E    K+   +L   G+T+  E+YL+ H FG     E + DLS+    YK  LR   N  NL  ++ SY+ R+N+         DI                R +E     R      ++KCP L ++G+ + + DDV      ++   + +P      E+M++ +C  + L E+  +VA++L  FLQG G V
Sbjct:    9 AIVTFHDIGQNHTSAFLGFFNFVDVQPLLEHFCIYHIDAPGQENCEKQLPETFVYPTMEELADFVVHEVVKQLSISRFIGLGVGAGANVLCRYGLMYPDFVDALVLVNLSVGKSGWIEWGYQKVCVRQLHNKGLTTFVEDYLLWHHFGEKTK-EENLDLSSA---YKDSLRSLLNPHNLALFINSYITRTNI---------DI---------------VRPVEGGPNPR------SLKCPTLLVTGTFSPHGDDV------VESNSRLDPKIS---EYMKVSDCGGMPLEEQPAKVAQALILFLQGNGYV 275          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Medaka
Match: ENSORLT00000006023.2 (protein NDRG1 [Source:NCBI gene;Acc:101156766])

HSP 1 Score: 111.309 bits (277), Expect = 8.482e-27
Identity = 90/334 (26.95%), Postives = 149/334 (44.61%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFL-KHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSA 1083
            + T Y G L   + GT   N   ILT HD+G NH    + L  H  M+ +       +V  PGQ      LP+ YTYPT+ Q+++ L   +    +  +I  G GAGA ILAR A++  + + G VL+N   +   L++S+ +KI  W       T +  + L+ H FG    ++ + DL   +  Y+ ++  T N  N+  +  SY NR+ L                 D Q+   G    +             T+KC  L + G      D+   +   +    K  P++      +++ +C  +  V++  +V E+L+YF+QG G + SA
Sbjct:   21 VETPY-GDLHCIMTGTPKANRPVILTFHDVGLNHKSCFETLFNHEDMQEIVKHLPVCHVEAPGQQEAAKSLPTLYTYPTVDQLSEALPAVLKNFGLRSVIGLGVGAGAYILARFALNHPDLVDGLVLINVNPNAEGLMDSVANKITDW-------TQTLPDKLIAHLFG-QEEIQKNYDL---VATYRHYITATMNQSNVSQFFRSYNNRTTL-----------------DVQRPVSGGNINVR------------TLKCSTLLVVG------DNSPAVEAVVDCNSKLNPNKTT---LLKMADCGGLPQVDQPAKVTEALKYFIQGLGYLSSA 304          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Medaka
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:105353632])

HSP 1 Score: 101.293 bits (251), Expect = 1.952e-23
Identity = 89/343 (25.95%), Postives = 146/343 (42.57%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFGVMNNLESDEDL---STMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMS 1101
            + T Y G L   I G    N+ AILT HD+G NH   +  F  +  M+ +    V  +V  PGQ V  P  P  Y YPTM Q+A  L   +       ++  G GAGA +LA+ A+   + + G VLLN        ++      I W  S I G+TS+  + ++ H F       S E+L   + ++ +Y++ + +  N  NL  +   Y +R +L                            EM    R   +    T+KCP++ + G  A   + V      ++   K +P     ++    D+     + +  ++ E+ +YFLQG G + SA   R++
Sbjct:   11 VETAY-GTLHVVIRGAPKGNKPAILTYHDVGLNHKLCFNPFFHNEDMQEITKHFVVCHVDAPGQQVGAPQFPQGYQYPTMDQLAGMLPTVVEHFGFKSIVGIGVGAGAFVLAKFALIFPDLVEGLVLLN--------IDPNGKGWIDWAASKISGLTSTIPDIVLPHLF-------SQEELVSNTELVQSYRQQINNNVNHFNLQLFWNLYNSRRDL----------------------------EMN---RSGSTLNSKTLKCPVMLVVGDNAPAEEGV------VECNSKLDPTNTTFLKMA--DSGGLPQLTQPGKLTEAFKYFLQGMGYMPSASMTRLA 298          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Medaka
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:105353632])

HSP 1 Score: 102.449 bits (254), Expect = 3.935e-23
Identity = 90/348 (25.86%), Postives = 146/348 (41.95%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFGVMNNLESDEDL---STMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRP 1116
            + T Y G L   I G    N+ AILT HD+G NH   +  F  +  M+ +    V  +V  PGQ V  P  P  Y YPTM Q+A  L   +       ++  G GAGA +LA+ A+   + + G VLLN        ++      I W  S I G+TS+  + ++ H F       S E+L   + ++ +Y++ + +  N  NL  +   Y +R +L                            EM    R   +    T+KCP++ + G  A   + V      ++   K +P     ++    D+     + +  ++ E+ +YFLQG G +     RR+S    P
Sbjct:  213 VETAY-GTLHVVIRGAPKGNKPAILTYHDVGLNHKLCFNPFFHNEDMQEITKHFVVCHVDAPGQQVGAPQFPQGYQYPTMDQLAGMLPTVVEHFGFKSIVGIGVGAGAFVLAKFALIFPDLVEGLVLLN--------IDPNGKGWIDWAASKISGLTSTIPDIVLPHLF-------SQEELVSNTELVQSYRQQINNNVNHFNLQLFWNLYNSRRDL----------------------------EMN---RSGSTLNSKTLKCPVMLVVGDNAPAEEGV------VECNSKLDPTNTTFLKMA--DSGGLPQLTQPGKLTEAFKYFLQGMGYIAYVKDRRLSGGPVP 505          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Medaka
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:105353632])

HSP 1 Score: 102.449 bits (254), Expect = 4.209e-23
Identity = 90/349 (25.79%), Postives = 149/349 (42.69%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFGVMNNLESDEDL---STMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANV-LVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRP 1116
            + T Y G L   I G    N+ AILT HD+G NH   +  F  +  M+ +    V  +V  PGQ V  P  P  Y YPTM Q+A  L   +       ++  G GAGA +LA+ A+   + + G VLLN        ++      I W  S I G+TS+  + ++ H F       S E+L   + ++ +Y++ + +  N  NL  +   Y +R +L                            EM    R   +    T+KCP++ + G  A   + V      ++   K +P    +  F+++ +   +  + +  ++ E+ +YFLQG G +     RR+S    P
Sbjct:  171 VETAY-GTLHVVIRGAPKGNKPAILTYHDVGLNHKLCFNPFFHNEDMQEITKHFVVCHVDAPGQQVGAPQFPQGYQYPTMDQLAGMLPTVVEHFGFKSIVGIGVGAGAFVLAKFALIFPDLVEGLVLLN--------IDPNGKGWIDWAASKISGLTSTIPDIVLPHLF-------SQEELVSNTELVQSYRQQINNNVNHFNLQLFWNLYNSRRDL----------------------------EMN---RSGSTLNSKTLKCPVMLVVGDNAPAEEGV------VECNSKLDPT---NTTFLKMADSGGLPQLTQPGKLTEAFKYFLQGMGYIAYVKDRRLSGGPVP 463          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Medaka
Match: ndrg4 (NDRG family member 4 [Source:NCBI gene;Acc:105353632])

HSP 1 Score: 102.064 bits (253), Expect = 6.965e-23
Identity = 90/348 (25.86%), Postives = 146/348 (41.95%), Query Frame = 1
Query:   88 INTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQ-YIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTI-GMTSSTENYLVVHRFGVMNNLESDEDL---STMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRP 1116
            + T Y G L   I G    N+ AILT HD+G NH   +  F  +  M+ +    V  +V  PGQ V  P  P  Y YPTM Q+A  L   +       ++  G GAGA +LA+ A+   + + G VLLN        ++      I W  S I G+TS+  + ++ H F       S E+L   + ++ +Y++ + +  N  NL  +   Y +R +L                            EM    R   +    T+KCP++ + G  A   + V      ++   K +P     ++    D+     + +  ++ E+ +YFLQG G +     RR+S    P
Sbjct:  266 VETAY-GTLHVVIRGAPKGNKPAILTYHDVGLNHKLCFNPFFHNEDMQEITKHFVVCHVDAPGQQVGAPQFPQGYQYPTMDQLAGMLPTVVEHFGFKSIVGIGVGAGAFVLAKFALIFPDLVEGLVLLN--------IDPNGKGWIDWAASKISGLTSTIPDIVLPHLF-------SQEELVSNTELVQSYRQQINNNVNHFNLQLFWNLYNSRRDL----------------------------EMN---RSGSTLNSKTLKCPVMLVVGDNAPAEEGV------VECNSKLDPTNTTFLKMA--DSGGLPQLTQPGKLTEAFKYFLQGMGYIAYVKDRRLSGGPVP 558          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Planmine SMEST
Match: SMESG000021236.1 (SMESG000021236.1)

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 377/379 (99.47%), Postives = 378/379 (99.74%), Query Frame = 1
Query:   79 MTTINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYDNPKGASNITYNPKRKYSESEN 1215
            MTTINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCP IKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYD+PKGASNITYNPKRKYSESEN
Sbjct:    1 MTTINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPAIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYDSPKGASNITYNPKRKYSESEN 379          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Planmine SMEST
Match: SMESG000021236.1 (SMESG000021236.1)

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 339/379 (89.45%), Postives = 341/379 (89.97%), Query Frame = 1
Query:   79 MTTINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYDNPKGASNITYNPKRKYSESEN 1215
            MTTINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNM                                      TI+CPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYD+PKGASNITYNPKRKYSESEN
Sbjct:    1 MTTINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNM--------------------------------------TIRCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNRKISMEEYDSPKGASNITYNPKRKYSESEN 341          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Planmine SMEST
Match: SMESG000065324.1 (SMESG000065324.1)

HSP 1 Score: 271.166 bits (692), Expect = 1.151e-87
Identity = 147/360 (40.83%), Postives = 216/360 (60.00%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEP-DRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIG-NRKISMEEYDNPKGASNIT 1179
            G +  YI+GTR   E  ILTVHD+GCNH QY +FL +  M  L+ + VW +V LPGQ   D DL +++  P+M+ IA DL E    + +S++++FGEGAGANILAR A++ +  +LGA+L++CVGST +++ESLKDK+I WKL++IGM  + E+YLV+HRFG   N E++ +L  +I ++K  LR++ N KNL+ ++ S+M R NL                                        +   +  P LFI+G+ A +  +V  L E +   LK +P D+K   E ++ID  ANVL E  ++V  SLQYFLQG GLV +    R+S+   PI  NR++SME+YD P+G  + +
Sbjct:   18 GAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL--------------------------------------GERIAKLNTPTLFITGAAAIHCKNVHLLQETL---LKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNL---RLSN--EPIKINRRMSMEDYDRPRGTGSFS 329          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Planmine SMEST
Match: SMESG000065324.1 (SMESG000065324.1)

HSP 1 Score: 265.388 bits (677), Expect = 2.167e-85
Identity = 147/364 (40.38%), Postives = 216/364 (59.34%), Query Frame = 1
Query:  106 GKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGWKLSTIGMTSSTENYLVVHRFGV----MNNLESDEDLSTMINNYKKFLRDTFNSKNLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETRERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEP-DRKRHIEFMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIG-NRKISMEEYDNPKGASNIT 1179
            G +  YI+GTR   E  ILTVHD+GCNH QY +FL +  M  L+ + VW +V LPGQ   D DL +++  P+M+ IA DL E    + +S++++FGEGAGANILAR A++ +  +LGA+L++CVGST +++ESLKDK+I WKL++IGM  + E+YLV+HRFG       N E++ +L  +I ++K  LR++ N KNL+ ++ S+M R NL                                        +   +  P LFI+G+ A +  +V  L E +   LK +P D+K   E ++ID  ANVL E  ++V  SLQYFLQG GLV +    R+S+   PI  NR++SME+YD P+G  + +
Sbjct:   18 GAINVYIQGTRGPKEQIILTVHDLGCNHYQYEEFLSNPKMSALSQKFVWIHVDLPGQGDGDEDLETNF--PSMEDIALDLQELCVQMKLSNVLLFGEGAGANILARFAINSEHLVLGAILIHCVGSTASMIESLKDKVINWKLNSIGMNPTAESYLVLHRFGTQSIKFKNAENETELKNVIESFKYNLRNSINPKNLYKFINSFMTRRNL--------------------------------------GERIAKLNTPTLFITGAAAIHCKNVHLLQETL---LKTKPADQKVKFELVQIDGVANVLTEAPEKVVVSLQYFLQGLGLVSNL---RLSN--EPIKINRRMSMEDYDRPRGTGSFS 333          
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Planmine SMEST
Match: SMESG000055204.1 (SMESG000055204.1)

HSP 1 Score: 133.265 bits (334), Expect = 1.726e-37
Identity = 62/122 (50.82%), Postives = 84/122 (68.85%), Query Frame = 1
Query:   70 QTKMTTINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSMETLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISHLIVFGEGAGANILARMAMS 435
            + ++  + T  CG L  YI+G RS NEV I T+HD+GCNH +Y  FL+H+SM+ +  RCVW ++ +PGQ  ND DL     +PTMQ+IADD+      L+I H ++FGEGAGANILAR A+S
Sbjct:    3 EIEVKQVTTPKCGVLNIYIQGNRSPNEVIIFTIHDLGCNHKEYEQFLEHTSMKHIRNRCVWIHLDIPGQGDNDEDLNLK-EFPTMQEIADDIKVIFDELNIQHAVLFGEGAGANILARFAVS 123          
The following BLAST results are available for this feature:
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NDRG31.822e-2526.49NDRG family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
NDRG32.112e-2526.49NDRG family member 3 [Source:HGNC Symbol;Acc:HGNC:... [more]
NDRG14.220e-2524.27N-myc downstream regulated 1 [Source:HGNC Symbol;A... [more]
NDRG14.220e-2524.27N-myc downstream regulated 1 [Source:HGNC Symbol;A... [more]
NDRG25.761e-2426.44NDRG family member 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ZK1073.15.331e-4228.38pep chromosome:WBcel235:X:16124151:16128865:-1 gen... [more]
ZK1073.15.331e-4228.38pep chromosome:WBcel235:X:16123942:16128815:-1 gen... [more]
Y48G10A.34.054e-3026.93pep chromosome:WBcel235:I:13471683:13474185:-1 gen... [more]
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG20828.294e-5329.43gene:FBgn0027608 transcript:FBtr0078674[more]
CG20828.294e-5329.43gene:FBgn0027608 transcript:FBtr0300910[more]
CG20821.396e-5229.43gene:FBgn0027608 transcript:FBtr0300906[more]
CG20823.811e-5229.06gene:FBgn0027608 transcript:FBtr0078672[more]
CG20823.811e-5229.06gene:FBgn0027608 transcript:FBtr0300909[more]
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndrg1b2.277e-2625.52N-myc downstream regulated 1b [Source:ZFIN;Acc:ZDB... [more]
ndrg41.563e-2525.86NDRG family member 4 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
ndrg42.395e-2425.66NDRG family member 4 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
ndrg3b5.171e-2325.37ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ndrg3b5.171e-2325.37ndrg family member 3b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndrg43.735e-2527.67NDRG family member 4 [Source:NCBI gene;Acc:448335][more]
ndrg43.785e-2527.67NDRG family member 4 [Source:NCBI gene;Acc:448335][more]
ndrg42.891e-2427.03NDRG family member 4 [Source:NCBI gene;Acc:448335][more]
ndrg44.631e-2427.62NDRG family member 4 [Source:NCBI gene;Acc:448335][more]
ndrg48.104e-2326.24NDRG family member 4 [Source:NCBI gene;Acc:448335][more]
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ndrg13.647e-2824.68N-myc downstream regulated gene 1 [Source:MGI Symb... [more]
Ndrg31.887e-2425.67N-myc downstream regulated gene 3 [Source:MGI Symb... [more]
Ndrg23.430e-2426.36N-myc downstream regulated gene 2 [Source:MGI Symb... [more]
Ndrg23.768e-2426.44N-myc downstream regulated gene 2 [Source:MGI Symb... [more]
Ndrg33.378e-2325.29N-myc downstream regulated gene 3 [Source:MGI Symb... [more]
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O02485|YDJ1_CAEEL6.782e-4128.38Uncharacterized protein ZK1073.1 OS=Caenorhabditis... [more]
sp|Q62433|NDRG1_MOUSE2.551e-2724.68Protein NDRG1 OS=Mus musculus OX=10090 GN=Ndrg1 PE... [more]
sp|Q6JE36|NDRG1_RAT1.239e-2624.42Protein NDRG1 OS=Rattus norvegicus OX=10116 GN=Ndr... [more]
sp|Q5RA95|NDRG3_PONAB4.093e-2526.49Protein NDRG3 OS=Pongo abelii OX=9601 GN=NDRG3 PE=... [more]
sp|Q9UGV2|NDRG3_HUMAN1.014e-2426.49Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3 PE=... [more]
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C7TZF81.508e-10541.87Uncharacterized protein OS=Schistosoma japonicum O... [more]
A0A3Q0KUE13.189e-10540.80Family S33 non-peptidase homologue (S33 family) OS... [more]
A0A0R3SRI53.758e-10141.49Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3UIC17.917e-10140.26Uncharacterized protein OS=Mesocestoides corti OX=... [more]
Q86EV01.992e-10041.99Clone ZZD1393 mRNA sequence OS=Schistosoma japonic... [more]
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndrg1b4.011e-2725.81protein NDRG1 [Source:NCBI gene;Acc:103037827][more]
ndrg41.940e-2525.86NDRG family member 4 [Source:NCBI gene;Acc:1030419... [more]
ndrg43.155e-2525.86NDRG family member 4 [Source:NCBI gene;Acc:1030419... [more]
ndrg46.166e-2525.86NDRG family member 4 [Source:NCBI gene;Acc:1030419... [more]
ndrg46.176e-2425.51NDRG family member 4 [Source:NCBI gene;Acc:1030419... [more]
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000010056.12.073e-933.77pep scaffold:Pmarinus_7.0:GL493425:6271:8327:1 gen... [more]
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO324934.605e-3828.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401642.975e-3330.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000006023.28.482e-2726.95protein NDRG1 [Source:NCBI gene;Acc:101156766][more]
ndrg41.952e-2325.95NDRG family member 4 [Source:NCBI gene;Acc:1053536... [more]
ndrg43.935e-2325.86NDRG family member 4 [Source:NCBI gene;Acc:1053536... [more]
ndrg44.209e-2325.79NDRG family member 4 [Source:NCBI gene;Acc:1053536... [more]
ndrg46.965e-2325.86NDRG family member 4 [Source:NCBI gene;Acc:1053536... [more]
back to top
BLAST of Family S33 non-peptidase homologue (S33 family) vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021236.10.000e+099.47SMESG000021236.1[more]
SMESG000021236.10.000e+089.45SMESG000021236.1[more]
SMESG000065324.11.151e-8740.83SMESG000065324.1[more]
SMESG000065324.12.167e-8540.38SMESG000065324.1[more]
SMESG000055204.11.726e-3750.82SMESG000055204.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012889 ID=SMED30012889|Name=Family S33 non-peptidase homologue (S33 family)|organism=Schmidtea mediterranea sexual|type=transcript|length=1301bp
TGAAATTTGTTTAAATATATTATTTCTAAATTCTAACCTTTATATATAAT
TAGAATTGAAATTAGTTATCAAACGAAGATGACAACTATCAATACAAAAT
ATTGTGGAAAGTTAACATTTTACATTGAAGGCACTCGGTCTACAAATGAA
GTCGCTATATTAACTGTGCATGATATTGGCTGCAATCATACGCAATACAT
TGATTTTCTTAAACATTCAAGCATGGAAACTTTAGCTCCGAGATGCGTGT
GGTTCAATGTTGTTTTGCCAGGTCAAAGTGTGAATGATCCCGATCTTCCA
TCTGATTACACCTATCCTACGATGCAGCAAATAGCCGACGATTTGATTGA
ATGCATTGGAATATTGAGTATTTCTCATTTGATTGTATTCGGAGAGGGAG
CCGGTGCAAATATTCTGGCAAGAATGGCGATGAGTGGAGACGAACGGATT
CTGGGAGCAGTTCTGTTGAATTGTGTCGGTTCAACGCCAAACCTCGTCGA
ATCATTAAAGGATAAGATAATTGGATGGAAACTGAGTACAATCGGAATGA
CATCAAGCACGGAAAACTATTTGGTCGTCCATAGATTTGGAGTGATGAAT
AATCTCGAGTCTGACGAGGATTTGTCAACAATGATAAACAATTACAAAAA
GTTTCTTCGTGATACTTTTAATTCCAAAAATTTACATGGTTATGTTACCT
CTTACATGAACCGGTCAAATCTTATTGATAAAAATATGACTATAAGCCAA
GACATCAGTGATTCTCGGCAGGAAGACAAACAGAAAGTGAAAAAGGGTAA
ATATCGTGAAATGGAGGCTGAAACTAGAGAAAGAAAATCTTCTAAATGTC
CAACAATCAAATGTCCAATTCTTTTCATATCTGGTTCACTGGCAAATTAT
GCGGATGATGTCAAATGTCTATATGAAGACATTCAAGGATTCCTTAAAAA
TGAACCCGATAGAAAGCGGCACATTGAATTCATGGAAATTGATAATTGTG
CTAATGTTCTTGTAGAAAGAACAGATCAAGTTGCCGAATCGCTACAATAC
TTTTTACAGGGCCAGGGTCTCGTTGGATCGGCTCCGAGTCGACGAATGAG
TAGCACAGTTCGACCAATTGGCAATCGCAAAATTTCCATGGAAGAATACG
ATAATCCAAAGGGGGCATCCAATATAACTTATAATCCAAAAAGAAAGTAT
AGTGAAAGTGAAAATTAAAAGATAATACTGCTGCCTTATAACACTTATTA
ATGACTAATTTTGATTGTTAGAATAAATAAATGTTTGTATTATAAAAAAA
A
back to top

protein sequence of SMED30012889-orf-1

>SMED30012889-orf-1 ID=SMED30012889-orf-1|Name=SMED30012889-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=380bp
MTTINTKYCGKLTFYIEGTRSTNEVAILTVHDIGCNHTQYIDFLKHSSME
TLAPRCVWFNVVLPGQSVNDPDLPSDYTYPTMQQIADDLIECIGILSISH
LIVFGEGAGANILARMAMSGDERILGAVLLNCVGSTPNLVESLKDKIIGW
KLSTIGMTSSTENYLVVHRFGVMNNLESDEDLSTMINNYKKFLRDTFNSK
NLHGYVTSYMNRSNLIDKNMTISQDISDSRQEDKQKVKKGKYREMEAETR
ERKSSKCPTIKCPILFISGSLANYADDVKCLYEDIQGFLKNEPDRKRHIE
FMEIDNCANVLVERTDQVAESLQYFLQGQGLVGSAPSRRMSSTVRPIGNR
KISMEEYDNPKGASNITYNPKRKYSESEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004142NDRG
IPR029058AB_hydrolase
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004142NDRGPFAMPF03096Ndrcoord: 5..332
e-value: 2.0E-63
score: 213.8
IPR004142NDRGPANTHERPTHR11034N-MYC DOWNSTREAM REGULATEDcoord: 3..219
coord: 256..361
IPR029058Alpha/Beta hydrolase foldGENE3DG3DSA:3.40.50.1820coord: 2..333
e-value: 8.2E-55
score: 188.2
IPR029058Alpha/Beta hydrolase foldSUPERFAMILYSSF53474alpha/beta-Hydrolasescoord: 11..328
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 349..379
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 226..249
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 227..249
NoneNo IPR availablePANTHERPTHR11034:SF40BCDNA.GH02439coord: 3..219
coord: 256..361