BLUF domain-containing protein

Overview
NameBLUF domain-containing protein
Smed IDSMED30012881
Length (bp)903
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BLUF domain-containing protein (SMED30012881) t-SNE clustered cells

Violin plots show distribution of expression levels for BLUF domain-containing protein (SMED30012881) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BLUF domain-containing protein (SMED30012881) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BLUF domain-containing protein (SMED30012881) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012881

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30012881SMESG000015580.1 SmedASXL_019782SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30012881SMESG000015580.1 dd_Smed_v4_11000_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012881SMESG000015580.1 dd_Smed_v6_11000_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30012881SMESG000015580.1 OX_Smed_1.0.02020ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30012881SMESG000015580.1 dd_Smed_v4_11000_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BLUF domain-containing protein vs. Ensembl Human
Match: TEX47 (testis expressed 47 [Source:HGNC Symbol;Acc:HGNC:22402])

HSP 1 Score: 76.6406 bits (187), Expect = 9.983e-16
Identity = 60/240 (25.00%), Postives = 115/240 (47.92%), Query Frame = 1
Query:  118 HFFYDRDSNSGKKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNN---RVTGLLLLYPNHAIHILESTDRSILDILKLLNLMEINEVGDSQLMF-SKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWPA 825
            HF  ++     KK  + R+ +V+K+  N     R+ VAD+ E+     + ++    VTGLLL+YP   +HILES+  ++  +L    L  I  V D  + F  + +I+++S NI  +L+ Q++  ++ +    ++    + S  +++ D + Q  KL ++L             +   +       NL    PDL+  + I+ YL +  +    +    +I  Y +P    L+S+++WPA
Sbjct:   32 HFQEEKQRLHLKKFLLDRMFLVAKIQANVE---RKDVADYYEQMFQSVLKHHLGEAVTGLLLIYPTSILHILESSSDTLYKVL----LDYIGHVKDETVFFIQQMKIIVISHNIPMRLFMQWHVSVIKVPVMYLDDVTQSQSLKEVITDFLTQTHKLSLYLC------------QTMKVGTKGPGDNLHQVAPDLLLPEQIIKYLCKSEE---FMDPATFINMYNRPIHITLDSEVVWPA 249          
BLAST of BLUF domain-containing protein vs. Ensembl Zebrafish
Match: LO017829.1 (testis expressed 47 [Source:NCBI gene;Acc:100006770])

HSP 1 Score: 64.3142 bits (155), Expect = 1.212e-11
Identity = 70/253 (27.67%), Postives = 116/253 (45.85%), Query Frame = 1
Query:   88 DEEIFSKSIYHFFYDR---DSNSGKKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNNR----VTGLLLLYPNHAIHILESTDRSILDILKLLNLMEINEVGDSQLMFSKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWPA 825
            D E  S   +H    R    ++S  K  +HR+ + ++L  + + + R  VA   E+ +N  +  +R    +TGLLLLYP H + ++E +  ++L +L+ L  ME N   DS L+    RIL+VS ++  +L+ Q+   +L    +         +  K++   M QL +LG  L+                L   EVL ++ D VP        V  +  + Q   L+S   YI  Y  P    L+S+ +WPA
Sbjct:    8 DSENGSSLFHHRLRARRRTQADSQPKFLLHRLVVAARL--SCTPEDRSTVAAHYEK-LNMSIQRSRPGEELTGLLLLYPQHTLLVIECSTEALLSVLQDLRHMEEN--PDSSLILHP-RILLVSHDLPCRLFPQWFCMMLSESESRRTEASDEQNPEKLLNQTMKQLLQLGCHLYNTQHNTGSTM------LTPDEVLKDVSDVVPP-------VAAVYRLLQMEALLSPARYISTYHSPIHQPLDSESVWPA 241          
BLAST of BLUF domain-containing protein vs. Ensembl Xenopus
Match: zdhhc6 (zinc finger DHHC-type containing 6 [Source:Xenbase;Acc:XB-GENE-979137])

HSP 1 Score: 50.447 bits (119), Expect = 3.052e-7
Identity = 34/135 (25.19%), Postives = 68/135 (50.37%), Query Frame = 1
Query:  421 RILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWPA 825
            +IL++S NI  +L+ Q+  K+L++   ++    +  S   IV + + +L ++G  L K P K  +     +F            + VP+LI  Q  + +L    +   L + ++++Q Y+ P + +L+SD +WP 
Sbjct:   14 KILVMSHNIPNRLFNQWCYKVLNVPGQHLADKYNESSTDSIVTECLTKLLQIGKHLTKYP-KGSKNIPDSVF------------EKVPELIVPQGSIHHLLNCKE---LPTPDQFLQSYDSPLNVLLDSDRVWPT 132          
BLAST of BLUF domain-containing protein vs. Ensembl Mouse
Match: Tex47 (testis expressed 47 [Source:MGI Symbol;Acc:MGI:1918170])

HSP 1 Score: 65.855 bits (159), Expect = 4.245e-12
Identity = 52/228 (22.81%), Postives = 110/228 (48.25%), Query Frame = 1
Query:  151 KKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNN---RVTGLLLLYPNHAIHILESTDRSILDILKLLNLMEINEVGDSQLMFSKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWPA 825
            KK  +HR+ +V  +  N     ++ ++++ E+     + ++    VTGL+L+YP+  +HILES++ ++  I  LL+ +  +E  +++ M    +I++ S NI  +L+ Q++   + +    ++    + S  ++  + +    KL + L+K               L       NL    P+LI  + I+ YL +  +    +    ++  Y +P    L+SD++WPA
Sbjct:   43 KKFLLHRMFLVGYIQGN---TEKKDISEYYEQLFQSILKHHLGESVTGLMLIYPSTFLHILESSNGTLFRI--LLDYVA-HEKSETEFMLQNMKIVVASHNIPTRLFMQWHISAIKVPVLYLDDESQSPSIEEVTTEFLTMTHKLALQLYK------------TVKLGAKGPGDNLHQLAPELILPEQIIKYLCKAEE---FMDPASFLSMYNRPIHVTLDSDIVWPA 249          
BLAST of BLUF domain-containing protein vs. Ensembl Mouse
Match: Tex47 (testis expressed 47 [Source:MGI Symbol;Acc:MGI:1918170])

HSP 1 Score: 65.855 bits (159), Expect = 4.245e-12
Identity = 52/228 (22.81%), Postives = 110/228 (48.25%), Query Frame = 1
Query:  151 KKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNN---RVTGLLLLYPNHAIHILESTDRSILDILKLLNLMEINEVGDSQLMFSKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWPA 825
            KK  +HR+ +V  +  N     ++ ++++ E+     + ++    VTGL+L+YP+  +HILES++ ++  I  LL+ +  +E  +++ M    +I++ S NI  +L+ Q++   + +    ++    + S  ++  + +    KL + L+K               L       NL    P+LI  + I+ YL +  +    +    ++  Y +P    L+SD++WPA
Sbjct:   43 KKFLLHRMFLVGYIQGN---TEKKDISEYYEQLFQSILKHHLGESVTGLMLIYPSTFLHILESSNGTLFRI--LLDYVA-HEKSETEFMLQNMKIVVASHNIPTRLFMQWHISAIKVPVLYLDDESQSPSIEEVTTEFLTMTHKLALQLYK------------TVKLGAKGPGDNLHQLAPELILPEQIIKYLCKAEE---FMDPASFLSMYNRPIHVTLDSDIVWPA 249          
BLAST of BLUF domain-containing protein vs. Ensembl Mouse
Match: Tex47 (testis expressed 47 [Source:MGI Symbol;Acc:MGI:1918170])

HSP 1 Score: 65.855 bits (159), Expect = 4.245e-12
Identity = 52/228 (22.81%), Postives = 110/228 (48.25%), Query Frame = 1
Query:  151 KKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNN---RVTGLLLLYPNHAIHILESTDRSILDILKLLNLMEINEVGDSQLMFSKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWPA 825
            KK  +HR+ +V  +  N     ++ ++++ E+     + ++    VTGL+L+YP+  +HILES++ ++  I  LL+ +  +E  +++ M    +I++ S NI  +L+ Q++   + +    ++    + S  ++  + +    KL + L+K               L       NL    P+LI  + I+ YL +  +    +    ++  Y +P    L+SD++WPA
Sbjct:   43 KKFLLHRMFLVGYIQGN---TEKKDISEYYEQLFQSILKHHLGESVTGLMLIYPSTFLHILESSNGTLFRI--LLDYVA-HEKSETEFMLQNMKIVVASHNIPTRLFMQWHISAIKVPVLYLDDESQSPSIEEVTTEFLTMTHKLALQLYK------------TVKLGAKGPGDNLHQLAPELILPEQIIKYLCKAEE---FMDPASFLSMYNRPIHVTLDSDIVWPA 249          
BLAST of BLUF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8TBZ9|TEX47_HUMAN (Testis-expressed protein 47 OS=Homo sapiens OX=9606 GN=TEX47 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.794e-15
Identity = 60/240 (25.00%), Postives = 115/240 (47.92%), Query Frame = 1
Query:  118 HFFYDRDSNSGKKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNN---RVTGLLLLYPNHAIHILESTDRSILDILKLLNLMEINEVGDSQLMF-SKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWPA 825
            HF  ++     KK  + R+ +V+K+  N     R+ VAD+ E+     + ++    VTGLLL+YP   +HILES+  ++  +L    L  I  V D  + F  + +I+++S NI  +L+ Q++  ++ +    ++    + S  +++ D + Q  KL ++L             +   +       NL    PDL+  + I+ YL +  +    +    +I  Y +P    L+S+++WPA
Sbjct:   32 HFQEEKQRLHLKKFLLDRMFLVAKIQANVE---RKDVADYYEQMFQSVLKHHLGEAVTGLLLIYPTSILHILESSSDTLYKVL----LDYIGHVKDETVFFIQQMKIIVISHNIPMRLFMQWHVSVIKVPVMYLDDVTQSQSLKEVITDFLTQTHKLSLYLC------------QTMKVGTKGPGDNLHQVAPDLLLPEQIIKYLCKSEE---FMDPATFINMYNRPIHITLDSEVVWPA 249          
BLAST of BLUF domain-containing protein vs. UniProt/SwissProt
Match: sp|A0JPP5|TEX47_RAT (Testis-expressed protein 47 OS=Rattus norvegicus OX=10116 GN=Tex47 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.803e-11
Identity = 53/230 (23.04%), Postives = 112/230 (48.70%), Query Frame = 1
Query:  151 KKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNNR---VTGLLLLYPNHAIHILESTDRSILDILKLLNLMEINEVGDSQLMFSKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLM--NLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWPA 825
            KK  +HR+ +V  +  N     ++ ++++ E+     + ++    VTGL L+YP+  +HILES++ ++  I  LL+ +  +E  + + M    +I++ S NI  +L+ Q++  I+ +    ++    + S  ++  D +    KL + L+K              ++KL       NL    P+LI  +  + YL + ++    +    ++  Y +P    ++SD++WPA
Sbjct:   43 KKFLLHRLFLVGYIQAN---TEKKEISEYYEQLFQSILKHHLGEVVTGLFLIYPSSFLHILESSNGTLFRI--LLDYVA-HEKSEREFMIQNMKIIVASHNIPTRLFMQWHISIIKVPVLYLDDDTQSQSVEEVTTDFLTLTHKLALHLYK--------------TVKLGGKGPGDNLHQLAPELILPEKTIKYLCKATE---FMDPASFLSMYNRPIHITMDSDIVWPA 249          
BLAST of BLUF domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9D5W8|TEX47_MOUSE (Testis-expressed protein 47 OS=Mus musculus OX=10090 GN=Tex47 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.969e-11
Identity = 52/228 (22.81%), Postives = 110/228 (48.25%), Query Frame = 1
Query:  151 KKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNN---RVTGLLLLYPNHAIHILESTDRSILDILKLLNLMEINEVGDSQLMFSKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWPA 825
            KK  +HR+ +V  +  N     ++ ++++ E+     + ++    VTGL+L+YP+  +HILES++ ++  I  LL+ +  +E  +++ M    +I++ S NI  +L+ Q++   + +    ++    + S  ++  + +    KL + L+K               L       NL    P+LI  + I+ YL +  +    +    ++  Y +P    L+SD++WPA
Sbjct:   43 KKFLLHRMFLVGYIQGN---TEKKDISEYYEQLFQSILKHHLGESVTGLMLIYPSTFLHILESSNGTLFRI--LLDYVA-HEKSETEFMLQNMKIVVASHNIPTRLFMQWHISAIKVPVLYLDDESQSPSIEEVTTEFLTMTHKLALQLYK------------TVKLGAKGPGDNLHQLAPELILPEQIIKYLCKAEE---FMDPASFLSMYNRPIHVTLDSDIVWPA 249          
BLAST of BLUF domain-containing protein vs. TrEMBL
Match: A0A4V3SG74 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002745 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.054e-45
Identity = 90/287 (31.36%), Postives = 159/287 (55.40%), Query Frame = 1
Query:   76 IDIED--EEIFSKSIYHFFYDRDSNSGKKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNNRVTGLLLLYPNHAIHILESTDRSILDILKLLNLME----------------------------------INEVGDSQLMFS--KNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWP 822
            +D+ED      + ++Y    ++    G+   ++ I +V K+ P+  +  R+ VA + E  +  F   +++TGLLL+YP H ++I+E++ R+++ IL+ LN  E                                  I E+ +   +     NRIL V  N+  ++Y  Y     DMEP ++N ++S++SD K  ++ ++QL +LGVFL +EP+K Q E+VPEIF +KL+++L +LR+  P+L+PQQ+ VGY +E+S    +I + EY+ +Y+ P+   L+S+  WP
Sbjct:    8 LDVEDIDARPAATTLYQAIEEKGRFMGRTNILYSIVLVGKVSPH--VADRREVAAYFEGLLMQFKPPDQITGLLLIYPYHVVNIIETSFRTMMRILRALNESERIINCYIAHYTDILNKDLPEDEEPRRFTCFDEATIEEIAERPTLAPLIHNRILFVKDNLVHRIYRTYEMLPFDMEPVSLNQYDSSESDEKRFLETLSQLIRLGVFLSEEPMKGQEEYVPEIFKMKLTKILRHLREEHPELVPQQVTVGYFSELSNYPGIIPVQEYLNFYDMPYEITLQSENTWP 292          
BLAST of BLUF domain-containing protein vs. TrEMBL
Match: A0A504YMQ6 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_09422 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.062e-45
Identity = 88/288 (30.56%), Postives = 164/288 (56.94%), Query Frame = 1
Query:   76 IDIEDEE--IFSKSIYHFFYDRDSNSGKKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNNRVTGLLLLYPNHAIHILESTDRSILDILKLLNLME-----------------------------INEVGDSQLM--------FSKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWP 822
            +DIED +  + + S+Y    ++    G+   ++ + +V K+ P+  L  +  V  + E  ++ F   +++TGL+++YP H ++I+E++ RS++ +L+ LN  E                              +     QL+           N+IL +  N++ ++Y  +     DMEPA++N +++++ D K ++D + QLT+LG++L KEP+K+Q E+VPE+F +KL+E+L  LR+  P+L+PQQ++VGY +EIS    +I L EY+ +Y+ P+ T L+S++ WP
Sbjct:    1 MDIEDADARLSATSLYQALEEKGKFMGRVNLLYSVYLVGKISPH--LIDQHDVQSYFEGLLSQFKSPDQITGLVMVYPYHVVNIIETSFRSLMKVLRHLNETEKLINCYIEKCVEKLNRNLPEDSDPIPFTGFDREAKKQLIEKHHHLAPLVDNKILFIRSNLASRVYRTFEVLTFDMEPASLNQYDNSEPDEKKLLDTIIQLTRLGIYLSKEPMKNQEEYVPELFKIKLTEILKRLREDHPELVPQQVVVGYFSEISTFEGIIPLQEYLNFYDLPYETSLQSEVTWP 286          
BLAST of BLUF domain-containing protein vs. TrEMBL
Match: A0A4S2M4N2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002745 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.401e-45
Identity = 93/300 (31.00%), Postives = 162/300 (54.00%), Query Frame = 1
Query:   31 DL*LKYHSNIIMTSTIDIEDEEIFSKSIYHFFYDRDSNSGKKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNNRVTGLLLLYPNHAIHILESTDRSILDILKLLNLME----------------------------------INEVGDSQLMFS--KNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWP 822
            D  L  H +  +    DI D    + ++Y    ++    G+   ++ I +V K+ P+  +  R+ VA + E  +  F   +++TGLLL+YP H ++I+E++ R+++ IL+ LN  E                                  I E+ +   +     NRIL V  N+  ++Y  Y     DMEP ++N ++S++SD K  ++ ++QL +LGVFL +EP+K Q E+VPEIF +KL+++L +LR+  P+L+PQQ+ VGY +E+S    +I + EY+ +Y+ P+   L+S+  WP
Sbjct:    3 DFILTLHKSFKLLDVEDI-DARPAATTLYQAIEEKGRFMGRTNILYSIVLVGKVSPH--VADRREVAAYFEGLLMQFKPPDQITGLLLIYPYHVVNIIETSFRTMMRILRALNESERIINCYIAHYTDILNKDLPEDEEPRRFTCFDEATIEEIAERPTLAPLIHNRILFVKDNLVHRIYRTYEMLPFDMEPVSLNQYDSSESDEKRFLETLSQLIRLGVFLSEEPMKGQEEYVPEIFKMKLTKILRHLREEHPELVPQQVTVGYFSELSNYPGIIPVQEYLNFYDMPYEITLQSENTWP 299          
BLAST of BLUF domain-containing protein vs. TrEMBL
Match: A0A4E0S266 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_003600 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.792e-45
Identity = 88/288 (30.56%), Postives = 164/288 (56.94%), Query Frame = 1
Query:   76 IDIEDEE--IFSKSIYHFFYDRDSNSGKKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNNRVTGLLLLYPNHAIHILESTDRSILDILKLLNLME-----------------------------INEVGDSQLM--------FSKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWP 822
            +DIED +  + + S+Y    ++    G+   ++ + +V K+ P+  L  +  V  + E  ++ F   +++TGL+++YP H ++I+E++ RS++ +L+ LN  E                              +     QL+           N+IL +  N++ ++Y  +     DMEPA++N +++++ D K ++D + QLT+LG++L KEP+K+Q E+VPE+F +KL+E+L  LR+  P+L+PQQ++VGY +EIS    +I L EY+ +Y+ P+ T L+S++ WP
Sbjct:    1 MDIEDADARLSATSLYQSLEEKGKFMGRVNLLYSVYLVGKISPH--LIDQHDVQSYFEGLLSQFKSPDQITGLVMVYPYHVVNIIETSFRSLMKVLRHLNETEKLINCYIEKCVEKLNRNLPEDSDPIPFTGFDREAKKQLIEKHQHLAPLVDNKILFIRSNLASRVYRTFEVLTFDMEPASLNQYDNSEPDEKKLLDTIIQLTRLGIYLSKEPMKNQEEYVPELFKIKLTEILKRLREDHPELVPQQVVVGYFSEISTFEGIIPLQEYLNFYDLPYETSLQSEVTWP 286          
BLAST of BLUF domain-containing protein vs. TrEMBL
Match: A0A4S2M4M0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002745 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 3.074e-44
Identity = 89/286 (31.12%), Postives = 157/286 (54.90%), Query Frame = 1
Query:   76 IDIED--EEIFSKSIYHFFYDRDSNSGKKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNNRVTGLLLLYPNHAIHILESTDRSILDILKLLNLME----------------------------------INEVGDSQLMFS--KNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIW 819
            +D+ED      + ++Y    ++    G+   ++ I +V K+ P+ +   R+ VA + E  +  F   +++TGLLL+YP H ++I+E++ R+++ IL+ LN  E                                  I E+ +   +     NRIL V  N+  ++Y  Y     DMEP ++N ++S++SD K  ++ ++QL +LGVFL +EP+K Q E+VPEIF +KL+++L +LR+  P+L+PQQ+ VGY +E+S    +I + EY+ +Y+ P+   L+S   W
Sbjct:    8 LDVEDIDARPAATTLYQAIEEKGRFMGRTNILYSIVLVGKVSPHVA--DRREVAAYFEGLLMQFKPPDQITGLLLIYPYHVVNIIETSFRTMMRILRALNESERIINCYIAHYTDILNKDLPEDEEPRRFTCFDEATIEEIAERPTLAPLIHNRILFVKDNLVHRIYRTYEMLPFDMEPVSLNQYDSSESDEKRFLETLSQLIRLGVFLSEEPMKGQEEYVPEIFKMKLTKILRHLREEHPELVPQQVTVGYFSELSNYPGIIPVQEYLNFYDMPYEITLQSGTTW 291          
BLAST of BLUF domain-containing protein vs. Ensembl Nematostella
Match: EDO37997 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE97])

HSP 1 Score: 47.3654 bits (111), Expect = 8.878e-7
Identity = 25/75 (33.33%), Postives = 41/75 (54.67%), Query Frame = 1
Query:  109 SIYHFFYDRDSNSGKKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNNRVTGLLLLYPNHAIHILEST 333
            S+     +++    KK+ +HR+  VSK+ P  + D R +   +   F N   +   V+GLLL+YP H +H+LE T
Sbjct:   18 SLLDLVLEKNRAQNKKQLVHRLVYVSKIRPEVA-DRRDIGEHYERLFKNSPANGEAVSGLLLIYPVHIVHVLEVT 91          
BLAST of BLUF domain-containing protein vs. Planmine SMEST
Match: SMESG000015580.1 (SMESG000015580.1)

HSP 1 Score: 519.235 bits (1336), Expect = 0.000e+0
Identity = 257/257 (100.00%), Postives = 257/257 (100.00%), Query Frame = 1
Query:   64 MTSTIDIEDEEIFSKSIYHFFYDRDSNSGKKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNNRVTGLLLLYPNHAIHILESTDRSILDILKLLNLMEINEVGDSQLMFSKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWPAQRS 834
            MTSTIDIEDEEIFSKSIYHFFYDRDSNSGKKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNNRVTGLLLLYPNHAIHILESTDRSILDILKLLNLMEINEVGDSQLMFSKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWPAQRS
Sbjct:    1 MTSTIDIEDEEIFSKSIYHFFYDRDSNSGKKESIHRITIVSKLPPNKSLDSRQLVADFCERFINGFVDNNRVTGLLLLYPNHAIHILESTDRSILDILKLLNLMEINEVGDSQLMFSKNRILIVSKNISQKLYAQYNTKILDMEPANINLFESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLMNLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDMIWPAQRS 257          
The following BLAST results are available for this feature:
BLAST of BLUF domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TEX479.983e-1625.00testis expressed 47 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of BLUF domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BLUF domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BLUF domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
LO017829.11.212e-1127.67testis expressed 47 [Source:NCBI gene;Acc:10000677... [more]
back to top
BLAST of BLUF domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zdhhc63.052e-725.19zinc finger DHHC-type containing 6 [Source:Xenbase... [more]
back to top
BLAST of BLUF domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tex474.245e-1222.81testis expressed 47 [Source:MGI Symbol;Acc:MGI:191... [more]
Tex474.245e-1222.81testis expressed 47 [Source:MGI Symbol;Acc:MGI:191... [more]
Tex474.245e-1222.81testis expressed 47 [Source:MGI Symbol;Acc:MGI:191... [more]
back to top
BLAST of BLUF domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8TBZ9|TEX47_HUMAN4.794e-1525.00Testis-expressed protein 47 OS=Homo sapiens OX=960... [more]
sp|A0JPP5|TEX47_RAT2.803e-1123.04Testis-expressed protein 47 OS=Rattus norvegicus O... [more]
sp|Q9D5W8|TEX47_MOUSE2.969e-1122.81Testis-expressed protein 47 OS=Mus musculus OX=100... [more]
back to top
BLAST of BLUF domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V3SG743.054e-4531.36Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A504YMQ63.062e-4530.56Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A4S2M4N23.401e-4531.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4E0S2663.792e-4530.56Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A4S2M4M03.074e-4431.12Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of BLUF domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BLUF domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BLUF domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BLUF domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO379978.878e-733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BLUF domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BLUF domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000015580.10.000e+0100.00SMESG000015580.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012881 ID=SMED30012881|Name=BLUF domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=903bp
TTTTTATTTTGTTTTTCATTTGTTTTAATCGATTTATAACTCAAGTATCA
TAGTAACATAATAATGACTTCAACAATTGATATTGAAGATGAAGAAATAT
TTTCTAAATCAATTTATCATTTCTTCTATGATCGCGATTCAAATTCAGGA
AAGAAAGAATCTATACATCGTATAACCATAGTATCAAAACTTCCACCAAA
TAAATCTTTAGATTCCAGGCAGTTAGTAGCGGATTTTTGTGAAAGATTCA
TAAACGGATTTGTTGATAACAATAGAGTAACAGGATTGCTTCTTTTGTAT
CCTAATCATGCAATACATATTTTAGAATCTACAGATCGTTCTATTTTAGA
TATTTTAAAGCTGCTTAATTTAATGGAAATTAATGAAGTTGGAGATTCAC
AACTTATGTTTTCTAAAAATCGAATTCTAATAGTATCGAAAAATATTAGC
CAGAAATTATACGCTCAATACAACACCAAAATATTAGACATGGAACCAGC
TAATATAAATTTATTCGAATCTAATGATTCTGATTATAAAATTGTTATTG
ATGTTATGAATCAGTTAACGAAATTAGGCGTATTTCTTTTTAAAGAACCC
TTGAAAGATCAACGAGAATTCGTTCCAGAAATATTTTCGCTCAAATTATC
AGAAGTTCTAATGAATCTACGCGACAGTGTTCCGGATCTCATTCCACAAC
AAATAATTGTTGGTTATTTAGCCGAAATATCTCAAGATTCATGTTTGATA
AGTTTAAATGAGTATATTCAATATTATGAAAAGCCTTTTTCAACAATACT
GGAATCTGATATGATCTGGCCTGCTCAAAGAAGCAAATTTTTATTCCTGT
AGTTGAAATAGAATTTTTGTTTTGAAATATAAGTTTAGTTTAAATTAAAA
AAA
back to top

protein sequence of SMED30012881-orf-1

>SMED30012881-orf-1 ID=SMED30012881-orf-1|Name=SMED30012881-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=263bp
MTSTIDIEDEEIFSKSIYHFFYDRDSNSGKKESIHRITIVSKLPPNKSLD
SRQLVADFCERFINGFVDNNRVTGLLLLYPNHAIHILESTDRSILDILKL
LNLMEINEVGDSQLMFSKNRILIVSKNISQKLYAQYNTKILDMEPANINL
FESNDSDYKIVIDVMNQLTKLGVFLFKEPLKDQREFVPEIFSLKLSEVLM
NLRDSVPDLIPQQIIVGYLAEISQDSCLISLNEYIQYYEKPFSTILESDM
IWPAQRSKFLFL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0009785blue light signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0009882blue light photoreceptor activity
GO:0071949FAD binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR34035FAMILY NOT NAMEDcoord: 26..256