DNA-directed RNA polymerase subunit

Overview
NameDNA-directed RNA polymerase subunit
Smed IDSMED30012878
Length (bp)5959
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA-directed RNA polymerase subunit (SMED30012878) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA-directed RNA polymerase subunit (SMED30012878) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA-directed RNA polymerase subunit (SMED30012878) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA-directed RNA polymerase subunit (SMED30012878) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012878

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30012878h1SMcG0010290 SmedASXL_016848SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012878h1SMcG0010290 SmedASXL_016848SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30012878h1SMcG0010290 SmedASXL_016847SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30012878h1SMcG0010290 SmedASXL_016847SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Human
Match: POLR2A (RNA polymerase II subunit A [Source:HGNC Symbol;Acc:HGNC:9187])

HSP 1 Score: 1754.96 bits (4544), Expect = 0.000e+0
Identity = 903/1574 (57.37%), Postives = 1154/1574 (73.32%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECE--------KGLNTIIRQ----GCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXXX----YXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSP----KTPHDYFYGLNSP----GMNP 4911
            LR IK VQFG+LS  EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  K +K+LR VCF CSKLLV+ ++PKI++I+ K++G  +KR   +++ CK       IC+  EE +        +G   + ++    GC   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRIS+E+C ++G   +Y+RPE MI+TVL VPP++VRPA+VM  S +  DDLTHKL +IVK+NN++R+ E+NG A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKSLKQRLKGK GRVR NLMGKR D++ARTVIT DPNL++DQVGVPR+IA N+TF E VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G +P+P I KP+ LWTGKQ+FSLIIPG +NC RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTV+NNWLL EGHTIGI D++ ++ T ++I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVVSGAKGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MESVMVKYDATVRN I+Q++QLRYGEDGL G  VEFQ L T K +N  FE+ FRFD  +   L R L E  V+++ + A I  +++ E+E+++ DRE LR  +  +   ++ LPCN+ R+IWNA+  F I+    +D+ P  +V  V+ L  +L++V G+D +S  A  N+TLL    +RS LC +++  + RLS EA +W++GEI + F ++  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG +A+D E AK I   LEHTTLRK+  ++ IYYDP+P+++VV  D++WV  YYE PDFDV + S ++LR+ L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  D+ K +E +E+ D+     +L  I++ +L ++ LQGI QISKVY+  P TD+KK++II   G+F+ ++EWILETDG  L +VL+E+ VD   TTSN I EIF   GIEA R A+E E+ +VISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L     LD  +C   M  +  N+  +G A P                         G+ F        G +PSP  G SP M+P     TP    YG  SP    GM P
Sbjct:   15 LRTIKRVQFGVLSPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKN----ICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLR-VIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLL-----LDAEKCKYGME-IPTNIPGLGAAGPT------------------------GMFF--------GSAPSPMGGISPAMTPWNQGATPA---YGAWSPSVGSGMTP 1541          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Human
Match: POLR2A (RNA polymerase II subunit A [Source:HGNC Symbol;Acc:HGNC:9187])

HSP 1 Score: 1754.96 bits (4544), Expect = 0.000e+0
Identity = 903/1574 (57.37%), Postives = 1154/1574 (73.32%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECE--------KGLNTIIRQ----GCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXXX----YXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSP----KTPHDYFYGLNSP----GMNP 4911
            LR IK VQFG+LS  EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  K +K+LR VCF CSKLLV+ ++PKI++I+ K++G  +KR   +++ CK       IC+  EE +        +G   + ++    GC   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRIS+E+C ++G   +Y+RPE MI+TVL VPP++VRPA+VM  S +  DDLTHKL +IVK+NN++R+ E+NG A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKSLKQRLKGK GRVR NLMGKR D++ARTVIT DPNL++DQVGVPR+IA N+TF E VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G +P+P I KP+ LWTGKQ+FSLIIPG +NC RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTV+NNWLL EGHTIGI D++ ++ T ++I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVVSGAKGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MESVMVKYDATVRN I+Q++QLRYGEDGL G  VEFQ L T K +N  FE+ FRFD  +   L R L E  V+++ + A I  +++ E+E+++ DRE LR  +  +   ++ LPCN+ R+IWNA+  F I+    +D+ P  +V  V+ L  +L++V G+D +S  A  N+TLL    +RS LC +++  + RLS EA +W++GEI + F ++  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG +A+D E AK I   LEHTTLRK+  ++ IYYDP+P+++VV  D++WV  YYE PDFDV + S ++LR+ L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  D+ K +E +E+ D+     +L  I++ +L ++ LQGI QISKVY+  P TD+KK++II   G+F+ ++EWILETDG  L +VL+E+ VD   TTSN I EIF   GIEA R A+E E+ +VISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L     LD  +C   M  +  N+  +G A P                         G+ F        G +PSP  G SP M+P     TP    YG  SP    GM P
Sbjct:   15 LRTIKRVQFGVLSPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKN----ICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLR-VIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLL-----LDAEKCKYGME-IPTNIPGLGAAGPT------------------------GMFF--------GSAPSPMGGISPAMTPWNQGATPA---YGAWSPSVGSGMTP 1541          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Human
Match: POLR2A (RNA polymerase II subunit A [Source:HGNC Symbol;Acc:HGNC:9187])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 315/550 (57.27%), Postives = 408/550 (74.18%), Query Frame = 1
Query:  262 ATVTLREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECE--------KGLNTIIRQ----GCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFL 1866
            +   LR IK VQFG+LS  EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  K +K+LR VCF CSKLLV+ ++PKI++I+ K++G  +KR   +++ CK       IC+  EE +        +G   + ++    GC   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRIS+E+C ++G   +Y+RPE MI+TVL VPP++VRPA+VM  S +  DDLTHKL +IVK+NN++R+ E+NG A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKSLKQRLKGK GRVR NLMGKR D++ARTVIT DPNL++DQVGVPR+IA N+TF E VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL
Sbjct:   11 SACPLRTIKRVQFGVLSPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKN----ICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFL 555          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Human
Match: POLR3A (RNA polymerase III subunit A [Source:HGNC Symbol;Acc:HGNC:30074])

HSP 1 Score: 562.762 bits (1449), Expect = 3.312e-171
Identity = 323/881 (36.66%), Postives = 512/881 (58.12%), Query Frame = 1
Query:  358 IYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPK-IREIMKKTEGSYRKRFDL---IHEECKKVKTCN----------------VICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETKDSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMN-HSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDI--QLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFL-----PSWNGVMPKPTIAKPQRLWTGKQLFSLII-PGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSS-GSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVE 2907
            +Y +  Q   P   G++D R G  +K   C+TC  N+++C GH+G+I+L  P +++GY   +I IL+ +C  C  ++++  + K   + +K+   +Y ++  L   I ++C+K   C+                +I ++ +  +K ++ I+    NF+Q       ++++ E  +   G+ ++ L    V+ +FKRI  ED  ++  N +  +P  +ILT L VPP+ +RP++V +  SG   DDLT KLTEI+ +N+ I++   +G  + +I+E  + LQ   A  +++E + +P+ +    +  +   QRLKGK GR R NL GKR D++ RTVI+ DPNL +D+V VP  +A+ LTFPE+V   N  FL++LV+NG  ++PGA F+ + +       +  +   +  +L YG+IVERH+++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V  PYNADFDGDEMNLH+PQ++EA AE   L      ++TP++  P+++ +QD LT    +T++DTF + A+   ++  +           +P PTI KP  LWTGKQ+FS+I+ P   N  R +      +  G  + +   D+ V I+N +L+ G + K TLGS S  ++ +I+  +   ++  +  + +  +   +L   G +IGI D        +     +N       + I   ++ +L   PG +  +T E  +   L+  RD  GS+  + L K NS   M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV NS+ +GLTPTEFFFH M GREG++DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQ  YG DGLD   +E
Sbjct:   41 LYSQDNQHA-PLLYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQEEKKQFLDYLKRPGLTYLQKRGLKKKISDKCRKKNICHHCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVS---NFLQS--FETAIEHNKEV-EPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLCANDSYVTIQNSELMSGSMDKGTLGSGSKNNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAGYKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 913          

HSP 2 Score: 171.4 bits (433), Expect = 6.961e-42
Identity = 122/414 (29.47%), Postives = 207/414 (50.00%), Query Frame = 1
Query: 3376 NRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISK--VYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            +R++   +E  +   R+ + ++Q+ PG  VG+L A+S+GEP TQMTL TFHFAGV++ N+TLGVPR+KEIIN S+   TP +T +L      D + A+ +   +E T L +++   E  + PD    +V+   + +R        +V+ +++        R  I   KL ++     +       ++C  P EN                           Y+       L ++ +QGIP++S+  +++ + +  +K +L++                +G  L  V+A   V    TTSN+  E+ +T GIEAAR  I  E+   +   G  ++ RH+ LL ++MT+KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    +GTG F +L
Sbjct: 1004 DRITPTQVEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAISTPIITAQL--DKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLLR----LEVNAETV--------RYSICTSKLRVKPGDVAV---HGEAVVCVTPREN---------------------SKSSMYYVLQFLKEDLPKVVVQGIPEVSRAVIHIDEQSGKEKYKLLV----------------EGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGIEAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLL 1363          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Human
Match: POLR1A (RNA polymerase I subunit A [Source:HGNC Symbol;Acc:HGNC:17264])

HSP 1 Score: 331.643 bits (849), Expect = 2.622e-91
Identity = 214/644 (33.23%), Postives = 318/644 (49.38%), Query Frame = 1
Query: 1132 LQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDR-----IDLKRR---------PDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFS-TFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPK--------PTIAKPQRLWTGKQLFSL----IIP---------GKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWL-LFEGHTIGIVDTLYNA-------------------ATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLD 2892
            LQ HV  + D+E   L +           ++Q L+ K G  R ++MGKR DY AR+VI  D  +N +++G+P   A  LT+P+ VTP+N + L+Q V NG  ++PGA  VI E+G R     +D+ +R         P +   +    +IV RH+ N D ++ NRQPTLH+ S+  HR ++LP     RL+ +    YNADFDGDEMN H PQS+   AE   LA  ++  + P+  +P+  ++QD + +   MT R  F      M L+     + G+  K        P+I KP  LWTGKQ+ S     IIP         GK                  +   S  +++V+I  G+L+ G+L K   GSS+  L+H        +  G     +  +   +L L+ G T+G+ D L                      A R  +      + D+V       H  + +      +   F+E+VN   NE                NS  +MV SGAKGS +N  Q+   +GQ  +EG+R P     ++LP F   +F P + GFV   +L G+ P EFFFH M GREG++DTAVKT+ +GY+QR ++K +E ++V+YD TVR+    ++Q  YGEDGLD
Sbjct:  394 LQSHVNIVFDSEMDKLMMD------KYPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMYINTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSAVDMTQREAVAKQLLTPATGAPKPQGTKIVCRHVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHYANCKAYNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGLIQDHMVSGASMTTRGCFFTREHYMELV-----YRGLTDKVGRVKLLSPSILKPFPLWTGKQVVSTLLINIIPEDHIPLNLSGKAKITGKAWVKETPRSVPGFNPDSMCESQVIIREGELLCGVLDKAHYGSSAYGLVHCCYEIYGGETSGKVLTCLARLFTAYLQLYRGFTLGVEDILVKPKADVKRQRIIEESTHCGPQAVRAALNLPEAASYDEVRGKWQDAHLGK-DQRDFNMIDLKFKEEVNHYSNEINKACMPFGLHRQFPENSLQMMVQSGAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPYEFTPRAGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGYLQRCIIKHLEGLVVQYDLTVRDSDGSVVQFLYGEDGLD 1025          

HSP 2 Score: 86.2705 bits (212), Expect = 5.619e-16
Identity = 51/103 (49.51%), Postives = 67/103 (65.05%), Query Frame = 1
Query: 3385 SLEALEWIIGEIRNI----FYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTIRLLGA--AAKDVEIAKK 3672
            S E  E  +  +R +    + +S   PGE VG LAA+S+GEP+TQMTLNTFHFAG    NVTLG+PRL+EI+ V S N KTP +++ +L    A K V+  KK
Sbjct: 1181 SYEKSELSLDRLRTLLQLKWQRSLCEPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIKTPMMSVPVLNTKKALKRVKSLKK 1283          

HSP 3 Score: 80.1073 bits (196), Expect = 4.198e-14
Identity = 51/168 (30.36%), Postives = 88/168 (52.38%), Query Frame = 1
Query: 4108 VYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLA-ERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDI 4608
            +Y +K  T    R ++N   + +  +E +L T+G  LP++      +D     SN I  I  T+GIEAA   IE E+ +V +  G  V+ RHL+L+ + M  +G    ++R GI R  +  L + +FE +   L +A      D ++  S  +++G++ R GTG F++
Sbjct: 1492 IYATKGIT----RCLLNETTNNKNEKELVLNTEGINLPELFKYAEVLDLRRLYSNDIHAIANTYGIEAALRVIEKEIKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGI-RSNSSPLQQMTFETSFQFLKQATMLGSHDELRSPSACLVVGKVVRGGTGLFEL 1654          

HSP 4 Score: 57.7658 bits (138), Expect = 3.128e-7
Identity = 29/68 (42.65%), Postives = 34/68 (50.00%), Query Frame = 1
Query:  382 GKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKL 585
            G P  NGL D   GP D   +C TC  + S C GH GHI L   VYN    +K+  +LR  C  C  L
Sbjct:   43 GNPSANGLYDLALGPADSKEVCSTCVQDFSNCSGHLGHIELPLTVYNPLLFDKLYLLLRGSCLNCHML 110          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Celegans
Match: ama-1 (DNA-directed RNA polymerase II subunit RPB1 [Source:UniProtKB/Swiss-Prot;Acc:P16356])

HSP 1 Score: 1746.87 bits (4523), Expect = 0.000e+0
Identity = 883/1584 (55.74%), Postives = 1141/1584 (72.03%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLNTI----------IRQGCNFVQPKFRRNGLDYSMETK---DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXX--XYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGG------ATPMNXXXXXXXXXXXXXXXXXXXXTGF---------GLAFSPSGFSEAGMSPSPGLGFSP--------MMSPKTPHDYFYGLNSPGM 4905
            LR +  VQFGIL   E++ +       + +PE  ++GKPK  GLMDPRQG +D+   C TC+GN+++CPGHFGH+ LA+PV++IG+  K +KILR VCF C +LL++   P++ EI+KKT  + +KR  +I++ CK       +C+ + E E+G+             +  GC   QP +RR G+D + E K   + D  + K  L A +V+EVF++I++ED +++G + +++RPE MI TVL VPP+AVRPA+V   S K  DDLTHKL++I+K N ++++ E NG A+ ++ +    LQ+HVATL+DN    LP A QK GRPLKS+KQRLKGK GR+R NLMGKR D++ARTVITADPNL +D VGVPR IAQNLTFPE VTPFN   LQ+LV  G T YPGAK++IRENG R+DL+  P ++D+ L  G  VERHM + D +VFNRQPTLHKMSMMGHRVK+LP+STFR+NLSVT PYNADFDGDEMNLH+PQS E  AEI  +A V + +ITPQ+N+PVM IVQD+L A   MT RD F++   MM LLM+LP+W+G +P+P I KP+ LWTGKQ+FSLIIPG VN  RTHSTHP+SEDSGPYKWIS  DT+V+IE+G+L+ GI+C KT+G S+G+L+H++ LE   +   NF+++IQTV+N WL+ EGHTIGI DT+ + AT  +I+  I KAK DV D I K H+++L  TPG +L QTFE KVN ILN+ARD+TGSSAQKSLS++N+F  MVVSG+KGSKINISQVIACVGQQNVEGKRIPFGF+ RTLPHFIK D+GPES+GFVENSYLAGLTP+EFFFHAMGGREG+IDTAVKTAETGYIQRRL+KAMESVMV YD TVRN + Q++QLRYGEDGLDG +VE Q +PT K NN  FER+FR D+ D   L ++ +E  V+EI+   D ++ +++EW QL+ DR  LR+        ++ LPCN+QRLIWNA+  FK+D+ K  ++ P  +++ VR L  +LI+V GND IS  A  N+TLL+  L+RS LC K +   ++L+ EA +W++GEI + F ++   PGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKEIINVS+  KTPSLT+ L GAAAKD E AK +   LEHTTL+K+  ++ IYYDPDP+N+V+  D +WV  +YE PD D+ + S ++LRI L RK++ DKKL+++ IA++I   F ND+     D+N + LV R+R+  +D  + +E    +     +L  I+  +L ++ LQGIP ISKVY+++P TDDKKR+II  +G F+ V +WILETDGT L +VL+ER +D   TTSN I EIFE  GIEA R AIE EM NVISFDGSYVNYRHLALLC++MT KG LM+I RHGINRQE GAL R SFEETVDILMEA  HAE DP+KGVSE+IMLGQLAR GTGCFD++     LD  +C   M  + QN+ M GG       +P N           S      +   +         G  FSP+G ++ G SP    G+SP         +SP+TP    YG  SPG+
Sbjct:   12 LRIVSRVQFGILGPEEIKRM---SVAHVEFPEVYENGKPKLGGLMDPRQGVIDRRGRCMTCAGNLTDCPGHFGHLELAKPVFHIGFLTKTLKILRCVCFYCGRLLIDKSAPRVLEILKKTGTNSKKRLTMIYDLCK----AKSVCEGAAEKEEGMPDDPDDPMNDGKKVAGGCGRYQPSYRRVGIDINAEWKKNVNEDTQERKIMLTAERVLEVFQQITDEDILVIGMDPQFARPEWMICTVLPVPPLAVRPAVVTFGSAKNQDDLTHKLSDIIKTNQQLQRNEANGAAAHVLTDDVRLLQFHVATLVDNCIPGLPTATQKGGRPLKSIKQRLKGKEGRIRGNLMGKRVDFSARTVITADPNLPIDTVGVPRTIAQNLTFPEIVTPFNVDKLQELVNRGDTQYPGAKYIIRENGARVDLRYHPRAADLHLQPGYRVERHMKDGDIIVFNRQPTLHKMSMMGHRVKILPWSTFRMNLSVTSPYNADFDGDEMNLHLPQSLETRAEIEEIAMVPRQLITPQANKPVMGIVQDTLCAVRMMTKRDVFIDWPFMMDLLMYLPTWDGKVPQPAILKPKPLWTGKQVFSLIIPGNVNVLRTHSTHPDSEDSGPYKWISPGDTKVIIEHGELLSGIVCSKTVGKSAGNLLHVVTLELGYEIAANFYSHIQTVINAWLIREGHTIGIGDTIADQATYLDIQNTIRKAKQDVVDVIEKAHNDDLEPTPGNTLRQTFENKVNQILNDARDRTGSSAQKSLSEFNNFKSMVVSGSKGSKINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIKDDYGPESKGFVENSYLAGLTPSEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSLAQMVQLRYGEDGLDGMWVENQNMPTMKPNNAVFERDFRMDLTDNKFLRKNYSEDVVREIQESEDGISLVESEWSQLEEDRRLLRKIFPRGDA-KIVLPCNLQRLIWNAQKIFKVDLRKPVNLSPLHVISGVRELSKKLIIVSGNDEISKQAQYNATLLMNILLRSTLCTKNMCTKSKLNSEAFDWLLGEIESRFQQAIAQPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKTLKTPSLTVFLTGAAAKDPEKAKDVLCKLEHTTLKKVTCNTAIYYDPDPKNTVIAEDEEWVSIFYEMPDHDLSRTSPWLLRIELDRKRMVDKKLTMEMIADRIHGGFGNDVHTIYTDDNAEKLVFRLRIAGEDKGEAQEEQVDKMEDDVFLRCIEANMLSDLTLQGIPAISKVYMNQPNTDDKKRIIITPEGGFKSVADWILETDGTALLRVLSERQIDPVRTTSNDICEIFEVLGIEAVRKAIEREMDNVISFDGSYVNYRHLALLCDVMTAKGHLMAITRHGINRQEVGALMRCSFEETVDILMEAAVHAEEDPVKGVSENIMLGQLARCGTGCFDLV-----LDVEKCKYGME-IPQNVVMGGGFYGSFAGSPSNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPFNEGGWSPASPGDPLGALSPRTPS---YGGMSPGV 1578          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Celegans
Match: ama-1 (DNA-directed RNA polymerase II subunit RPB1 [Source:UniProtKB/Swiss-Prot;Acc:P16356])

HSP 1 Score: 1746.87 bits (4523), Expect = 0.000e+0
Identity = 883/1584 (55.74%), Postives = 1141/1584 (72.03%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLNTI----------IRQGCNFVQPKFRRNGLDYSMETK---DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXX--XYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGG------ATPMNXXXXXXXXXXXXXXXXXXXXTGF---------GLAFSPSGFSEAGMSPSPGLGFSP--------MMSPKTPHDYFYGLNSPGM 4905
            LR +  VQFGIL   E++ +       + +PE  ++GKPK  GLMDPRQG +D+   C TC+GN+++CPGHFGH+ LA+PV++IG+  K +KILR VCF C +LL++   P++ EI+KKT  + +KR  +I++ CK       +C+ + E E+G+             +  GC   QP +RR G+D + E K   + D  + K  L A +V+EVF++I++ED +++G + +++RPE MI TVL VPP+AVRPA+V   S K  DDLTHKL++I+K N ++++ E NG A+ ++ +    LQ+HVATL+DN    LP A QK GRPLKS+KQRLKGK GR+R NLMGKR D++ARTVITADPNL +D VGVPR IAQNLTFPE VTPFN   LQ+LV  G T YPGAK++IRENG R+DL+  P ++D+ L  G  VERHM + D +VFNRQPTLHKMSMMGHRVK+LP+STFR+NLSVT PYNADFDGDEMNLH+PQS E  AEI  +A V + +ITPQ+N+PVM IVQD+L A   MT RD F++   MM LLM+LP+W+G +P+P I KP+ LWTGKQ+FSLIIPG VN  RTHSTHP+SEDSGPYKWIS  DT+V+IE+G+L+ GI+C KT+G S+G+L+H++ LE   +   NF+++IQTV+N WL+ EGHTIGI DT+ + AT  +I+  I KAK DV D I K H+++L  TPG +L QTFE KVN ILN+ARD+TGSSAQKSLS++N+F  MVVSG+KGSKINISQVIACVGQQNVEGKRIPFGF+ RTLPHFIK D+GPES+GFVENSYLAGLTP+EFFFHAMGGREG+IDTAVKTAETGYIQRRL+KAMESVMV YD TVRN + Q++QLRYGEDGLDG +VE Q +PT K NN  FER+FR D+ D   L ++ +E  V+EI+   D ++ +++EW QL+ DR  LR+        ++ LPCN+QRLIWNA+  FK+D+ K  ++ P  +++ VR L  +LI+V GND IS  A  N+TLL+  L+RS LC K +   ++L+ EA +W++GEI + F ++   PGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKEIINVS+  KTPSLT+ L GAAAKD E AK +   LEHTTL+K+  ++ IYYDPDP+N+V+  D +WV  +YE PD D+ + S ++LRI L RK++ DKKL+++ IA++I   F ND+     D+N + LV R+R+  +D  + +E    +     +L  I+  +L ++ LQGIP ISKVY+++P TDDKKR+II  +G F+ V +WILETDGT L +VL+ER +D   TTSN I EIFE  GIEA R AIE EM NVISFDGSYVNYRHLALLC++MT KG LM+I RHGINRQE GAL R SFEETVDILMEA  HAE DP+KGVSE+IMLGQLAR GTGCFD++     LD  +C   M  + QN+ M GG       +P N           S      +   +         G  FSP+G ++ G SP    G+SP         +SP+TP    YG  SPG+
Sbjct:   12 LRIVSRVQFGILGPEEIKRM---SVAHVEFPEVYENGKPKLGGLMDPRQGVIDRRGRCMTCAGNLTDCPGHFGHLELAKPVFHIGFLTKTLKILRCVCFYCGRLLIDKSAPRVLEILKKTGTNSKKRLTMIYDLCK----AKSVCEGAAEKEEGMPDDPDDPMNDGKKVAGGCGRYQPSYRRVGIDINAEWKKNVNEDTQERKIMLTAERVLEVFQQITDEDILVIGMDPQFARPEWMICTVLPVPPLAVRPAVVTFGSAKNQDDLTHKLSDIIKTNQQLQRNEANGAAAHVLTDDVRLLQFHVATLVDNCIPGLPTATQKGGRPLKSIKQRLKGKEGRIRGNLMGKRVDFSARTVITADPNLPIDTVGVPRTIAQNLTFPEIVTPFNVDKLQELVNRGDTQYPGAKYIIRENGARVDLRYHPRAADLHLQPGYRVERHMKDGDIIVFNRQPTLHKMSMMGHRVKILPWSTFRMNLSVTSPYNADFDGDEMNLHLPQSLETRAEIEEIAMVPRQLITPQANKPVMGIVQDTLCAVRMMTKRDVFIDWPFMMDLLMYLPTWDGKVPQPAILKPKPLWTGKQVFSLIIPGNVNVLRTHSTHPDSEDSGPYKWISPGDTKVIIEHGELLSGIVCSKTVGKSAGNLLHVVTLELGYEIAANFYSHIQTVINAWLIREGHTIGIGDTIADQATYLDIQNTIRKAKQDVVDVIEKAHNDDLEPTPGNTLRQTFENKVNQILNDARDRTGSSAQKSLSEFNNFKSMVVSGSKGSKINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIKDDYGPESKGFVENSYLAGLTPSEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSLAQMVQLRYGEDGLDGMWVENQNMPTMKPNNAVFERDFRMDLTDNKFLRKNYSEDVVREIQESEDGISLVESEWSQLEEDRRLLRKIFPRGDA-KIVLPCNLQRLIWNAQKIFKVDLRKPVNLSPLHVISGVRELSKKLIIVSGNDEISKQAQYNATLLMNILLRSTLCTKNMCTKSKLNSEAFDWLLGEIESRFQQAIAQPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKTLKTPSLTVFLTGAAAKDPEKAKDVLCKLEHTTLKKVTCNTAIYYDPDPKNTVIAEDEEWVSIFYEMPDHDLSRTSPWLLRIELDRKRMVDKKLTMEMIADRIHGGFGNDVHTIYTDDNAEKLVFRLRIAGEDKGEAQEEQVDKMEDDVFLRCIEANMLSDLTLQGIPAISKVYMNQPNTDDKKRIIITPEGGFKSVADWILETDGTALLRVLSERQIDPVRTTSNDICEIFEVLGIEAVRKAIEREMDNVISFDGSYVNYRHLALLCDVMTAKGHLMAITRHGINRQEVGALMRCSFEETVDILMEAAVHAEEDPVKGVSENIMLGQLARCGTGCFDLV-----LDVEKCKYGME-IPQNVVMGGGFYGSFAGSPSNREFSPAHSPWNSGVTPTYAGAAWSPTTGGMSPGAGFSPAGNTDGGASPFNEGGWSPASPGDPLGALSPRTPS---YGGMSPGV 1578          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Celegans
Match: rpc-1 (DNA-directed RNA polymerase subunit [Source:UniProtKB/TrEMBL;Acc:Q18566])

HSP 1 Score: 684.871 bits (1766), Expect = 0.000e+0
Identity = 473/1451 (32.60%), Postives = 744/1451 (51.27%), Query Frame = 1
Query:  385 KPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKI--REIMKKT-EGSYRKRF-DLIHEECKKVKTCNVICDESEECEKGLNTIIRQGCNFVQP-KFRRNGLDYSMETKDSDDGKGKQ--------PLYAHQVVEVFKRISNEDC-IIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMN-HSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGT-MYPGAKFVI-RENGDRIDLKR-RPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGV------MPKPTIAKPQRLWTGKQLFSLII-PGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSG-SLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGL--------DGGFVEF-QVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQ-EIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLK--RKKITDKKLSLQSIAEKITEYFKNDIICHVPDEN-LDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNF 4620
            +P   G +DP+ G   K   C TC   +++C GHFG+ +L  PV++IG+ +  I++L+ +C  CS +L+     ++  R++M    +  +RK     I   CKK  TC+    ++   +K +  +++    F  P      G   +M + + + G   +        PL+   V ++F  I   D  ++M  + +   P  ++LT + VPP+ +RP++V    +G   DD+T KL EI+  N+ +++ + +G  S  + E    LQ   A  +++E + LP  +Q   R +++  QRLKGK GR R NL GKR D++ RTVI+ DPNL +DQVGVP  +A  LTFPE V   N + ++QLV NG+ ++PGA +++ ++ G++  LK  + D     L  G+ +ERH+ ++D V+FNRQP+LHK+S+M HR KV+P  TFR N     PYNADFDGDEMNLH+PQ+ EA AE + L  V   +ITP+S  P+++ +QD +T    +T +DTFL  AE+      L   +        +P P I +P  LWTGKQL  LII P K +    + T      +G  +  S  D+ V+I N  L+ G L K  LGSSS  ++ +++  +   D   +    +  +   +L   G +IGI D   +     E    ++         I +    +L + PG +  +T E  +   L+  RD  G    ++LSKYN+   M V G+KGS INISQ+IACVGQQ + G R P GF++R+LPHF +    PE++GFV NS+ +GLTPTEFFFH MGGREG++DTAVKTAETGY+QRRL+K +E +   YD TVR+ +  +I+  +GEDGL        DG  V+F  VL   K  N+   +     +D +D++ +   +K+ + +  + AD L++      Q +I +    +  K   G                         +  D+K  +     +NL                A + S L   CL ++ LC    +C  +++                ++   PG  VG++AA S+GEP+TQMTL TFHFAGV++ N+T GVPR+KEIIN  +   TP +T  LL     D  +A+++ A +E TTL ++    E  Y PD               Y+     +  +  L  L + ++     I   K+  Q    KI  + K  +    P  + L   + +++L                          L  + ++GIP +++  +     D+K       KGDF     + L  +GT    VL+   VD   T  N+   + +  GIEAAR+ I  E+   +   G  ++ RH+ LL ++MT++G ++ I R+G+ + +   L  +SFE+T+D L EA   ++ D + GVSE I++G    +GTG F ++  +
Sbjct:   50 QPANYGPLDPKMGVSTKTGTCSTCGLGLTDCVGHFGYFDLDVPVFHIGFFKLTIQLLQCICKNCSSILLTPEQHRVFSRQVMNPNLDYLHRKALHKRIVAACKKGSTCSHCGLKNGTVKKAVGAVLKIA--FASPVSVDELGKFATMFSSNQEVGDHVRKMKFTLLNPLF---VQKLFSNIKEGDIPVLMVRSGEEKHPNDLLLTRMPVPPVCIRPSVVSEVKAGTTEDDVTMKLMEIMLTNDVLKKHKRDGAPSKTLFETWEHLQIQCALYINSEMSGLPPDMQPK-RAMRAFTQRLKGKQGRFRGNLCGKRVDFSGRTVISPDPNLRIDQVGVPIHVAMTLTFPEIVNASNIEKMRQLVINGSDVHPGANYLVEKKTGNKKLLKYGKRDELAKNLRMGDTIERHLDDNDVVLFNRQPSLHKISIMSHRAKVMPGRTFRFNECACTPYNADFDGDEMNLHLPQTYEAKAEASELMNVKNNLITPRSGEPLVAAIQDFITGGYLLTHKDTFLPRAEVYRFAAALIDASAKKQTKIRIPPPAIRRPVELWTGKQLIELIIRPDKGSDVSLNLTAKNKSYTGNLELCSK-DSYVIIRNSVLLAGCLDKSLLGSSSKVNIFYMLMRDYGEDAAVDAMWRLARMAPVFLSNRGFSIGIGDVRPSEQLLREKGQLVDNGYSKCSQYIKELEEGKLKAQPGCTEEETLESIILRELSTIRDHAGQVCLRNLSKYNAPLTMAVCGSKGSFINISQMIACVGQQAISGHRPPDGFEERSLPHFERKKKTPEAKGFVANSFYSGLTPTEFFFHTMGGREGLVDTAVKTAETGYMQRRLVKCLEDLCASYDGTVRSSVGDVIEFVFGEDGLDPAMMEAKDGSVVDFTHVLEHAK--NIQTTKEQPIPVDKLDEVLKAEIQKKFKGKYVHFADKLSEY---ITQTEIKKSKKWQNGKAHCGNH-----------------------ETADLKTKESCKICKNL---------------EAYKTSLLANSCLTKTQLCSFIELCYYKVA----------------RAITEPGTAVGAIAATSIGEPSTQMTLKTFHFAGVASMNITQGVPRIKEIINAVKTISTPIITAALLDPY--DESLARRVKARIEKTTLGEICDYIEEVYLPD--------------DYFLLVKLNSKRIRLLQLEVCMESISYAIATSKVCPQMRGCKIVAHGKTMMAIRPPSTSKLSKTMTMQIL-----------------------KYSLANVVVKGIPSVNRCVIH---ADEK-------KGDF-----YSLLVEGTDFRSVLSSVGVDPRKTNFNNALVVADVLGIEAARSCIINEIIATMDAHGIGLDRRHVMLLADVMTYRGEVLGITRNGLVKMKDSVLLLASFEKTMDHLFEAAFFSQRDVIHGVSECIIMGTPMTVGTGTFKLMQKY 1380          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Celegans
Match: rpoa-1 (DNA-directed RNA polymerase subunit [Source:UniProtKB/TrEMBL;Acc:G5EDG7])

HSP 1 Score: 340.117 bits (871), Expect = 3.169e-94
Identity = 233/727 (32.05%), Postives = 358/727 (49.24%), Query Frame = 1
Query:  940 ESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIR----------QAEENGVASTIILEKENSLQYHVA--TLMDNESTFLPVAIQKSGR-PLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGT-MYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEI--------------VERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFS-TFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLM--FLPSWNGV-MPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYK-----WI---------SHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIG-NFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNEL---------NSTPG---RSLLQTF------EEKVNMI---LNEARDKTGSSAQKS--------LSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLD 2892
            + + L  + VPP   RP I M    +  D  T  L ++++    I            A+   + +  +  K  + Q H A   L    +      + K  R  +  +KQ L+ K G  R ++MGKR ++  R+VIT DP L++D++G+P   A+ LTF E V  FN   ++ L+R G   +PGA F +  +G +  L  +P+    ++   +               V RHM N D ++ NRQP+LHK S++GHR +VL      R+N +    YNADFDGDEMN H+ QS  A  E+  +A V    + P+   P++ ++QD + +   +++RD FLN  + MHL++  F      + +P PTI  P+RLWTGKQ+ + I+    NC       P     G  K     WI           +++ V+   G+L++G+L K   G++   L H  A E      G    +    +   +L F G T+G+ D L        +K    K K+ V ++ T G  N++          +TP    R+L  T+         V M+   + +   K   +  KS        L   N+  LM+ SGAKGS +N  Q+  C+GQ  +EGKR+      RTLP F   D  P + G+++  +L G+ P E FFH M GREG+IDTAVKT+ +GY+QR ++K +E + V YD+TVR+    +IQ RYGEDG+D
Sbjct:  351 DGLFLERILVPPKKFRP-IRMFKGAQYEDPQTLNLRKVLEATETISAISLIMKGDTSAQLKELIANRVRGKTINAQMHDAYLQLQLRANAIFDQDLNKGDRDSIAGIKQILEKKQGLFRMHMMGKRVNFACRSVITPDPYLDIDEIGIPDIFAKKLTFTEPVNAFNVNEMKGLLRQGPHQHPGANFFVEPSGKKTMLGDKPEEKKRRMQMAKTLNAATTENLRQTPKVLRHMKNGDMIMMNRQPSLHKPSILGHRARVLTGQRALRMNYAPCKAYNADFDGDEMNGHLVQSHIAQTEVREIANVGSNFLVPKDATPLLGLIQDHVVSGVLLSVRDRFLNKEDFMHLVLASFAQYSKRIEIPPPTILYPKRLWTGKQVITTIVK---NC--IPDGKPLINLDGKAKTPLSCWIVPGFDAPQFDMSESHVVFRQGELLVGVLDKAHFGATQFGLAH-CAFELYGHRCGVQLLSCFSRLFTTYLQFHGFTLGVADILV-------VKDADGKRKEAVMESRTIG--NQVVKTAFGLPDTATPAEIKRTLAATYCNPRGQGTDVKMLDFGMKQGIAKYNDAITKSCVPTGLLRLFPQNALQLMIQSGAKGSAVNAIQISGCLGQIELEGKRMAVTIAGRTLPSFRCFDPSPRAGGYIDQRFLTGMNPQELFFHTMAGREGLIDTAVKTSRSGYLQRCIIKHLEGIRVHYDSTVRDHDGSVIQFRYGEDGMD 1061          

HSP 2 Score: 87.0409 bits (214), Expect = 1.560e-16
Identity = 43/82 (52.44%), Postives = 59/82 (71.95%), Query Frame = 1
Query: 3421 RNIFYK---SQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEII-NVSRNPKTPSLTIRLLGAAAKD 3654
            R +++K   S   PGE VG LAA+S+GEP+TQMTLNTFHFAG    NVTLG+PRL+EI+   S++  TPS +I ++   ++D
Sbjct: 1218 RTLYWKGMRSLADPGENVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMTASKSIATPSASIAVIAGTSRD 1299          

HSP 3 Score: 82.0333 bits (201), Expect = 4.132e-15
Identity = 52/146 (35.62%), Postives = 74/146 (50.68%), Query Frame = 1
Query: 4183 EEWILETDGTCLPKVLAERYV-DSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMN 4617
            E  IL+T G  L        V D  +  SN +  I E +G+EA   AI  EM NV +  G  V+ RHL+L  + MT  G +   +R G     +  L + +FE T+  L EA  H E D +   S  +++G L R GTG FD+L++
Sbjct: 1569 EMTILQTQGVNLAAFFKHADVLDVNSVYSNDLNLILENYGVEACSKAITTEMNNVFAVYGIEVSKRHLSLTADYMTFTGQIQPFNR-GAMSSSSSPLQKMTFETTMAFLREALLHGEEDNVNSPSARLVMGALPRGGTGSFDLLLD 1713          

HSP 4 Score: 63.929 bits (154), Expect = 1.362e-9
Identity = 28/68 (41.18%), Postives = 36/68 (52.94%), Query Frame = 1
Query:  382 GKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKL 585
            G P   GL DP  GP + + MC TC+     CPGH GHI LA PV+N    +    +L+  C  C +L
Sbjct:   46 GHPIAGGLYDPILGPDNTFDMCMTCNQYERHCPGHMGHIQLAVPVFNPLLFQFTYNLLKGSCVHCHRL 113          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Celegans
Match: rpoa-1 (DNA-directed RNA polymerase subunit [Source:UniProtKB/TrEMBL;Acc:G5EDG7])

HSP 1 Score: 59.3066 bits (142), Expect = 4.533e-10
Identity = 35/96 (36.46%), Postives = 52/96 (54.17%), Query Frame = 1
Query: 4330 EMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMN 4617
            EM NV +  G  V+ RHL+L  + MT  G +   +R G     +  L + +FE T+  L EA  H E D +   S  +++G L R GTG FD+L++
Sbjct:    2 EMNNVFAVYGIEVSKRHLSLTADYMTFTGQIQPFNR-GAMSSSSSPLQKMTFETTMAFLREALLHGEEDNVNSPSARLVMGALPRGGTGSFDLLLD 96          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Fly
Match: RpII215 (gene:FBgn0003277 transcript:FBtr0073542)

HSP 1 Score: 1760.73 bits (4559), Expect = 0.000e+0
Identity = 886/1548 (57.24%), Postives = 1144/1548 (73.90%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLNTIIRQ----------GCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXX----XXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLP------MMSGVAQNLFMVGGAT-----PMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEA-GMSPS 4827
            LR++K VQFGILS  E+R +SV++  G+ + E  + G+PK  GLMDPRQG +D+ S CQTC+GN++ECPGHFGHI+LA+PV++IG+  K IKILR VCF CSK+LV+ H+PKI+EI+ K+ G  RKR   +++ CK       IC+  E+ +  L    +Q          GC   QP  RR GLD + E K  + D  + K  + A +V E+ K I++E+C I+G + KY+RP+ MI+TVL VPP+AVRPA+VM  + K  DDLTHKL++I+K NNE+R+ E +G A+ +I E    LQ+HVATL+DN+   +P A+QKSG+PLK++K RLKGK GR+R NLMGKR D++ARTVIT DPNL +DQVGVPR+IAQNLTFPE VTPFN   +Q+LVR G + YPGAK+++R+NG+RIDL+  P SSD+ L  G  VERH+ +DD V+FNRQPTLHKMSMMGHRVKVLP+STFR+NLS T PYNADFDGDEMNLH+PQS E  AE+ N+    + +ITPQ+N+PVM IVQD+LTA  KMT RD F+   ++M+LLMFLP+W+  MP+P I KP+ LWTGKQ+FSLIIPG VN  RTHSTHP+ ED GPYKWIS  DT+V++E+G+LIMGILCKK+LG+S+GSL+HI  LE   D  G F+ NIQTV+NNWLLFEGH+IGI DT+ +  T  EI+  I KAKDDV + I K H+ EL  TPG +L QTFE KVN ILN+ARDKTG SA+KSL++YN+   MVVSG+KGS INISQVIACVGQQNVEGKRIP+GF++RTLPHFIK D+GPESRGFVENSYLAGLTP+EF+FHAMGGREG+IDTAVKTAETGYIQRRL+KAMESVMV YD TVRN + QLIQLRYGEDGL G  VEFQ +PT K++N +FE+ F+FD  +   + +  T+  ++E+ + ++ + +++AEW++L  DR+ LR+        ++ LPCN+QR+IWN +  F I+    TD+ P  ++  V+ L    ++V GNDRIS  AN N+TLL  CLIRS LC K V  + RLS EA EW++GEI   F ++Q +PGEMVG+LAA+SLGEPATQMTLNTFHFAGVS+KNVTLGVPRLKEIIN+S+ PK PSLT+ L G AA+D E AK +   LEHTTLRK+  ++ IYYDPDP+ +V+  D+++V  YYE PDFD  + S ++LRI L RK++TDKKL+++ IAEKI   F  D+ C   D+N D LVLRIR++  ++ K    +E  D+MED  +L  I+  +L ++ LQGI  I KVY+  P TD KKR++I   G+F+ + EW+LETDGT + KVL+ER VD   T+SN I EIF+  GIEA R ++E EM  V+ F G YVNYRHLALLC++MT KG LM+I RHGINRQ+TGAL R SFEETVD+LM+A AHAE DPM+GVSE+I++GQL +MGTGCFD+L++  +      +P      M+ G A  +F+ GG+T     PM   +   +    S     ++ T  G +FSPS  S+A GMSPS
Sbjct:   11 LRQVKRVQFGILSPDEIRRMSVTEG-GVQFAETMEGGRPKLGGLMDPRQGVIDRTSRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTIKILRCVCFYCSKMLVSPHNPKIKEIVMKSRGQPRKRLAYVYDLCKG----KTICEGGEDMD--LTKENQQPDPNKKPGHGGCGHYQPSIRRTGLDLTAEWKHQNEDSQEKKIVVSAERVWEILKHITDEECFILGMDPKYARPDWMIVTVLPVPPLAVRPAVVMFGAAKNQDDLTHKLSDIIKANNELRKNEASGAAAHVIQENIKMLQFHVATLVDNDMPGMPRAMQKSGKPLKAIKARLKGKEGRIRGNLMGKRVDFSARTVITPDPNLRIDQVGVPRSIAQNLTFPELVTPFNIDRMQELVRRGNSQYPGAKYIVRDNGERIDLRFHPKSSDLHLQCGYKVERHLRDDDLVIFNRQPTLHKMSMMGHRVKVLPWSTFRMNLSCTSPYNADFDGDEMNLHVPQSMETRAEVENIHITPRQIITPQANKPVMGIVQDTLTAVRKMTKRDVFITREQVMNLLMFLPTWDAKMPQPCILKPRPLWTGKQIFSLIIPGNVNMIRTHSTHPDEEDEGPYKWISPGDTKVMVEHGELIMGILCKKSLGTSAGSLLHICFLELGHDIAGRFYGNIQTVINNWLLFEGHSIGIGDTIADPQTYNEIQQAIKKAKDDVINVIQKAHNMELEPTPGNTLRQTFENKVNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACVGQQNVEGKRIPYGFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEFYFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSVGQLIQLRYGEDGLCGELVEFQNMPTVKLSNKSFEKRFKFDWSNERLMKKVFTDDVIKEMTDSSEAIQELEAEWDRLVSDRDSLRQIFPNGE-SKVVLPCNLQRMIWNVQKIFHINKRLPTDLSPIRVIKGVKTLLERCVIVTGNDRISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLVGEIETRFQQAQANPGEMVGALAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTGGAARDAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQRTVISEDQEFVNVYYEMPDFDPTRISPWLLRIELDRKRMTDKKLTMEQIAEKINVGFGEDLNCIFNDDNADKLVLRIRIMNNEENKFQDEDEAVDKMEDDMFLRCIEANMLSDMTLQGIEAIGKVYMHLPQTDSKKRIVITETGEFKAIGEWLLETDGTSMMKVLSERDVDPIRTSSNDICEIFQVLGIEAVRKSVEKEMNAVLQFYGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAAHAETDPMRGVSENIIMGQLPKMGTGCFDLLLDAEKCRFGIEIPNTLGNSMLGGAA--MFIGGGSTPSMTPPMTPWANCNTPRYFSPPGHVSAMTPGGPSFSPSAASDASGMSPS 1548          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Fly
Match: RpIIIC160 (gene:FBgn0030687 transcript:FBtr0300811)

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 471/1510 (31.19%), Postives = 752/1510 (49.80%), Query Frame = 1
Query:  262 ATVTLREIKNVQFGIXXXXXXXXXXXXDACGI-IYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREI-MKKTEGSYRKRFDL---IHEECKKVKTCNVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDY------------SMETKDSDDGKGK----QPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMN-HSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDI--QLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLM-FLPSWNGVM----PKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGN-FFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGAT 4698
            A+   ++I +VQFGI    E++  ++       +Y  + Q   P   G++D R G   K +MC+TC   ++EC GHFG+++LA PV++IG+    I IL+ +C  C+ +++   D ++ E  +     SY  +  L   +  + KKV  C      +   +KG   +       +   ++   +D             +   +D +   G     + L    V+++F++I   D  ++G     + P+ +I+T + VPP  +RP+++    +G   DDLT K +EI+ +N+ I++    G    +I E  + LQ HVA    +E + +P+ +    +  + + QRLKGK GR R NL GKR D++ RTVI+ DPNL ++QVGVP  +A+ LT+PERV P N + +++LVRNG +M+PGA +V +            +   +  +L  G++VERH+ + D V+FNRQP+LHKMS+M HR KV P  TFR N     PYNADFDGDEMNLH+PQ++EA AE   L      ++TP++   +++  QD +T    +T ++ FL   E M L   FL + +  M    P P + KP+RLWTGKQ+FSL++    +     +   +  +    K +   D+ + I N +L+ G++ K T+GS +   +  + L    +         +  + + +L   G + GI D   +    +  +  +N       + I    +  L   PG +  +T E  +   L+  R++   +    L   NS  +M +SG+KGS INISQ+IACVGQQ + GKR+P GF+ R LPHF +    P +RGFV+NS+ +GLTPTEFFFH M GREG++DTAVKTAETGY+QRRL+K +E ++V YD TVRN +++++   YG DGLD   +E +  P                +D + Q                     ++ A+  Q K DR    E + E+    L  P         A+  FK+D               VRN  N +     + RI     R    +  C         ++ C   L+ E L   +  I + + ++   PG  VG++AA+S+GEP TQMTL TFHFAGV++ N+T GVPR+ EIIN ++   TP +T  L       +E A+++ A +E TTL +L+   E+   P      +  D   ++      D D       V  I+  R ++   ++ + +   +I    +      +  E   L L ++ +                                 G+P I++  ++    DD +           +   + L  +G  L  V+A   V  + T SN+I EI++T GIEAAR  I +E+T V+   G  V++RH+ LL   MT +G ++ I RHG+ +        +SFE+T D L +A  + + D + GVSE I+LG  A +GTG F +L    Q ++ Q  P+   +  +L ++   T
Sbjct:    8 ASALNKKISHVQFGISGADEIQQEALVRIISKNLYQAQRQ---PVPYGVLDRRMGISTKDAMCETCGQGLNECIGHFGYLDLALPVFHIGHFRSTINILQMICKVCAHVMLKPEDRQLYEKKLHNPNFSYLGKKALHVQMLAKAKKVTKCPHCGSPNGGVKKGPGLL-----KILHDPYKGRKMDSLFTSNMNEMLRSTQTNRDLNSTLGNYSTAEELTPLMVLDLFEQIPQRDVALLGMCSHDAHPKHLIVTRVFVPPACIRPSVLSEVKAGTTEDDLTMKQSEILLINDVIQRHMATGGKIELIHEDWDFLQLHVALYFHSEISGIPINMAPK-KTTRGIVQRLKGKQGRFRCNLSGKRVDFSGRTVISPDPNLMINQVGVPVRVAKILTYPERVNPANIRHMRELVRNGPSMHPGANYVQQRGSSFKKYLAYGNREKVAQELKCGDVVERHLRDGDIVLFNRQPSLHKMSIMCHRAKVQPQRTFRFNECACTPYNADFDGDEMNLHLPQTEEARAEALILMGNQSNLVTPKNGEILIAATQDFITGGYLLTQKEVFLTKEEAMQLAACFLANEDSTMHIKLPPPALLKPRRLWTGKQMFSLLMRPNDDSQVRLNMVNKGRNYTRNKDLCSNDSWIHIRNSELMCGVMDKATMGSGTKQCIFYLLLRDFGESHATKAMWRLARIASYFLQNRGFSFGISDVTPSKKLLQHKELLLNNGYAKCNEYIELLKAGTLQCQPGCTPEETLESVMLRELSAIREQAAKTCFAELHPTNSALIMALSGSKGSNINISQMIACVGQQAISGKRVPNGFENRALPHFERHSAIPAARGFVQNSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYLQRRLVKCLEDLVVHYDGTVRNAVNEMVDTIYGGDGLDPVSMETRNKP----------------VDLVHQYD-------------------NLRAQHPQGK-DRPLNAEEMSEALETLLRTP-----EFAEARDDFKLD---------------VRNHINTV-----SKRIGQLQKRYEKCIDLC--------HQIEC---LTTEQLLQFVRRINDRYNRAVTEPGTAVGAIAAQSIGEPGTQMTLKTFHFAGVASMNITQGVPRIVEIINATKTISTPIITAEL--ENCHSMEFARQVKARIEKTTLAELSSYVEVVCGPYSCYLAIGVDMARIKLLGLHIDLDT-----IVFSILKSRMRVKPTQVEVVASQSRIVVRVEATRTSTINAELARLALSLQNVVVA------------------------------GLPNINRAVIA---VDDAR-----------QPPTYKLCIEGYGLRDVIATYGVVGKRTRSNNICEIYQTLGIEAARTIIMSEITEVMEGHGMSVDWRHIMLLASQMTARGEVLGITRHGLAKMRESVFNLASFEKTADHLFDAAYYGQTDAINGVSERIILGMPACIGTGIFKLLQ---QHEDKQVPPIEPTICSSLNLLPSKT 1382          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Fly
Match: RpI1 (gene:FBgn0019938 transcript:FBtr0087511)

HSP 1 Score: 409.838 bits (1052), Expect = 9.480e-117
Identity = 312/978 (31.90%), Postives = 478/978 (48.88%), Query Frame = 1
Query: 1039 KLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRI-----DLKRRPDSSDIQLSYGE----IVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFS-TFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHL----LMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLI-------------------IPGK-VNCNRTH----STHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLY-------------------NAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSA--QKSLSKY--NSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLD---GGFVEFQVLPTYKINNLN-----FERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNI-FYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLA----VSSEIYYDPD 3744
            KLTE  K   +  + E    A   +     +LQ  V  L+D       V + +  +  + LKQ ++ K G +RS++MGKR +Y ARTVIT DPN+N+D++G+P   A+ L++P  VT +N   L+++V NG  ++PGA ++  +NG        +  +R   + + LS  +    IV RH+LN D ++ NRQP+LHK S+MGH+ ++L    TFRL+ S    YNADFDGDEMN H PQS+ A AE  NL  V    + P+   P+  ++QD + +  K+++R  F N  +   L    L  L     ++P PTI KP  LW+GKQ+ S I                   I GK  N +R       T+PE  D         ++++V I NG+L++G+L K+  G+++  L+H +      D           V   +L  EG T+G+ D L                    N+A    ++       D++ + +   +   +  +  R LL   + K   +L+   +   S+   +  ++K+  N+  LMV+SGAKGS +N  Q+   +GQ  +EGKR P     ++LP F   +  P+S GF++  ++ G+ P +FFFH M GREG+IDTAVKT+ +GY+QR L+K +E + V YD TVR+  + ++Q  YGEDGLD     F   +    +   N        +     D + + ++ RH    R  E +  A +        E+L+ + E  R     S  GR      + +L W           KK D +   +  K    C +  V      +   +    T             +K+I D      AL+  I +I  +   KS   PGE VG +AA+S+GEP+TQMTLNTFHFAG    NVTLG+PRL+EI+ + S N KTPS+ I +        E   K+  +L   TL  L     VS+ +  DP+
Sbjct:  349 KLTEEAKAAYQTLKGE---TAHEKLYTAWLALQMSVDVLLD-------VNMSREMKSGEGLKQIIEKKSGLIRSHMMGKRVNYAARTVITPDPNINVDEIGIPDIFAKKLSYPVPVTEWNVTELRKMVMNGPDVHPGANYIQDKNGFTTYIPADNASKRESLAKLLLSNPKDGIKIVHRHVLNGDVLLLNRQPSLHKPSIMGHKARILHGEKTFRLHYSNCKAYNADFDGDEMNAHYPQSEVARAEAYNLVNVASNYLVPKDGTPLGGLIQDHVISGVKLSIRGRFFNREDYQQLVFQGLSQLKKDIKLLP-PTILKPAVLWSGKQILSTIIINIIPEGYERINLDSFAKIAGKNWNVSRPRPPICGTNPEGNDL--------SESQVQIRNGELLVGVLDKQQYGATTYGLIHCMYELYGGDVSTLLLTAFTKVFTFFLQLEGFTLGVKDILVTDVADRKRRKIIRECRNVGNSAVAAALELEDEPPHDELVEKMEAAY---VKDSKFRVLL---DRKYKSLLDGYTNDINSTCLPRGLITKFPSNNLQLMVLSGAKGSMVNTMQISCLLGQIELEGKRPPLMISGKSLPSFTSFETSPKSGGFIDGRFMTGIQPQDFFFHCMAGREGLIDTAVKTSRSGYLQRCLIKHLEGLSVHYDLTVRDSDNSVVQFLYGEDGLDILKSKFFNDKFCADFLTQNATAILRPAQLQLMKDEEQLAKVQRHEKHIRSWEKKKPAKLRAAFTHFSEELREEVEVKRPNEINSKTGRRRFDEGLLKL-W-----------KKADAEDKALYRKKYARCPDPTVAVYKQDLYYGSVSERT-------------RKLITDYAKRKPALKETIADIMRVKTIKSLAAPGEPVGLIAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMLASSNIKTPSMDIPIKPGQQHQAE---KLRINLNSVTLANLLEYVHVSTGLTLDPE 1273          

HSP 2 Score: 79.337 bits (194), Expect = 3.870e-14
Identity = 51/158 (32.28%), Postives = 78/158 (49.37%), Query Frame = 1
Query: 4141 KRLIINSKGDFEKVEEWILETDGTCLPKVLAE-RYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            KR II    D    ++ +L+TDG  + ++    + +D     SN I  I  T+GIEAA   I  E++NV    G  V+ RHL+L+ + MT  G    + R G+    +  L + SFE ++  L  A      D +   S  +M+G   R GTG F++L
Sbjct: 1486 KRAIIYKGTD----DDQLLKTDGINIGEMFQHNKILDLNRLYSNDIHAIARTYGIEAASQVIVKEVSNVFKVYGITVDRRHLSLIADYMTFDGTFQPLSRKGME-HSSSPLQQMSFESSLQFLKSAAGFGRADELSSPSSRLMVGLPVRNGTGAFELL 1638          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Zebrafish
Match: polr2a (polymerase (RNA) II (DNA directed) polypeptide A [Source:ZFIN;Acc:ZDB-GENE-041008-78])

HSP 1 Score: 1764.59 bits (4569), Expect = 0.000e+0
Identity = 897/1554 (57.72%), Postives = 1154/1554 (74.26%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTC-------NVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXXX----YXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPM-MSGVA----QNLFMVGGATPMNXXXXXXX---XXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGL--GFSPMMSP 4860
            LR IK VQFG+LS  EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  KI+K+LR VCF CSKLLV+ ++PKI++I+ K++G  RKR   +++ CK    C       N    E  E E         GC   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRI++E+ II+G + KY+RPE MI+TVL VPP+AVRPA+VM  S +  DDLTHKL +IVK+NN++++ E++G A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKS+KQRLKGK GRVR NLMGKR D++ARTVIT DPNL +DQVGVPR+IA N+TFPE VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D +VFNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G +P+P I KP+ LWTGKQ+FSLIIPG +N  RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTVVNNWLL EGH+IGI D++ + AT ++I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVV+G+KGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MESVMVKYDATVRN I+Q++QLRYGEDGL G  VEFQ + T K ++  FE+ F+FD  +   L R L E  V+++   A + + ++ E+E+++ DRE LR     +   ++ LPCN+ R+IWNA+  F+I+    TD+ P  +V+ V+ L  +L++V G+D++S  A  N+TLL    +RS LC K++  + RLS EA +W++GEI   F +S  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG AA+D E AK I   LEHTTLRK+  ++ IYYDP+P+N+VV  D++WV  YYE PDFDV + S ++LRI L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  D+ K +E +E+ D+     +L  I++ +L ++ LQGI QISKVY+  P TD+KK++II   G+F+ ++EWILETDG  L +VL+E+ VD   TTSN I EIF   GIEA R A+E E+ +VISFDGSYVNYRHLALLC+ MT +G LM+I RHGINRQ+TG L + SFEETVD+LMEA +H E DPMKGVSE+IMLGQLA  GTGCFD+L++  +      +P  + G++      +F     +PM+  SP ++     +     + + S G G+    +GFS +  S + G   G+SP  SP
Sbjct:   13 LRLIKRVQFGVLSPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERSGRCQTCAGNMTECPGHFGHIELAKPVFHVGFITKIMKVLRCVCFFCSKLLVDANNPKIKDILTKSKGQPRKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPESEDITKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRIADEEDIILGMDPKYARPEWMIVTVLPVPPLAVRPAVVMQGSARNQDDLTHKLADIVKINNQLKRNEQSGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSIKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLQIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIIVFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINAIRTHSTHPDEEDSGPYKNISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVVNNWLLIEGHSIGIGDSIADKATYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVAGSKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGEAVEFQNMATLKPSHKAFEKKFKFDYANERALRRTLQEDVVKDVMTNAHVQSSLEREFEKMREDREILRAIFP-TGDSKVVLPCNLARMIWNAQKIFRINPRAPTDLNPARVVDGVKELSKKLVIVNGDDQLSRQAQENATLLFNIHLRSTLCSKRMTEEFRLSTEAFDWLLGEIETKFNQSIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKRPKTPSLTVFLLGQAARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVTEDQEWVNVYYEMPDFDVTRISPWLLRIELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKFQEDEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGINRQDTGPLMKCSFEETVDVLMEASSHGESDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGISVAGPTGMFFGSAPSPMSGMSPAMTPWNTGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSP 1564          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Zebrafish
Match: polr3a (polymerase (RNA) III (DNA directed) polypeptide A [Source:ZFIN;Acc:ZDB-GENE-050208-103])

HSP 1 Score: 559.296 bits (1440), Expect = 3.447e-170
Identity = 324/884 (36.65%), Postives = 511/884 (57.81%), Query Frame = 1
Query:  358 IYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDP-KIREIMKKTEGSYRKRFDL---IHEECKK---VKTCNVICDESEECEKGLNTIIRQGCN----FVQPKFRR--NGLDYSMETKDSDDG---KGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMN-HSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKR-----RPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFL-----PSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESED-SGPYKWISHADTRVLIENGQLIMGILCKKTLGSSS-GSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNA----ATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVE 2907
            +Y + T   KP + G++D R G  +K   C+TC  N+++C GH+G+++L  P ++IGY + I+ IL+ +C  CS +L+   +  +  + +++   +Y ++  L   I ++C+K      CN      ++C  GL  II +        V P         D ++E     +    + ++ L    V+ +F+RI ++D  ++  N +  +P  +ILT L VPP+ +RP++V +  SG   DDLT KLTEI+ +N+ I++    G  + +I+E  + LQ   A  +++E + +P+ +    +  +   QRLKGK GR R NL GKR D++ RTVI+ DPNL +D+V VP  +A+ LT+PE+V   N + +++LVRNG  ++PGA F+ + +   + +KR       +    +L +G++VERHM++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V  PYNADFDGDEMNLH+PQ++EA AE   L      ++TP++  P+++ +QD LT    +T++DTF +  +   ++  +           +P P I KP RLWTGKQ+FSLI+    +C    +   + +   G  + +   D+ V+I N +L+ G + K TLGS S  ++ +I+  +    +  +  + +  +   +L   G +IGI D         A +E +     K  D+  D +  G    L   PG +  +T E  +   L+  RD  GS+  + L K NS  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV +S+ +GLTPTEFFFH M GREG++DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQ  YG DGLD   +E
Sbjct:   41 LYSQDTSH-KPLQYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYLDLELPCFHIGYFKAIVGILQMICKTCSHILLTKEEKLQFLDYLRRPGLAYLQKRGLKKKISDKCRKKTVCLNCNAFNGSVKKC--GLLKIIHEKYKSTKKVVDPAVSDFLQSFDVAIEHNKEVESLLTRAQENLNPLVVLNLFRRIPDKDVPLLLMNPESGKPADLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRMTGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTYPEKVNKANIELMRKLVRNGPEVHPGANFIQQRH---MQMKRFLKYGNREKMAQELKFGDVVERHMIDGDIVLFNRQPSLHKLSIMAHIARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRTKACQIVASILVGKDEKIKISLPHPAILKPIRLWTGKQIFSLILKPSKSCPVMANLRTKGKQYCGKGEDLCANDSFVVIHNSELMCGSMDKGTLGSGSKNNIFYILLRDWGQQEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKQELLDAGYEKC-DEYIDALKTGR---LQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFQKHSKLPAAKGFVADSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 913          

HSP 2 Score: 175.637 bits (444), Expect = 1.882e-43
Identity = 123/414 (29.71%), Postives = 209/414 (50.48%), Query Frame = 1
Query: 3376 NRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISK--VYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            +R++   LE  +   R+ + ++Q+ PG  VG+L A+S+GEP TQMTL TFHFAGV++ N+TLGVPR+KEIIN S+N  TP ++  L      D + A+ +   +E T L +++   E  + PD    +V+   D +R        +V+ ++   +R  +   K+  K   +Q   E         ++C  P EN                           Y+       L ++ +QGIP++S+  +++ + +   K +L++                +G  +  V+A   V+   TTSN+  E+ +T GIEAAR+ I  E+   +   G  ++ RH+ LL ++M++KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    +GTG F +L
Sbjct: 1004 DRITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIISANL--DTNDDPDFARLVKGRIEKTLLGEISEYIEEVFLPDDTFILVKLSLDRIRLLR----LEVNAET---VRYSICTSKLRVKPGDVQVHGEA--------VVCVSPREN---------------------SKSSMYYVLQSLKQDLPKVVVQGIPEVSRAVIHIDEQSGKQKFKLLV----------------EGDNMRSVMATHGVNGSKTTSNNTYEVEKTLGIEAARSTIINEIQYTMVNHGMSIDRRHVMLLADLMSYKGEILGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLL 1363          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Zebrafish
Match: polr1a (RNA polymerase I subunit A [Source:ZFIN;Acc:ZDB-GENE-030131-5286])

HSP 1 Score: 324.324 bits (830), Expect = 3.942e-89
Identity = 234/757 (30.91%), Postives = 360/757 (47.56%), Query Frame = 1
Query:  913 GFNYKYSRPESMILTVLAVPPMAVRP-------------------------------AIVMNHSGKAHDDLTHKL---TEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMD--NESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDL----KRRPDSSDIQL---SYGE------IVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFS-TFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPK--------PTIAKPQRLWTGKQLFSLI-------------------IPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWL-LFEGHTIGIVDTLY----NAATREEIKFNI---NKAKDDVFDTITKGHSNELNSTPGRSLLQT-----------FEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLD 2892
            GFN     PE   L +L VPP   RP                                ++ +   KA +    +L   +E  KV  EI Q+    +    + +K  S   H+ +L++   +S    +  +K       ++Q L+ K G  R ++MGKR DY AR+VI  D  +  +++G+P   A  LT+P+ VTP+N K ++Q V NG  ++PGA  V+ E+G R  L    + + ++   QL   S G+      IV RH+ N D ++ NRQPTLH+ S+  H  ++LP     RL+ +    YNADFDGDEMN H PQS+ + AE   L   ++  + P+  +P+  ++QD + +   MT+R  F    +   L+     + G+  K        PT+ KP  LWTGKQ+ S +                   IPGK     +    P       Y   S  +++V+I  G+L+MG+L K   GSS+  L+H        +  G   + +  +   +L L+ G T+G+ D L     N   ++ IK ++   +KA    F+        E       + L             F+E+VN + N                 N+  +MV SGAKGS +N  Q+   +GQ  +EG+R P     ++LP F   +  P S GFV   +L G+ P EFFFH M GREG++DTAVKT+ +GY+QR ++K +E ++V+YD TVR+    ++Q  YGEDGLD
Sbjct:  274 GFN-----PEVFFLELLVVPPCRYRPINRLGDQMFTNGQTVNMQAVLKDGLIIQKLLTLIADEKTKAIEGTQTELEQSSEAPKVT-EIDQSFLTSIQGVTLTDKLYSTWIHLQSLVNIVFDSDMDKLITEK----FPGVRQLLEKKEGLFRKHMMGKRVDYAARSVICPDMYIGTNEIGIPMVFATKLTYPQPVTPWNVKEMRQAVLNGPNIHPGATMVVNEDGSRTILSSTNQTQREAVAKQLLTPSTGQHRIPMKIVNRHIKNGDVLLLNRQPTLHRPSIQAHCARILPGEKVLRLHYANCKAYNADFDGDEMNAHFPQSELSRAEAYTLVSTDQQYLVPKDGKPLAGLIQDHMVSGTSMTIRGCFFTRDQYTALV-----YRGLTDKIGRVKLLPPTLIKPVLLWTGKQVVSTLLLNVIPENSIPLNLTGKAKIPGKAWVKESPRPVPG------YVPESMCESQVVIRQGELLMGVLDKAHYGSSAYGLVHCCYELYGGETSGKLLSCLARLFTAYLQLYRGFTLGVEDILVKDGANKQRKKIIKKSVTCGSKALQAAFNLPASAEDTEARERWQDAHLNIDQRDFNMVDLKFKEEVNQVNNNINKVCMPLGLHRSFPENNLQMMVQSGAKGSTVNTMQISCLLGQIELEGRRPPLMPSGKSLPCFQPYEPQPRSGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGYLQRCVIKHLEGLVVQYDLTVRDSDGSVVQFLYGEDGLD 1009          

HSP 2 Score: 82.4185 bits (202), Expect = 6.243e-15
Identity = 46/92 (50.00%), Postives = 64/92 (69.57%), Query Frame = 1
Query: 3418 IRNI----FYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTIRLL--GAAAKDVEIAKK 3672
            +RN+    + ++   PGE VG +AA+S+GEP+TQMTLNTFHFAG    NVTLG+PRL+EI+ V S N KTP ++I ++    A K V+  +K
Sbjct: 1176 LRNLLQLKWQRALCDPGEAVGLVAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILLVASSNIKTPMMSIPVVMNKKALKQVKTLRK 1267          

HSP 3 Score: 68.9366 bits (167), Expect = 6.991e-11
Identity = 30/68 (44.12%), Postives = 37/68 (54.41%), Query Frame = 1
Query:  382 GKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKL 585
            G    NGL D   GP D   +C TC  + S CPGHFGHI L  PVYN  + +K+  ++R  C  C  L
Sbjct:   43 GNAAANGLYDLALGPADNKEICSTCMQDFSSCPGHFGHIELPLPVYNPLFFDKLYLLIRGSCLSCHIL 110          

HSP 4 Score: 67.0106 bits (162), Expect = 3.264e-10
Identity = 42/156 (26.92%), Postives = 80/156 (51.28%), Query Frame = 1
Query: 4144 RLIINSKGDFEKVEEWILETDGTCLPKVLA-ERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDI 4608
            R ++N     +  +E +L T+G  + ++      +D +   SN +  +  T+GIE A   IE E+ +V +  G  V+ RHL+L+ + M  +G    ++R GI +  +  L + +FE +   L +A      D +   S  +++G++ + GTG FD+
Sbjct: 1525 RCLLNEVTRKDGSKEIMLNTEGINIHEMFKYADILDLKRLYSNEVHAMASTYGIEVALRVIEKEIKDVFAVYGIEVDPRHLSLVADYMCFEGVYKPLNRFGI-QSNSSPLQQMTFETSFKFLKQATMLGSYDKLSSPSACLVVGKVVKGGTGIFDL 1679          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Zebrafish
Match: polr1a (RNA polymerase I subunit A [Source:ZFIN;Acc:ZDB-GENE-030131-5286])

HSP 1 Score: 323.939 bits (829), Expect = 4.752e-89
Identity = 234/757 (30.91%), Postives = 360/757 (47.56%), Query Frame = 1
Query:  913 GFNYKYSRPESMILTVLAVPPMAVRP-------------------------------AIVMNHSGKAHDDLTHKL---TEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMD--NESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDL----KRRPDSSDIQL---SYGE------IVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFS-TFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPK--------PTIAKPQRLWTGKQLFSLI-------------------IPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWL-LFEGHTIGIVDTLY----NAATREEIKFNI---NKAKDDVFDTITKGHSNELNSTPGRSLLQ-----------TFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLD 2892
            GFN     PE   L +L VPP   RP                                ++ +   KA +    +L   +E  KV  EI Q+    +    + +K  S   H+ +L++   +S    +  +K       ++Q L+ K G  R ++MGKR DY AR+VI  D  +  +++G+P   A  LT+P+ VTP+N K ++Q V NG  ++PGA  V+ E+G R  L    + + ++   QL   S G+      IV RH+ N D ++ NRQPTLH+ S+  H  ++LP     RL+ +    YNADFDGDEMN H PQS+ + AE   L   ++  + P+  +P+  ++QD + +   MT+R  F    +   L+     + G+  K        PT+ KP  LWTGKQ+ S +                   IPGK     +    P       Y   S  +++V+I  G+L+MG+L K   GSS+  L+H        +  G   + +  +   +L L+ G T+G+ D L     N   ++ IK ++   +KA    F+        E       + L             F+E+VN + N                 N+  +MV SGAKGS +N  Q+   +GQ  +EG+R P     ++LP F   +  P S GFV   +L G+ P EFFFH M GREG++DTAVKT+ +GY+QR ++K +E ++V+YD TVR+    ++Q  YGEDGLD
Sbjct:  283 GFN-----PEVFFLELLVVPPCRYRPINRLGDQMFTNGQTVNMQAVLKDGLIIQKLLTLIADEKTKAIEGTQTELEQSSEAPKVT-EIDQSFLTSIQGVTLTDKLYSTWIHLQSLVNIVFDSDMDKLITEK----FPGVRQLLEKKEGLFRKHMMGKRVDYAARSVICPDMYIGTNEIGIPMVFATKLTYPQPVTPWNVKEMRQAVLNGPNIHPGATMVVNEDGSRTILSSTNQTQREAVAKQLLTPSTGQHRIPMKIVNRHIKNGDVLLLNRQPTLHRPSIQAHCARILPGEKVLRLHYANCKAYNADFDGDEMNAHFPQSELSRAEAYTLVSTDQQYLVPKDGKPLAGLIQDHMVSGTSMTIRGCFFTRDQYTALV-----YRGLTDKIGRVKLLPPTLIKPVLLWTGKQVVSTLLLNVIPENSIPLNLTGKAKIPGKAWVKESPRPVPG------YVPESMCESQVVIRQGELLMGVLDKAHYGSSAYGLVHCCYELYGGETSGKLLSCLARLFTAYLQLYRGFTLGVEDILVKDGANKQRKKIIKKSVTCGSKALQAAFNLPASAEDTEARERWQDAHLNIDQRDFNMVDLKFKEEVNQVNNNINKVCMPLGLHRSFPENNLQMMVQSGAKGSTVNTMQISCLLGQIELEGRRPPLMPSGKSLPCFQPYEPQPRSGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGYLQRCVIKHLEGLVVQYDLTVRDSDGSVVQFLYGEDGLD 1018          

HSP 2 Score: 82.4185 bits (202), Expect = 6.466e-15
Identity = 46/92 (50.00%), Postives = 64/92 (69.57%), Query Frame = 1
Query: 3418 IRNI----FYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTIRLL--GAAAKDVEIAKK 3672
            +RN+    + ++   PGE VG +AA+S+GEP+TQMTLNTFHFAG    NVTLG+PRL+EI+ V S N KTP ++I ++    A K V+  +K
Sbjct: 1185 LRNLLQLKWQRALCDPGEAVGLVAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILLVASSNIKTPMMSIPVVMNKKALKQVKTLRK 1276          

HSP 3 Score: 68.9366 bits (167), Expect = 6.998e-11
Identity = 30/68 (44.12%), Postives = 37/68 (54.41%), Query Frame = 1
Query:  382 GKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKL 585
            G    NGL D   GP D   +C TC  + S CPGHFGHI L  PVYN  + +K+  ++R  C  C  L
Sbjct:   43 GNAAANGLYDLALGPADNKEICSTCMQDFSSCPGHFGHIELPLPVYNPLFFDKLYLLIRGSCLSCHIL 110          

HSP 4 Score: 67.0106 bits (162), Expect = 3.213e-10
Identity = 42/156 (26.92%), Postives = 80/156 (51.28%), Query Frame = 1
Query: 4144 RLIINSKGDFEKVEEWILETDGTCLPKVLA-ERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDI 4608
            R ++N     +  +E +L T+G  + ++      +D +   SN +  +  T+GIE A   IE E+ +V +  G  V+ RHL+L+ + M  +G    ++R GI +  +  L + +FE +   L +A      D +   S  +++G++ + GTG FD+
Sbjct: 1534 RCLLNEVTRKDGSKEIMLNTEGINIHEMFKYADILDLKRLYSNEVHAMASTYGIEVALRVIEKEIKDVFAVYGIEVDPRHLSLVADYMCFEGVYKPLNRFGI-QSNSSPLQQMTFETSFKFLKQATMLGSYDKLSSPSACLVVGKVVKGGTGIFDL 1688          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Xenopus
Match: ctdnep1 (CTD nuclear envelope phosphatase 1 [Source:Xenbase;Acc:XB-GENE-5939296])

HSP 1 Score: 1576.99 bits (4082), Expect = 0.000e+0
Identity = 849/1610 (52.73%), Postives = 1091/1610 (67.76%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTC-------------NVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXX---XYXXXXXXXXXXXXXXQGIPQISKVYL------SKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKV-LAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLP-------------MMSGVAQNLF--MVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEA-GMS------------------------PSPGLGFSPMMSPKTPHDYFYGLNSPG 4902
            LR IK VQFG++   EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  K +K+LR VCF CSKLLV+ ++PKI++I+ K++G  +KR   ++E CK    C                 DE  + EKG       GC   QP+ RR GL+   E K  + D  + K  L   +V E+FKRI++E+C I+G + +++RPE +I+TVL VPP++VRPA+VM  S +  DDLTHKL +IVK+NN++R+ E+NG A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKSLKQRLKGK GRVR NLMGKR D++ARTVIT DPNL++DQVGVPR+IA N+TFPE VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G +P+P I KP+ LWTGKQ+FSLI+PG +NC RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTV+NNWLL EGHTIGI D++ +A T ++I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVVSGAKGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MESVMVKYDATVRN I+Q++QLRYGEDGL G  VEFQ L T K +N  FE+ F+FD  +   L R L E  V+EI ++A +  +++ E+E++K DRE LR  +  +   ++ LPCN+QR+IWNA+  F I+    +D+ P  +V  VR L  +L++V G+D +S  A  N+TLL    +RS LC ++++ + RLS EA +W++GEI + F ++  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG +A+D E AK I   LEHTTLRK+  ++ IYYDP+P+N+VV  D++WV  YYE PDFDV + S ++LR+ L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  ++ K ++ + ++      +L  I++ +L ++ LQGI QISKV L        P    +  L+   KG    V  W    D    P + L    + S T  +  +T  F+     A    +      V SF  S +    L  L E  + +                  L       +VD+LMEA AH E DPMKGVSE+I LGQLA  GTGCFD+L+   +      +P             M  G A +    M    TP N  +            S  +    G  FSPS  S+A G S                        PSPG   SP  SP +P    Y   SPG
Sbjct:   13 LRTIKRVQFGVIGPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDANNPKIKDILIKSKGQPKKRLTHVYELCKGKNICEGGEEMDNKFGVEQTEGDEDIQKEKG-----HGGCGRYQPRIRRTGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRITDEECFILGMDPRFARPEWLIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIVPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDTTRLFYSNIQTVINNWLLIEGHTIGIGDSIADAKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGEGVEFQNLATLKPSNKAFEKKFKFDYANERALRRTLQEDVVKEILSDAHVQNELEKEFEKMKEDREVLR-VIFPTGDSKVVLPCNLQRMIWNAQKIFHINTRMPSDLHPIKVVEGVRELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMVEEFRLSGEAFDWLLGEIESKFNQAVAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVSEDQEWVNVYYEMPDFDVTRISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSEENKMQDEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVGLVTLGQGQVPLGRYQLGLVTLGKGQLTGVSYWSGYCDFLTPPPIGLGWAMIFSPTMAA--VTCYFKRRRSLATGFVLMG--VGVFSFALSPL----LQYLLETYSWR--------------GALLLLSGLALHSVDVLMEAPAHGESDPMKGVSENIFLGQLAPAGTGCFDLLLEAEKCKLGMEIPKKIPGLGGGGATGMFFGTAPSPMGGMSPAMTPWNQGATPAYGAWSPSIGSGMTPGAAG--FSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPA---YEPRSPG 1588          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Xenopus
Match: ctdnep1 (CTD nuclear envelope phosphatase 1 [Source:Xenbase;Acc:XB-GENE-5939296])

HSP 1 Score: 1534.24 bits (3971), Expect = 0.000e+0
Identity = 752/1255 (59.92%), Postives = 958/1255 (76.33%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTC-------------NVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRML 3987
            LR IK VQFG++   EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  K +K+LR VCF CSKLLV+ ++PKI++I+ K++G  +KR   ++E CK    C                 DE  + EKG       GC   QP+ RR GL+   E K  + D  + K  L   +V E+FKRI++E+C I+G + +++RPE +I+TVL VPP++VRPA+VM  S +  DDLTHKL +IVK+NN++R+ E+NG A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKSLKQRLKGK GRVR NLMGKR D++ARTVIT DPNL++DQVGVPR+IA N+TFPE VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G +P+P I KP+ LWTGKQ+FSLI+PG +NC RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTV+NNWLL EGHTIGI D++ +A T ++I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVVSGAKGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MESVMVKYDATVRN I+Q++QLRYGEDGL G  VEFQ L T K +N  FE+ F+FD  +   L R L E  V+EI ++A +  +++ E+E++K DRE LR  +  +   ++ LPCN+QR+IWNA+  F I+    +D+ P  +V  VR L  +L++V G+D +S  A  N+TLL    +RS LC ++++ + RLS EA +W++GEI + F ++  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG +A+D E AK I   LEHTTLRK+  ++ IYYDP+P+N+VV  D++WV  YYE PDFDV + S ++LR+ L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++
Sbjct:   13 LRTIKRVQFGVIGPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDANNPKIKDILIKSKGQPKKRLTHVYELCKGKNICEGGEEMDNKFGVEQTEGDEDIQKEKG-----HGGCGRYQPRIRRTGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRITDEECFILGMDPRFARPEWLIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIVPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDTTRLFYSNIQTVINNWLLIEGHTIGIGDSIADAKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGEGVEFQNLATLKPSNKAFEKKFKFDYANERALRRTLQEDVVKEILSDAHVQNELEKEFEKMKEDREVLR-VIFPTGDSKVVLPCNLQRMIWNAQKIFHINTRMPSDLHPIKVVEGVRELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMVEEFRLSGEAFDWLLGEIESKFNQAVAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVSEDQEWVNVYYEMPDFDVTRISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIM 1260          

HSP 2 Score: 71.2478 bits (173), Expect = 2.327e-11
Identity = 52/153 (33.99%), Postives = 68/153 (44.44%), Query Frame = 1
Query: 4492 TVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLP------MMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMS----------PSPGLGFSPMMSPKTPHDYFYGLNSPG 4902
            +VD+LMEA AH E DPMKGVSE+I LGQLA  GTGCFD+L+   +      +P         G +       G +P                 + + ++GF   +SP+     G            PSPG   SP  SP +P    Y   SPG
Sbjct: 1398 SVDVLMEAPAHGESDPMKGVSENIFLGQLAPAGTGCFDLLLEAEKCKLGMEIPKKIPGLGGGGGSGMTPGAAGFSP----------------SAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPA---YEPRSPG 1531          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Xenopus
Match: polr3a (polymerase (RNA) III (DNA directed) polypeptide A, 155kDa [Source:NCBI gene;Acc:100124725])

HSP 1 Score: 571.237 bits (1471), Expect = 2.510e-174
Identity = 333/874 (38.10%), Postives = 508/874 (58.12%), Query Frame = 1
Query:  388 PKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPK-IREIMKKTEGSYRKRFDL---IHEECKKVKTCNVICDESEECEK--GLNTIIRQGCN----FVQPKFRR--NGLDYSMETK---DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMN-HSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDI--QLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFL-----PSWNGVMPKPTIAKPQRLWTGKQLFSLII-PGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSS-GSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDT--------ITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVE 2907
            P   G++D R G  +K   CQTC  N++EC GH+G+++L  P +++GY + +I IL+ +C  CS++L+N  + K   + +K+   +Y ++  L   I ++C+K KT  + C       K  GL  II +        V P         D ++E     +S  G+ ++ L    V+ + ++I  ED  ++  N +  +P  +ILT L VPP+ +RP++V +  SG   DDLT KLTEI+ +N+ I++    G  + +I+E  + LQ   A  +++E + +P+ +    +  +   QRLKGK GR R NL GKR D++ RTVI+ DPNL +D+V VP  +A+ LTFPE+V   N + +++LV+NG  ++PGA F+ + +       +  +   I  +L +G+IVERH+++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V  PYNADFDGDEMNLH+PQ++EA AE   L      ++TP++  P+++ +QD LTA   +T++DTF + A+   ++  +           +P P I KP  LWTGKQ+FSLI+ P   N  R +      +  G  + + H D+ V I+N +L+ G L K TLGS S  ++ +I+  +    +  +  + +  +   +L   G +IGI D              + KAK D+ D         I   ++ +L   PG S  +T E  +   L+  RD  GS+  + L K NS  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV NS+ +GLTPTEFFFH M GREG++DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQ  YG DGLD   +E
Sbjct:   40 PLAFGVLDHRMGTSEKDRHCQTCGKNLAECLGHYGYLDLELPCFHVGYFKAVIGILQMICKTCSRILLNAEERKQFLDFLKRPGLTYLQKRGLKKKISDKCRK-KTVCLYCGAYNGSVKKCGLLKIIHEKYKTTKKVVDPMVSHFLQSFDTAIEHNKEVESLLGRAQENLNPLIVLNLLRQIPAEDIPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRITGAKTQMIMEDWDFLQLQCALYINSELSGIPMNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNQANMQLMRKLVQNGPDVHPGANFIQQRHTQMKRFLKYGNREKIAQELRFGDIVERHLIDGDIVLFNRQPSLHKLSIMAHIARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEAYVLMGTKANLVTPRNGEPLIAAIQDFLTAAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPAILKPVTLWTGKQVFSLILQPSHDNPVRANLRTKGKQYCGKGEDLCHNDSYVTIQNSELMCGSLDKGTLGSGSKNNIFYILLRDWGQVEAADAMSRLARLAPVFLSNRGFSIGIGDVTPGQG--------LLKAKQDLLDAGYKKCDEYIEALNTGKLQPQPGCSAEETLEALILRELSVIRDHAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 903          

HSP 2 Score: 176.022 bits (445), Expect = 2.025e-43
Identity = 121/414 (29.23%), Postives = 210/414 (50.72%), Query Frame = 1
Query: 3376 NRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISK--VYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            +R++   LE  +   R+ + ++Q+ PG  VG+L A+S+GEP TQMTL TFHFAGV++ N+TLGVPR+KEIIN S+N  TP +T  L      D + A+ +   +E T L +++   E  + PD    +V+   + +R        +V+ +++    I + + ++    +++   A          ++C  P EN                           Y+       L ++ +QGIP++++  +++ + +  +K +L++                +G  L  V+A   V    TTSN+  E+ +T GIEAAR+ I  E+   +   G  ++ RH+ LL ++MT+KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    +GTG F +L
Sbjct:  994 DRITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIITAHL--DIDDDADFARLVKGRIEKTLLGEISEYIEEVFLPDDCFLLVKLSLERIRLLR----LEVNAETVRY-SICMSKLRVKPGDIAVHGEA----------VLCVTPREN---------------------SKSSMYYVLQSLKEDLPKVVVQGIPEVARAVIHIDEQSGKEKYKLLV----------------EGDNLRSVMATHGVKGSRTTSNNTYEVEKTLGIEAARSTIINEIQYTMVNHGMSIDRRHVMLLADLMTYKGEVLGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLL 1353          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Xenopus
Match: polr3a (polymerase (RNA) III (DNA directed) polypeptide A, 155kDa [Source:NCBI gene;Acc:100124725])

HSP 1 Score: 570.852 bits (1470), Expect = 2.744e-174
Identity = 333/874 (38.10%), Postives = 508/874 (58.12%), Query Frame = 1
Query:  388 PKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPK-IREIMKKTEGSYRKRFDL---IHEECKKVKTCNVICDESEECEK--GLNTIIRQGCN----FVQPKFRR--NGLDYSMETK---DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMN-HSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGT-MYPGAKFVIRENGDRIDLKRRPDSSDI--QLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFL-----PSWNGVMPKPTIAKPQRLWTGKQLFSLII-PGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSS-GSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDT--------ITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVE 2907
            P   G++D R G  +K   CQTC  N++EC GH+G+++L  P +++GY + +I IL+ +C  CS++L+N  + K   + +K+   +Y ++  L   I ++C+K KT  + C       K  GL  II +        V P         D ++E     +S  G+ ++ L    V+ + ++I  ED  ++  N +  +P  +ILT L VPP+ +RP++V +  SG   DDLT KLTEI+ +N+ I++    G  + +I+E  + LQ   A  +++E + +P+ +    +  +   QRLKGK GR R NL GKR D++ RTVI+ DPNL +D+V VP  +A+ LTFPE+V   N + +++LV+NG  ++PGA F+ + +       +  +   I  +L +G+IVERH+++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V  PYNADFDGDEMNLH+PQ++EA AE   L      ++TP++  P+++ +QD LTA   +T++DTF + A+   ++  +           +P P I KP  LWTGKQ+FSLI+ P   N  R +      +  G  + + H D+ V I+N +L+ G L K TLGS S  ++ +I+  +    +  +  + +  +   +L   G +IGI D              + KAK D+ D         I   ++ +L   PG S  +T E  +   L+  RD  GS+  + L K NS  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV NS+ +GLTPTEFFFH M GREG++DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQ  YG DGLD   +E
Sbjct:   31 PLAFGVLDHRMGTSEKDRHCQTCGKNLAECLGHYGYLDLELPCFHVGYFKAVIGILQMICKTCSRILLNAEERKQFLDFLKRPGLTYLQKRGLKKKISDKCRK-KTVCLYCGAYNGSVKKCGLLKIIHEKYKTTKKVVDPMVSHFLQSFDTAIEHNKEVESLLGRAQENLNPLIVLNLLRQIPAEDIPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRITGAKTQMIMEDWDFLQLQCALYINSELSGIPMNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNQANMQLMRKLVQNGPDVHPGANFIQQRHTQMKRFLKYGNREKIAQELRFGDIVERHLIDGDIVLFNRQPSLHKLSIMAHIARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEAYVLMGTKANLVTPRNGEPLIAAIQDFLTAAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPAILKPVTLWTGKQVFSLILQPSHDNPVRANLRTKGKQYCGKGEDLCHNDSYVTIQNSELMCGSLDKGTLGSGSKNNIFYILLRDWGQVEAADAMSRLARLAPVFLSNRGFSIGIGDVTPGQG--------LLKAKQDLLDAGYKKCDEYIEALNTGKLQPQPGCSAEETLEALILRELSVIRDHAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 894          

HSP 2 Score: 176.022 bits (445), Expect = 2.148e-43
Identity = 121/414 (29.23%), Postives = 210/414 (50.72%), Query Frame = 1
Query: 3376 NRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISK--VYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            +R++   LE  +   R+ + ++Q+ PG  VG+L A+S+GEP TQMTL TFHFAGV++ N+TLGVPR+KEIIN S+N  TP +T  L      D + A+ +   +E T L +++   E  + PD    +V+   + +R        +V+ +++    I + + ++    +++   A          ++C  P EN                           Y+       L ++ +QGIP++++  +++ + +  +K +L++                +G  L  V+A   V    TTSN+  E+ +T GIEAAR+ I  E+   +   G  ++ RH+ LL ++MT+KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    +GTG F +L
Sbjct:  985 DRITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIITAHL--DIDDDADFARLVKGRIEKTLLGEISEYIEEVFLPDDCFLLVKLSLERIRLLR----LEVNAETVRY-SICMSKLRVKPGDIAVHGEA----------VLCVTPREN---------------------SKSSMYYVLQSLKEDLPKVVVQGIPEVARAVIHIDEQSGKEKYKLLV----------------EGDNLRSVMATHGVKGSRTTSNNTYEVEKTLGIEAARSTIINEIQYTMVNHGMSIDRRHVMLLADLMTYKGEVLGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLL 1344          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Xenopus
Match: polr3a (polymerase (RNA) III (DNA directed) polypeptide A, 155kDa [Source:NCBI gene;Acc:100124725])

HSP 1 Score: 570.466 bits (1469), Expect = 5.335e-174
Identity = 333/874 (38.10%), Postives = 508/874 (58.12%), Query Frame = 1
Query:  388 PKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPK-IREIMKKTEGSYRKRFDL---IHEECKKVKTCNVICDESEECEK--GLNTIIRQGCN----FVQPKFRR--NGLDYSMETK---DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMN-HSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDI--QLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFL-----PSWNGVMPKPTIAKPQRLWTGKQLFSLII-PGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSS-GSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDT--------ITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVE 2907
            P   G++D R G  +K   CQTC  N++EC GH+G+++L  P +++GY + +I IL+ +C  CS++L+N  + K   + +K+   +Y ++  L   I ++C+K KT  + C       K  GL  II +        V P         D ++E     +S  G+ ++ L    V+ + ++I  ED  ++  N +  +P  +ILT L VPP+ +RP++V +  SG   DDLT KLTEI+ +N+ I++    G  + +I+E  + LQ   A  +++E + +P+ +    +  +   QRLKGK GR R NL GKR D++ RTVI+ DPNL +D+V VP  +A+ LTFPE+V   N + +++LV+NG  ++PGA F+ + +       +  +   I  +L +G+IVERH+++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V  PYNADFDGDEMNLH+PQ++EA AE   L      ++TP++  P+++ +QD LTA   +T++DTF + A+   ++  +           +P P I KP  LWTGKQ+FSLI+ P   N  R +      +  G  + + H D+ V I+N +L+ G L K TLGS S  ++ +I+  +    +  +  + +  +   +L   G +IGI D              + KAK D+ D         I   ++ +L   PG S  +T E  +   L+  RD  GS+  + L K NS  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV NS+ +GLTPTEFFFH M GREG++DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQ  YG DGLD   +E
Sbjct:   49 PLAFGVLDHRMGTSEKDRHCQTCGKNLAECLGHYGYLDLELPCFHVGYFKAVIGILQMICKTCSRILLNAEERKQFLDFLKRPGLTYLQKRGLKKKISDKCRK-KTVCLYCGAYNGSVKKCGLLKIIHEKYKTTKKVVDPMVSHFLQSFDTAIEHNKEVESLLGRAQENLNPLIVLNLLRQIPAEDIPLLLMNPEAGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRITGAKTQMIMEDWDFLQLQCALYINSELSGIPMNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNQANMQLMRKLVQNGPDVHPGANFIQQRHTQMKRFLKYGNREKIAQELRFGDIVERHLIDGDIVLFNRQPSLHKLSIMAHIARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEAYVLMGTKANLVTPRNGEPLIAAIQDFLTAAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPAILKPVTLWTGKQVFSLILQPSHDNPVRANLRTKGKQYCGKGEDLCHNDSYVTIQNSELMCGSLDKGTLGSGSKNNIFYILLRDWGQVEAADAMSRLARLAPVFLSNRGFSIGIGDVTPGQG--------LLKAKQDLLDAGYKKCDEYIEALNTGKLQPQPGCSAEETLEALILRELSVIRDHAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 912          

HSP 2 Score: 176.022 bits (445), Expect = 2.341e-43
Identity = 121/414 (29.23%), Postives = 210/414 (50.72%), Query Frame = 1
Query: 3376 NRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISK--VYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            +R++   LE  +   R+ + ++Q+ PG  VG+L A+S+GEP TQMTL TFHFAGV++ N+TLGVPR+KEIIN S+N  TP +T  L      D + A+ +   +E T L +++   E  + PD    +V+   + +R        +V+ +++    I + + ++    +++   A          ++C  P EN                           Y+       L ++ +QGIP++++  +++ + +  +K +L++                +G  L  V+A   V    TTSN+  E+ +T GIEAAR+ I  E+   +   G  ++ RH+ LL ++MT+KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    +GTG F +L
Sbjct: 1003 DRITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIITAHL--DIDDDADFARLVKGRIEKTLLGEISEYIEEVFLPDDCFLLVKLSLERIRLLR----LEVNAETVRY-SICMSKLRVKPGDIAVHGEA----------VLCVTPREN---------------------SKSSMYYVLQSLKEDLPKVVVQGIPEVARAVIHIDEQSGKEKYKLLV----------------EGDNLRSVMATHGVKGSRTTSNNTYEVEKTLGIEAARSTIINEIQYTMVNHGMSIDRRHVMLLADLMTYKGEVLGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLL 1362          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Mouse
Match: Polr2a (polymerase (RNA) II (DNA directed) polypeptide A [Source:MGI Symbol;Acc:MGI:98086])

HSP 1 Score: 1756.88 bits (4549), Expect = 0.000e+0
Identity = 901/1573 (57.28%), Postives = 1157/1573 (73.55%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECE--------KGLNTIIRQ----GCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXXX----YXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMS----------PSPGLGFSPMMSPKTPHDYFYGLNSPG 4902
            LR IK VQFG+LS  EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  K +K+LR VCF CSKLLV+ ++PKI++I+ K++G  +KR   +++ CK       IC+  EE +        +G   + ++    GC   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRIS+E+C ++G   +Y+RPE MI+TVL VPP++VRPA+VM  S +  DDLTHKL +IVK+NN++R+ E+NG A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKSLKQRLKGK GRVR NLMGKR D++ARTVIT DPNL++DQVGVPR+IA N+TF E VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G +P+P I KP+ LWTGKQ+FSLIIPG +NC RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTV+NNWLL EGHTIGI D++ ++ T ++I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVVSGAKGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MESVMVKYDATVRN I+Q++QLRYGEDGL G  VEFQ L T K +N  FE+ FRFD  +   L R L E  V+++ + A I  +++ E+E+++ DRE LR  +  +   ++ LPCN+ R+IWNA+  F I+    +D+ P  +V  V+ L  +L++V G+D +S  A  N+TLL    +RS LC +++  + RLS EA +W++GEI + F ++  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG +A+D E AK I   LEHTTLRK+  ++ IYYDP+P+++VV  D++WV  YYE PDFDV + S ++LR+ L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  D+ K +E +E+ D+     +L  I++ +L ++ LQGI QISKVY+  P TD+KK++II   G+F+ ++EWILETDG  L +VL+E+ VD   TTSN I EIF   GIEA R A+E E+ +VISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L     LD  +C   M  +  N+  +G A      S      +     + + ++GF   +SP+     G            PSPG   SP  SP +P    Y   SPG
Sbjct:   15 LRTIKRVQFGVLSPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKN----ICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLR-VIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLL-----LDAEKCKYGME-IPTNIPGLGAA----GRSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPSSPYIPSPGGAMSPSYSPTSPA---YEPRSPG 1568          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Mouse
Match: Polr2a (polymerase (RNA) II (DNA directed) polypeptide A [Source:MGI Symbol;Acc:MGI:98086])

HSP 1 Score: 1755.34 bits (4545), Expect = 0.000e+0
Identity = 903/1574 (57.37%), Postives = 1154/1574 (73.32%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECE--------KGLNTIIRQ----GCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXXX----YXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSP----KTPHDYFYGLNSP----GMNP 4911
            LR IK VQFG+LS  EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  K +K+LR VCF CSKLLV+ ++PKI++I+ K++G  +KR   +++ CK       IC+  EE +        +G   + ++    GC   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRIS+E+C ++G   +Y+RPE MI+TVL VPP++VRPA+VM  S +  DDLTHKL +IVK+NN++R+ E+NG A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKSLKQRLKGK GRVR NLMGKR D++ARTVIT DPNL++DQVGVPR+IA N+TF E VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G +P+P I KP+ LWTGKQ+FSLIIPG +NC RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTV+NNWLL EGHTIGI D++ ++ T ++I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVVSGAKGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MESVMVKYDATVRN I+Q++QLRYGEDGL G  VEFQ L T K +N  FE+ FRFD  +   L R L E  V+++ + A I  +++ E+E+++ DRE LR  +  +   ++ LPCN+ R+IWNA+  F I+    +D+ P  +V  V+ L  +L++V G+D +S  A  N+TLL    +RS LC +++  + RLS EA +W++GEI + F ++  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG +A+D E AK I   LEHTTLRK+  ++ IYYDP+P+++VV  D++WV  YYE PDFDV + S ++LR+ L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  D+ K +E +E+ D+     +L  I++ +L ++ LQGI QISKVY+  P TD+KK++II   G+F+ ++EWILETDG  L +VL+E+ VD   TTSN I EIF   GIEA R A+E E+ +VISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L     LD  +C   M  +  N+  +G A P                         G+ F        G +PSP  G SP M+P     TP    YG  SP    GM P
Sbjct:   15 LRTIKRVQFGVLSPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKN----ICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLR-VIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLL-----LDAEKCKYGME-IPTNIPGLGAAGPT------------------------GMFF--------GSAPSPMGGISPAMTPWNQGATPA---YGAWSPSVGSGMTP 1541          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Mouse
Match: Polr3a (polymerase (RNA) III (DNA directed) polypeptide A [Source:MGI Symbol;Acc:MGI:2681836])

HSP 1 Score: 564.688 bits (1454), Expect = 5.586e-172
Identity = 325/871 (37.31%), Postives = 508/871 (58.32%), Query Frame = 1
Query:  388 PKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPK-IREIMKKTEGSYRKRFDL---IHEECKKVKTCNVICDESEECEK-GLNTIIRQG------------CNFVQPKFRRNGLDYSMETKDSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMN-HSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGT-MYPGAKFVIRENGDRIDLKR-----RPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFL-----PSWNGVMPKPTIAKPQRLWTGKQLFSLII-PGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSS-GSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVE 2907
            P   G++D R G  +K   C+TC  N+++C GH+G+I+L  P +++GY   +I IL+ +C  C  ++++  + +   + +K+   +Y ++  L   I ++C+K  TC+     +   +K GL  II +              NF+Q       ++++ E  +   G+ ++ L    V+ +FKRI  ED  ++  N +  +P  +ILT L VPP+ +RP++V +  SG   DDLT KLTEI+ +N+ I++   +G  + +I+E  + LQ   A  +++E + +P+ +    +  +   QRLKGK GR R NL GKR D++ RTVI+ DPNL +D+V VP  +A+ LTFPE+V   N  FL++LVRNG  ++PGA F+ + +   + +KR       +    +L +G+IVERH+++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V  PYNADFDGDEMNLH+PQ++EA AE   L      ++TP++  P+++ +QD LT    +T++DTF + A+   ++  +           +P PTI KP  LWTGKQ+FS+I+ P   N  R +      +  G  + +   D+ V I+N +L+ G + K TLGS S  ++ +I+  +   ++  +  + +  +   +L   G +IGI D        +     +N       + I   ++ +L   PG +  +T E  +   L+  RD  GS+  + L K NS   M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV NS+ +GLTPTEFFFH M GREG++DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQ  YG DGLD   +E
Sbjct:   50 PLLYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQEEKQQFLDFLKRPGLTYLQKRGLKKKISDKCRKKSTCHYCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVSNFLQS--FETAIEHNKEV-EPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLMNPESGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRNGPDVHPGANFIQQRH---MQMKRFLKYGNREKMAQELKFGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLCVNDSYVTIQNSELMCGSMDKGTLGSGSKNNIFYILLRDWGQNEAADAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKYELLNAGYKKCDEYIEALNTGKLQQQPGCTAEETLEALILKELSVIRDHAGSACLRELDKSNSPLTMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVANSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 913          

HSP 2 Score: 171.4 bits (433), Expect = 4.542e-42
Identity = 122/414 (29.47%), Postives = 207/414 (50.00%), Query Frame = 1
Query: 3376 NRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISK--VYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            +R++   +E  +   R+ + ++Q+ PG  VG+L A+S+GEP TQMTL TFHFAGV++ N+TLGVPR+KEIIN S+   TP +T +L      D + A+ +   +E T L +++   E  + PD    +V+   + +R        +V+ +++        R  I   KL ++     +       ++C  P EN                           Y+       L ++ +QGIP++S+  +++ + +  +K +L++                +G  L  V+A   V    TTSN+  E+ +T GIEAAR  I  E+   +   G  ++ RH+ LL ++MT+KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    +GTG F +L
Sbjct: 1004 DRITPTQIEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKAISTPIITAQL--DKDDDADYARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLLR----LEVNAETV--------RYSICTSKLRVKPGDVAV---HGEAVVCVTPREN---------------------SKSSMYYVLQFLKEDLPKVVVQGIPEVSRAVIHIDEQSGKEKFKLLV----------------EGDNLRAVMATHGVKGTRTTSNNTYEVEKTLGIEAARTTIINEIQYTMVNHGMSIDRRHVMLLSDLMTYKGEVLGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLL 1363          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Mouse
Match: Polr3a (polymerase (RNA) III (DNA directed) polypeptide A [Source:MGI Symbol;Acc:MGI:2681836])

HSP 1 Score: 361.303 bits (926), Expect = 7.346e-108
Identity = 206/563 (36.59%), Postives = 333/563 (59.15%), Query Frame = 1
Query:  388 PKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPK-IREIMKKTEGSYRKRFDL---IHEECKKVKTCNVICDESEECEK-GLNTIIRQG------------CNFVQPKFRRNGLDYSMETKDSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMN-HSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGT-MYPGAKFVIRENGDRIDLKR-----RPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFL-----PSWNGVMPKPTIAKPQRLWTGKQLFSLII 1989
            P   G++D R G  +K   C+TC  N+++C GH+G+I+L  P +++GY   +I IL+ +C  C  ++++  + +   + +K+   +Y ++  L   I ++C+K  TC+     +   +K GL  II +              NF+Q       ++++ E  +   G+ ++ L    V+ +FKRI  ED  ++  N +  +P  +ILT L VPP+ +RP++V +  SG   DDLT KLTEI+ +N+ I++   +G  + +I+E  + LQ   A  +++E + +P+ +    +  +   QRLKGK GR R NL GKR D++ RTVI+ DPNL +D+V VP  +A+ LTFPE+V   N  FL++LVRNG  ++PGA F+ + +   + +KR       +    +L +G+IVERH+++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V  PYNADFDGDEMNLH+PQ++EA AE   L      ++TP++  P+++ +QD LT    +T++DTF + A+   ++  +           +P PTI KP  LWTGKQ+FS+I+
Sbjct:   50 PLLYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYIDLELPCFHVGYFRAVIGILQMICKTCCHIMLSQEEKQQFLDFLKRPGLTYLQKRGLKKKISDKCRKKSTCHYCGAFNGTVKKCGLLKIIHEKYKTNKKVVDPIVSNFLQS--FETAIEHNKEV-EPLLGRAQENLNPLVVLNLFKRIPAEDVPLLLMNPESGKPSDLILTRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRISGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTFPEKVNKANINFLRKLVRNGPDVHPGANFIQQRH---MQMKRFLKYGNREKMAQELKFGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVIL 605          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Mouse
Match: Polr1a (polymerase (RNA) I polypeptide A [Source:MGI Symbol;Acc:MGI:1096397])

HSP 1 Score: 330.102 bits (845), Expect = 8.378e-91
Identity = 209/644 (32.45%), Postives = 324/644 (50.31%), Query Frame = 1
Query: 1132 LQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDR-----IDLKRR---------PDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFS-TFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPK--------PTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWI-------------SHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWL-LFEGHTIGIVDTLY--NA-----------------ATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLD 2892
            LQ HV  + D+E   L   ++K       ++Q L+ K G  R ++MGKR DY AR+VI  D  +N +++G+P   A  LT+P+ VTP+N + L+Q V NG  ++PGA  VI E+G R     +D  +R         P +   +    ++V RH+ N D ++ NRQPTLH+ S+  HR ++LP     RL+ +    YNADFDGDEMN H PQS+   AE   LA  ++  + P+  +P+  ++QD + +   MT+R  F    + M L+     + G+  K        P I KP  LWTGKQ+ S ++   +  +            G   W+             S  +++V+I  G+L+ G+L K   GSS+  L+H        +  G     +  +   +L L+ G T+G+ D L   NA                 A +  +      + D++       H ++ +      +   F+E+VN   NE                N+  +MV SGAKGS +N  Q+   +GQ  +EG+R P     ++LP F   +F P + GFV   +L G+ P EFFFH M GREG++DTAVKT+ +GY+QR ++K +E ++++YD TVR+    ++Q  YGEDGLD
Sbjct:  401 LQSHVNIVFDSEMDKL--MLEK----YPGIRQILEKKEGLFRKHMMGKRVDYAARSVICPDMYINTNEIGIPMVFATKLTYPQPVTPWNVQELRQAVINGPNVHPGASMVINEDGSRTALSSVDAAQREAVAKQLLTPATGAPKPQGTKVVCRHVKNGDILLLNRQPTLHRPSIQAHRARILPEEKVLRLHYANCKAYNADFDGDEMNAHFPQSELGRAEAYVLACTDQQYLVPKDGQPLAGLIQDHMVSGANMTIRGCFFTREQYMELV-----YRGLTDKVGRVKLFPPAILKPFPLWTGKQVVSTLLINIIPEDYAPLNLSGKAKIGSKAWVKEKPRPIPDFDPDSMCESQVIIREGELLCGVLDKAHYGSSAYGLVHCCYEIYGGETSGRVLTCLARLFTAYLQLYRGFTLGVEDILVKPNADVVRQRIIEESTQCGPQAVKAALSLPETASCDEIQGKWQDAHLSK-DQRDFNMIDMKFKEEVNHYSNEINKACMPLGLHRQFPENNLQMMVQSGAKGSTVNTMQISCLLGQIELEGRRPPLMASGKSLPCFEPYEFTPRAGGFVTGRFLTGIRPPEFFFHCMAGREGLVDTAVKTSRSGYLQRCIIKHLEGLVIQYDLTVRDSDGSVVQFLYGEDGLD 1032          

HSP 2 Score: 84.3445 bits (207), Expect = 1.577e-15
Identity = 46/84 (54.76%), Postives = 59/84 (70.24%), Query Frame = 1
Query: 3430 FYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTIRLLGA--AAKDVEIAKK 3672
            + +S   PGE VG LAA+S+GEP+TQMTLNTFHFAG    NVTLG+PRL+EI+ V S N KTP +++ +     A K V+  KK
Sbjct: 1207 WQRSLCDPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASANIKTPMMSVPVFDTKKALKKVKSLKK 1290          

HSP 3 Score: 78.9518 bits (193), Expect = 7.040e-14
Identity = 48/162 (29.63%), Postives = 85/162 (52.47%), Query Frame = 1
Query: 4126 TTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLA-ERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDI 4608
            TT    R ++N   + +  +E +L T+G  LP++      +D     SN I  +  T+GIEAA   IE E+ +V +  G  V+ RHL+L+ + M  +G    ++R GI +  +  L + +FE +   L +A      D +K  S  +++G++ + GTG F++
Sbjct: 1552 TTKGITRCLLNETTNSKNEKELVLNTEGINLPELFKYSEILDLRRLYSNDIHAMANTYGIEAALRVIEKEIKDVFAVYGIAVDPRHLSLVADYMCFEGVYKPLNRFGI-QSSSSPLQQMTFETSFQFLKQATMMGSHDELKSPSACLVVGKVVKGGTGLFEL 1712          

HSP 4 Score: 61.6178 bits (148), Expect = 1.331e-8
Identity = 28/68 (41.18%), Postives = 35/68 (51.47%), Query Frame = 1
Query:  382 GKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKL 585
            G P  NGL D   GP D   +C TC  + + C GH GHI+L   VYN    +K+  +LR  C  C  L
Sbjct:   43 GNPSANGLYDLALGPADSKEVCATCVQDFNNCSGHLGHIDLPLTVYNPFLFDKLYLLLRGSCLSCHML 110          
BLAST of DNA-directed RNA polymerase subunit vs. UniProt/SwissProt
Match: sp|P04052|RPB1_DROME (DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster OX=7227 GN=RpII215 PE=3 SV=4)

HSP 1 Score: 1760.73 bits (4559), Expect = 0.000e+0
Identity = 886/1548 (57.24%), Postives = 1144/1548 (73.90%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLNTIIRQ----------GCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXX----XXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLP------MMSGVAQNLFMVGGAT-----PMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEA-GMSPS 4827
            LR++K VQFGILS  E+R +SV++  G+ + E  + G+PK  GLMDPRQG +D+ S CQTC+GN++ECPGHFGHI+LA+PV++IG+  K IKILR VCF CSK+LV+ H+PKI+EI+ K+ G  RKR   +++ CK       IC+  E+ +  L    +Q          GC   QP  RR GLD + E K  + D  + K  + A +V E+ K I++E+C I+G + KY+RP+ MI+TVL VPP+AVRPA+VM  + K  DDLTHKL++I+K NNE+R+ E +G A+ +I E    LQ+HVATL+DN+   +P A+QKSG+PLK++K RLKGK GR+R NLMGKR D++ARTVIT DPNL +DQVGVPR+IAQNLTFPE VTPFN   +Q+LVR G + YPGAK+++R+NG+RIDL+  P SSD+ L  G  VERH+ +DD V+FNRQPTLHKMSMMGHRVKVLP+STFR+NLS T PYNADFDGDEMNLH+PQS E  AE+ N+    + +ITPQ+N+PVM IVQD+LTA  KMT RD F+   ++M+LLMFLP+W+  MP+P I KP+ LWTGKQ+FSLIIPG VN  RTHSTHP+ ED GPYKWIS  DT+V++E+G+LIMGILCKK+LG+S+GSL+HI  LE   D  G F+ NIQTV+NNWLLFEGH+IGI DT+ +  T  EI+  I KAKDDV + I K H+ EL  TPG +L QTFE KVN ILN+ARDKTG SA+KSL++YN+   MVVSG+KGS INISQVIACVGQQNVEGKRIP+GF++RTLPHFIK D+GPESRGFVENSYLAGLTP+EF+FHAMGGREG+IDTAVKTAETGYIQRRL+KAMESVMV YD TVRN + QLIQLRYGEDGL G  VEFQ +PT K++N +FE+ F+FD  +   + +  T+  ++E+ + ++ + +++AEW++L  DR+ LR+        ++ LPCN+QR+IWN +  F I+    TD+ P  ++  V+ L    ++V GNDRIS  AN N+TLL  CLIRS LC K V  + RLS EA EW++GEI   F ++Q +PGEMVG+LAA+SLGEPATQMTLNTFHFAGVS+KNVTLGVPRLKEIIN+S+ PK PSLT+ L G AA+D E AK +   LEHTTLRK+  ++ IYYDPDP+ +V+  D+++V  YYE PDFD  + S ++LRI L RK++TDKKL+++ IAEKI   F  D+ C   D+N D LVLRIR++  ++ K    +E  D+MED  +L  I+  +L ++ LQGI  I KVY+  P TD KKR++I   G+F+ + EW+LETDGT + KVL+ER VD   T+SN I EIF+  GIEA R ++E EM  V+ F G YVNYRHLALLC++MT KG LM+I RHGINRQ+TGAL R SFEETVD+LM+A AHAE DPM+GVSE+I++GQL +MGTGCFD+L++  +      +P      M+ G A  +F+ GG+T     PM   +   +    S     ++ T  G +FSPS  S+A GMSPS
Sbjct:   11 LRQVKRVQFGILSPDEIRRMSVTEG-GVQFAETMEGGRPKLGGLMDPRQGVIDRTSRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTIKILRCVCFYCSKMLVSPHNPKIKEIVMKSRGQPRKRLAYVYDLCKG----KTICEGGEDMD--LTKENQQPDPNKKPGHGGCGHYQPSIRRTGLDLTAEWKHQNEDSQEKKIVVSAERVWEILKHITDEECFILGMDPKYARPDWMIVTVLPVPPLAVRPAVVMFGAAKNQDDLTHKLSDIIKANNELRKNEASGAAAHVIQENIKMLQFHVATLVDNDMPGMPRAMQKSGKPLKAIKARLKGKEGRIRGNLMGKRVDFSARTVITPDPNLRIDQVGVPRSIAQNLTFPELVTPFNIDRMQELVRRGNSQYPGAKYIVRDNGERIDLRFHPKSSDLHLQCGYKVERHLRDDDLVIFNRQPTLHKMSMMGHRVKVLPWSTFRMNLSCTSPYNADFDGDEMNLHVPQSMETRAEVENIHITPRQIITPQANKPVMGIVQDTLTAVRKMTKRDVFITREQVMNLLMFLPTWDAKMPQPCILKPRPLWTGKQIFSLIIPGNVNMIRTHSTHPDEEDEGPYKWISPGDTKVMVEHGELIMGILCKKSLGTSAGSLLHICFLELGHDIAGRFYGNIQTVINNWLLFEGHSIGIGDTIADPQTYNEIQQAIKKAKDDVINVIQKAHNMELEPTPGNTLRQTFENKVNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACVGQQNVEGKRIPYGFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEFYFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSVGQLIQLRYGEDGLCGELVEFQNMPTVKLSNKSFEKRFKFDWSNERLMKKVFTDDVIKEMTDSSEAIQELEAEWDRLVSDRDSLRQIFPNGE-SKVVLPCNLQRMIWNVQKIFHINKRLPTDLSPIRVIKGVKTLLERCVIVTGNDRISKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLVGEIETRFQQAQANPGEMVGALAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTGGAARDAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQRTVISEDQEFVNVYYEMPDFDPTRISPWLLRIELDRKRMTDKKLTMEQIAEKINVGFGEDLNCIFNDDNADKLVLRIRIMNNEENKFQDEDEAVDKMEDDMFLRCIEANMLSDMTLQGIEAIGKVYMHLPQTDSKKRIVITETGEFKAIGEWLLETDGTSMMKVLSERDVDPIRTSSNDICEIFQVLGIEAVRKSVEKEMNAVLQFYGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAAHAETDPMRGVSENIIMGQLPKMGTGCFDLLLDAEKCRFGIEIPNTLGNSMLGGAA--MFIGGGSTPSMTPPMTPWANCNTPRYFSPPGHVSAMTPGGPSFSPSAASDASGMSPS 1548          
BLAST of DNA-directed RNA polymerase subunit vs. UniProt/SwissProt
Match: sp|P08775|RPB1_MOUSE (DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus OX=10090 GN=Polr2a PE=1 SV=3)

HSP 1 Score: 1755.34 bits (4545), Expect = 0.000e+0
Identity = 903/1574 (57.37%), Postives = 1154/1574 (73.32%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECE--------KGLNTIIRQ----GCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXXX----YXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSP----KTPHDYFYGLNSP----GMNP 4911
            LR IK VQFG+LS  EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  K +K+LR VCF CSKLLV+ ++PKI++I+ K++G  +KR   +++ CK       IC+  EE +        +G   + ++    GC   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRIS+E+C ++G   +Y+RPE MI+TVL VPP++VRPA+VM  S +  DDLTHKL +IVK+NN++R+ E+NG A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKSLKQRLKGK GRVR NLMGKR D++ARTVIT DPNL++DQVGVPR+IA N+TF E VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G +P+P I KP+ LWTGKQ+FSLIIPG +NC RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTV+NNWLL EGHTIGI D++ ++ T ++I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVVSGAKGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MESVMVKYDATVRN I+Q++QLRYGEDGL G  VEFQ L T K +N  FE+ FRFD  +   L R L E  V+++ + A I  +++ E+E+++ DRE LR  +  +   ++ LPCN+ R+IWNA+  F I+    +D+ P  +V  V+ L  +L++V G+D +S  A  N+TLL    +RS LC +++  + RLS EA +W++GEI + F ++  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG +A+D E AK I   LEHTTLRK+  ++ IYYDP+P+++VV  D++WV  YYE PDFDV + S ++LR+ L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  D+ K +E +E+ D+     +L  I++ +L ++ LQGI QISKVY+  P TD+KK++II   G+F+ ++EWILETDG  L +VL+E+ VD   TTSN I EIF   GIEA R A+E E+ +VISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L     LD  +C   M  +  N+  +G A P                         G+ F        G +PSP  G SP M+P     TP    YG  SP    GM P
Sbjct:   15 LRTIKRVQFGVLSPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKN----ICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLR-VIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLL-----LDAEKCKYGME-IPTNIPGLGAAGPT------------------------GMFF--------GSAPSPMGGISPAMTPWNQGATPA---YGAWSPSVGSGMTP 1541          
BLAST of DNA-directed RNA polymerase subunit vs. UniProt/SwissProt
Match: sp|P24928|RPB1_HUMAN (DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2)

HSP 1 Score: 1754.96 bits (4544), Expect = 0.000e+0
Identity = 903/1574 (57.37%), Postives = 1154/1574 (73.32%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECE--------KGLNTIIRQ----GCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXXX----YXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSP----KTPHDYFYGLNSP----GMNP 4911
            LR IK VQFG+LS  EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  K +K+LR VCF CSKLLV+ ++PKI++I+ K++G  +KR   +++ CK       IC+  EE +        +G   + ++    GC   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRIS+E+C ++G   +Y+RPE MI+TVL VPP++VRPA+VM  S +  DDLTHKL +IVK+NN++R+ E+NG A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKSLKQRLKGK GRVR NLMGKR D++ARTVIT DPNL++DQVGVPR+IA N+TF E VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G +P+P I KP+ LWTGKQ+FSLIIPG +NC RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTV+NNWLL EGHTIGI D++ ++ T ++I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVVSGAKGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MESVMVKYDATVRN I+Q++QLRYGEDGL G  VEFQ L T K +N  FE+ FRFD  +   L R L E  V+++ + A I  +++ E+E+++ DRE LR  +  +   ++ LPCN+ R+IWNA+  F I+    +D+ P  +V  V+ L  +L++V G+D +S  A  N+TLL    +RS LC +++  + RLS EA +W++GEI + F ++  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG +A+D E AK I   LEHTTLRK+  ++ IYYDP+P+++VV  D++WV  YYE PDFDV + S ++LR+ L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  D+ K +E +E+ D+     +L  I++ +L ++ LQGI QISKVY+  P TD+KK++II   G+F+ ++EWILETDG  L +VL+E+ VD   TTSN I EIF   GIEA R A+E E+ +VISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L     LD  +C   M  +  N+  +G A P                         G+ F        G +PSP  G SP M+P     TP    YG  SP    GM P
Sbjct:   15 LRTIKRVQFGVLSPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKN----ICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLR-VIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLL-----LDAEKCKYGME-IPTNIPGLGAAGPT------------------------GMFF--------GSAPSPMGGISPAMTPWNQGATPA---YGAWSPSVGSGMTP 1541          
BLAST of DNA-directed RNA polymerase subunit vs. UniProt/SwissProt
Match: sp|P11414|RPB1_CRIGR (DNA-directed RNA polymerase II subunit RPB1 OS=Cricetulus griseus OX=10029 GN=POLR2A PE=2 SV=2)

HSP 1 Score: 1754.96 bits (4544), Expect = 0.000e+0
Identity = 903/1574 (57.37%), Postives = 1154/1574 (73.32%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECE--------KGLNTIIRQ----GCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXXX----YXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSP----KTPHDYFYGLNSP----GMNP 4911
            LR IK VQFG+LS  EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  K +K+LR VCF CSKLLV+ ++PKI++I+ K++G  +KR   +++ CK       IC+  EE +        +G   + ++    GC   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRIS+E+C ++G   +Y+RPE MI+TVL VPP++VRPA+VM  S +  DDLTHKL +IVK+NN++R+ E+NG A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKSLKQRLKGK GRVR NLMGKR D++ARTVIT DPNL++DQVGVPR+IA N+TF E VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G +P+P I KP+ LWTGKQ+FSLIIPG +NC RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTV+NNWLL EGHTIGI D++ ++ T ++I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVVSGAKGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MESVMVKYDATVRN I+Q++QLRYGEDGL G  VEFQ L T K +N  FE+ FRFD  +   L R L E  V+++ + A I  +++ E+E+++ DRE LR  +  +   ++ LPCN+ R+IWNA+  F I+    +D+ P  +V  V+ L  +L++V G+D +S  A  N+TLL    +RS LC +++  + RLS EA +W++GEI + F ++  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG +A+D E AK I   LEHTTLRK+  ++ IYYDP+P+++VV  D++WV  YYE PDFDV + S ++LR+ L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  D+ K +E +E+ D+     +L  I++ +L ++ LQGI QISKVY+  P TD+KK++II   G+F+ ++EWILETDG  L +VL+E+ VD   TTSN I EIF   GIEA R A+E E+ +VISFDGSYVNYRHLALLC+ MT +G LM+I RHG+NRQ+TG L + SFEETVD+LMEA AH E DPMKGVSE+IMLGQLA  GTGCFD+L     LD  +C   M  +  N+  +G A P                         G+ F        G +PSP  G SP M+P     TP    YG  SP    GM P
Sbjct:   15 LRTIKRVQFGVLSPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKN----ICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQNGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSLKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLSIDQVGVPRSIAANMTFAEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQTGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAILKPRPLWTGKQIFSLIIPGHINCIRTHSTHPDDEDSGPYKHISPGDTKVVVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVINNWLLIEGHTIGIGDSIADSKTYQDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVSGAKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQNELEREFERMREDREVLR-VIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKVVEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLLGEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAEDQEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGPLMKCSFEETVDVLMEAAAHGESDPMKGVSENIMLGQLAPAGTGCFDLL-----LDAEKCKYGME-IPTNIPGLGAAGPT------------------------GMFF--------GSAPSPMGGISPAMTPWNQGATPA---YGAWSPSVGSGMTP 1541          
BLAST of DNA-directed RNA polymerase subunit vs. UniProt/SwissProt
Match: sp|P35074|RPB1_CAEBR (DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae OX=6238 GN=rpb-1 PE=3 SV=2)

HSP 1 Score: 1747.25 bits (4524), Expect = 0.000e+0
Identity = 889/1577 (56.37%), Postives = 1145/1577 (72.61%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGL----------NTIIRQGCNFVQPKFRRNGLDYSMETK---DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRML---XXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGA-------TPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGLGFSP--------MMSPKTPHDYFYGLNSPGM 4905
            LR +  VQFGIL   E++ +       + +PE  ++GKPK  GLMDPRQG +D+   C TC+GN+++CPGHFGH+ LA+PV++IG+  K +KILR VCF C +LL++  +P++ +I+KKT G+ +KR  LI++ CK       +C+ + E E GL             +  GC   QP +RR G+D + E K   + D  + K  L A +V+EVFK+I++ED +++G + +++RPE MI TVL VPP+AVRPA+V   S K  DDLTHKL++I+K N ++++ E NG A+ ++ +    LQYHVATL+DN    LP A QK GRPLKS+KQRLKGK GR+R NLMGKR D++ARTVITADPNL +D VGVPR IAQNLTFPE VTPFN   LQ+LV  G T YPGAK++IRENG R+DL+  P ++D+ L  G  VERHM + D +VFNRQPTLHKMSMMGHRVK+LP+STFR+NLSVT PYNADFDGDEMNLH+PQS E  AEI  +A V + +ITPQ+N+PVM IVQD+L A   MT RD F++   MM LLM+LP+W+G +P+P I KP+ LWTGKQ+FSLIIPG VN  RTHSTHP+SEDSGPYKWIS  DT+VLIE+G+L+ GI+C KT+G S+G+L+H++ALE   +   NF+++IQTV+N WLL EGHTIGI DT+ + +T  +I+  I KAK DV D I K H+++L  TPG +L QTFE KVN ILN+ARD+TGSSAQKSLS++N+F  MVVSG+KGSKINISQVIACVGQQNVEGKRIPFGF+ RTLPHFIK D+GPES+GFVENSYLAGLTP+EFFFHAMGGREG+IDTAVKTAETGYIQRRL+KAMESVMV YD TVRN + Q++QLRYGEDGLDG +VE Q +PT K NN  FER+FR D+ D   L ++ +E  V+EI+   D ++ +++EW QL+ DR  LR+        ++ LPCN+QRLIWNA+  FK+D+ K  ++ P  ++N VR L  +LI+V GND IS  A  N+TLL+  L+RS LC KK+    +L+ EA +W++GEI   F ++   PGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKEIINVS+  KTPSLT+ L GAAAKD E AK +   LEHTTL+K+  ++ IYYDPDP+N+V+  D +WV  +YE PD D+ + S ++LRI L RK++ DKKL+++ IA++I   F  D+     D+N + LV R+R+    K  + +EE+ D+MED  +L  I+  +L ++ LQGIP ISKVY+++P TDDKKR+II  +G F+ V +WILETDGT L +VL+ER +D   TTSN I EIFE  GIEA R +IE EM NVISFDGSYVNYRHLALLC++MT KG LM+I RHGINRQE GAL R SFEETVDILMEA  HAE DP+KGVSE+IMLGQLAR GTGCFD++++  +      +P    +   ++  G A       +P +S        + S  +SP         FSP+G  + G SP    G+SP         +SP+TP    YG  SPG+
Sbjct:   12 LRTVCRVQFGILGPEEIKRM---SVAHVEFPEVYENGKPKMGGLMDPRQGVIDRRGRCMTCAGNLTDCPGHFGHLELAKPVFHIGFLTKSLKILRCVCFYCGRLLIDKTNPRVMDILKKTSGNPKKRLALIYDLCKS----KSVCEGAAEKEDGLPDDMDDPMNEGKKVPAGCGRYQPSYRRVGIDINAEWKKNVNEDTQERKIMLTAERVLEVFKQITDEDILVIGMDPQFARPEWMICTVLPVPPLAVRPAVVTFGSAKNQDDLTHKLSDIIKTNQQLQRNEANGAAAHVLTDDVRLLQYHVATLVDNCIPGLPTATQKGGRPLKSIKQRLKGKEGRIRGNLMGKRVDFSARTVITADPNLPIDTVGVPRTIAQNLTFPEIVTPFNVDKLQELVNRGDTQYPGAKYIIRENGARVDLRYHPRAADLHLQPGYRVERHMKDGDIIVFNRQPTLHKMSMMGHRVKILPWSTFRMNLSVTSPYNADFDGDEMNLHLPQSLETRAEIEEIAMVPRQLITPQANKPVMGIVQDTLCAVRMMTKRDIFIDWPFMMDLLMYLPTWDGKVPQPAILKPKPLWTGKQVFSLIIPGNVNVLRTHSTHPDSEDSGPYKWISPGDTKVLIEHGELLSGIVCSKTVGKSAGNLLHVVALELGHEIAANFYSHIQTVINAWLLREGHTIGIGDTIADQSTYLDIQNTIRKAKQDVVDVIEKAHNDDLEPTPGNTLRQTFENKVNQILNDARDRTGSSAQKSLSEFNNFKSMVVSGSKGSKINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIKDDYGPESKGFVENSYLAGLTPSEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSLAQMVQLRYGEDGLDGMWVENQNMPTMKPNNAVFERDFRMDLTDNKFLRKNYSEDVVREIQEAQDGISLVESEWSQLEEDRRLLRKIFPRGD-AKIVLPCNLQRLIWNAQKIFKVDLRKPVNLSPLHVINGVRELSKKLIIVSGNDEISKQAQYNATLLMNILLRSTLCTKKMCTSAKLNTEAFDWLLGEIETRFQQAIAQPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKQLKTPSLTVFLTGAAAKDPEKAKDVLCKLEHTTLKKVTCNTAIYYDPDPKNTVIAEDEEWVSIFYEMPDHDLTRTSPWLLRIELDRKRMVDKKLTMEMIADRIHGGFGQDVHTIYTDDNAEKLVFRLRIAGEDKGAEGQEEQVDKMEDDVFLRCIEANMLSDLTLQGIPAISKVYMNQPNTDDKKRIIITPEGGFKAVADWILETDGTALLRVLSERQIDPVRTTSNDICEIFEVLGIEAVRKSIEKEMDNVISFDGSYVNYRHLALLCDVMTAKGHLMAITRHGINRQEVGALMRCSFEETVDILMEASVHAEVDPVKGVSENIMLGQLARCGTGCFDLVLDVEKCKHGMEIPQNVVMGAGIYGGGFAGSPSREFSPAHSPWNSGVTPNYSGPWSPTGGMSPSAGFSPAGNLDGGASPFNEGGWSPASPGDPLGALSPRTPA---YGGMSPGV 1577          
BLAST of DNA-directed RNA polymerase subunit vs. TrEMBL
Match: A0A1S6KMI6 (DNA-directed RNA polymerase subunit OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 2430.6 bits (6298), Expect = 0.000e+0
Identity = 1195/1560 (76.60%), Postives = 1353/1560 (86.73%), Query Frame = 1
Query:  244 LLNMAIATVTLREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETKDSDDGKG-KQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXX--XXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSPKTPHDYFYGLNSPGMNPL 4914
            + N+ + +V LRE+K VQFGILS  E++ LSV    GIIY EKTQDGKPKK+GLMDPRQGP DKYS CQTC G+V+ECPGHFGHINLARPV++IG+KEKIIKILRSVCFKCSKLL +++   ++EI+KKTE + RKRFD +++EC++ K C+V   + +E +     + R GC +VQP FRRNGL+Y +  KD       KQPL A+QV+E+F+RI+ EDC++MGFN KYSRPE MI+TVL+VPP+AVRPA+VMNH+GK+HDDLTHKLTE+VKVNNEIR AEENGVASTI+LEKENSLQYHVAT +DNES FLP AIQKSGRPLK+LKQRLKGKHGR+RSNLMGKRTDY+ARTVITADPNLNLDQVGVPR IAQNLTFPE+VTPFNK +LQQLV+NGTMYPGA FVIRENGDRIDLKRRPDSSDIQL YGE VERHMLNDDFVVFNRQPTLHKMSMM HRVKVLPFSTFRLNLSVT PYNADFDGDEMNLH+PQS E  AE+++LARV KL+ITPQSN+PVMSIVQD+LTACNKMT RD FLN AE+MHLLM+LP+WNG +PKP I KP RLWTGKQ+FSLIIPG+VNC RTHSTHPE E++GPYKWIS  DT+VLIE+G+LI GILCKKTLGSS+GSL+HIIALEQ  D+ G FFNN+QTVVNNWLL EGHTIGIVD LY+A TREEIK  I++AK+ VF+TI K H+ EL STPG +L QTFE  VN ILN+ARDKTGS AQKSLSKYN+FNLMV+SGAKGSKINISQVIACVGQQNVEGKRIPFGF+QRTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+KAMESVM+KYD+TVRNQIDQLIQ RYGEDGLDG FVEFQ LPT+K     FE+ FRFDI + D+LSR+LTEKRV+EI  EAD +  +D EW+QL  DRE +R+ +K  TGGR+ LPCN+ RL+ N +  FKID+LKKTDIKP DI+ KV NLC +LIVV G+D IS TAN N+TLL CCLIRS LCCKKVI + RLS EA +W++GEI+  F +S V PGEMVG+LAAESLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKEIINVSRNPKTPSLT+ L G AAKD E+AK IAA LEHTTLRKLAV SEIYYDP+PE+SV+E DR+WVRTYYE PDFD+DKKS Y+LRIVL RKK+TDKKL+LQ+IAEKITEYF+NDIICH+PD+NL+LVLRIRMLKK+DEK++E  EMEDRKYLEL++NLILDEICLQGIPQISKVY+  P TDDKK+++INS G FE   EWILETDGTCL KVLAER VDSETT SNHITEIFETFGIEAARNAIE EM +VISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLA++GTGCFDILMN+ + +EAQ LPMMSGVA NL+MVGGATPMNSASPQL+      S          FG +FSP   SE GMSP+P L FSPMMSPKTP DY +G  SP MNP+
Sbjct:    1 MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKDDSSDSDSKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEFQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIRMLKKEDEKDDEKLEMEDRKYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPI 1560          
BLAST of DNA-directed RNA polymerase subunit vs. TrEMBL
Match: A0A419Q500 (DNA-directed RNA polymerase subunit OS=Clonorchis sinensis OX=79923 GN=Polr2a PE=3 SV=1)

HSP 1 Score: 1958.73 bits (5073), Expect = 0.000e+0
Identity = 957/1491 (64.19%), Postives = 1168/1491 (78.34%), Query Frame = 1
Query:  253 MAIATVTLREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTC----NVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXX-----XXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGG 4692
            MA     LR++K +QFGILS  E++ +SV++  GI Y E  + GKPK  GLMDPRQG +D+ S+CQTCSGNVS CPGHFGH+ LA+PV++IG+ +K +K+LR VCF CSK+LV++  P+I+EI++KT+   R+R   ++EECK    C    + I  E++  E   N   R GC   QP+FRR GL+ + E K  + +  + K  L A +V+EVFKRIS+EDC+ +GF+ +Y+RP+ MI+TVL VPP+AVRPA+VM  + +  DDLTHKL +I+K NN++R+ E+NG AS I+ E    LQ+HV T+ DN+   LP AIQKSGRPLKS+K RLKGK GR+R NLMGKR D++ARTVITADPNLNLDQVGVPR IAQNLT+PE VT FN   LQ+LV+NGT+YPGAKF++RENGDRIDL+  P  +D+ L  G +VERHMLNDD+V+FNRQPTLHKMSMM HRVKVLP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI+ LARV++LVITPQ+N+PVMSIVQD+LTA NKMT RD FLN AEMM+LLM+LP+WNG MPKP I KPQRLWTGKQLF+LIIPG+VNC RTHSTHPE ED GPY+WIS  DT+V++++G LI GILCKKTLGS SGSL+HI+ALE   + +  FFNNIQTVVNNWLL EGHTIGI DTLY+ ATR +I   I KAKD VF+ I + H+ +L  TPG +L QTFE  VN ILN+ARDKTGS AQ+SLSKYN+FN+MVV+G+KGS+INISQVIACVGQQNVEGKRIPFGF+ RTLPHFI+ D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+KAMESVMVKYD TVRNQI+QLIQLRYGEDGLD   VEFQ LPT+K ++  FE  FRFDI +   L R + E  V+ +  ++    ++DAEW QL  DRE LR  +++ T   + LPCN+ RL+ NA+  F+ID L KT++ P  +V  VR  C  L+VVPG+DR+S  AN N+TLL+  LIRS LC KKVI + RLS EAL+W++GEIR  F ++Q+HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKEIINVS+ PKTPS+TI L G AA+D E  K + A LEHTTLR+L  S+ IYYDPDP+NSVVE DR+WV TYYE PDFDV+  S ++LRI   RK +T KKLS++ I++KIT  F ND+ICH+PD+NL LV+RIR++         E +   D+MED  +L  I+  +L +I LQGIPQI+KVY+ +P T DKKR++I   G F+ V EW+LETDGTCL +VLAER VD   T SN I EIFE  GIEA R AIE EM +VISFDGSYVNYRHLALLC+IMT KG LM+I RHG+NR +TGALAR SFEETVDILM+A  HAECDPM GVSE+IMLGQLA++GTGCFD+L++ A+  EAQ +P+   V   LF   G
Sbjct:    4 MAGGGPPLRDVKALQFGILSPDEIKEMSVTNDGGIKYAETMEGGKPKIGGLMDPRQGCVDRGSICQTCSGNVSNCPGHFGHVELAKPVFHIGFMKKTLKLLRCVCFHCSKILVDVQSPQIQEILRKTKNDNRRRMMFMYEECKSRTECLSNEDQIGGENDTLE---NKTKRAGCGRYQPRFRRIGLELTAEWKKINEESQERKITLTAERVLEVFKRISDEDCLSLGFDPRYARPDWMIITVLPVPPLAVRPAVVMYGATRNQDDLTHKLADIIKANNQLRRDEQNGAASHILAEDIRMLQFHVTTMTDNDVPGLPKAIQKSGRPLKSIKTRLKGKAGRIRGNLMGKRVDFSARTVITADPNLNLDQVGVPRTIAQNLTYPENVTQFNIDHLQKLVQNGTLYPGAKFIVRENGDRIDLRYHPKVADLTLQVGYVVERHMLNDDYVIFNRQPTLHKMSMMCHRVKVLPWSTFRLNLSVTSPYNADFDGDEMNLHLPQSVETKAEISQLARVSRLVITPQANKPVMSIVQDTLTAVNKMTQRDVFLNRAEMMNLLMYLPTWNGRMPKPAIYKPQRLWTGKQLFTLIIPGRVNCIRTHSTHPEDEDGGPYRWISPGDTKVIVDDGDLIAGILCKKTLGSGSGSLIHIVALEHHHEQVSMFFNNIQTVVNNWLLIEGHTIGIADTLYDQATRRQIGETITKAKDAVFEIIDQAHNYDLQPTPGNTLRQTFENSVNKILNDARDKTGSCAQRSLSKYNNFNIMVVAGSKGSRINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIQDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVKYDGTVRNQINQLIQLRYGEDGLDATHVEFQRLPTFKPSHAAFEHGFRFDIGNERALRRCMPEDVVRSLATDSQTQAELDAEWMQLCADRETLRSIIRK-TDDTVVLPCNINRLVMNAQKIFEIDPLSKTNVHPRQVVEMVRETCKRLVVVPGDDRLSREANANATLLMGALIRSSLCAKKVINEYRLSYEALDWVLGEIRARFQQAQIHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKKPKTPSMTIYLTGPAARDAERTKDVVARLEHTTLRRLVNSTYIYYDPDPKNSVVEEDREWVSTYYELPDFDVNAISSWMLRIEFARKGMTGKKLSMEQISDKITRAFGNDLICHIPDDNLKLVMRIRIMNSDLEKDLKEADTTSDKMEDDTFLRFIEANLLSDITLQGIPQITKVYMHRPQTQDKKRVVIKDDGSFDAVAEWMLETDGTCLMRVLAERDVDPTRTVSNDIVEIFEALGIEAVRKAIECEMYHVISFDGSYVNYRHLALLCDIMTVKGHLMAITRHGLNRLDTGALARCSFEETVDILMDAATHAECDPMAGVSETIMLGQLAKIGTGCFDLLLDSAKCQEAQPIPLAGVVGMGLFNAPG 1490          
BLAST of DNA-directed RNA polymerase subunit vs. TrEMBL
Match: A0A4S2M8D4 (DNA-directed RNA polymerase subunit OS=Opisthorchis felineus OX=147828 GN=CRM22_001927 PE=3 SV=1)

HSP 1 Score: 1954.87 bits (5063), Expect = 0.000e+0
Identity = 954/1488 (64.11%), Postives = 1167/1488 (78.43%), Query Frame = 1
Query:  253 MAIATVTLREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESE-ECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXX-----XXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGG 4692
            MA     LR+++++QFGILS  E++ +SV++  GI Y E  + GKPK  GLMDPRQG +D+ S+CQTCSGNVS CPGHFGH+ LA+PV++IG+ +K +K+LR VCF CSK+LV++  P+I+EI++KT+   R+R   ++EECK    C    D++  E +   N   R GC   QP+FRR GL+ + E K  + +  + K  L A +V+EVFKRIS+EDC+ +GF+ +Y+RP+ MI+TVL VPP+AVRPA+VM  + +  DDLTHKL +I+K NN++R+ E+NG AS I+ E    LQ+HV T+ DN+   LP AIQKSGRPLKS+K RLKGK GR+R NLMGKR D++ARTVITADPNLNLDQVGVPR IAQNLT+PE VT FN   LQ+LV+NGT+YPGAKF++RENGDRIDL+  P  +D+ L  G +VERHMLNDD+V+FNRQPTLHKMSMM HRVKVLP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI+ LARV++LVITPQ+N+PVMSIVQD+LTA NKMT RD FLN AEMM+LLM+LP+WNG MPKP I KPQRLWTGKQLF+LIIPG+VNC RTHSTHPE ED GPY+WIS  DT+V++++G LI GILCKKTLGS SGSL+HI+ALE   + +  FFNNIQTVVNNWLL EGHTIGI DTLY+  TR +I   I KAKD VF+ I + H+ +L  TPG +L QTFE  VN ILN+ARDKTGS AQ+SLSKYN+FN+MVV+G+KGS+INISQVIACVGQQNVEGKRIPFGF+ RTLPHFI+ D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+KAMESVMVKYD TVRNQI+QLIQLRYGEDGLD   VEFQ LPT+K ++  FE  FRFDI +   L R + E  V+ +  ++    ++DAEW QL  DRE LR  +++ T   + LPCN+ RL+ NA+  F+ID L KT++ P  +V  VR  C  L+VVPG+DR+S  AN N+TLL+  LIRS LC KKVI + RLS EAL+W++GEIR  F ++Q+HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKEIINVS+ PKTPS+TI L G AA+D E  K + A LEHTTLR+L  S+ IYYDPDP+NSVVE DR+WV TYYE PDFDV+  S ++LRI   RK +T KKLS++ I++KIT  F ND+ICH+PD+NL LV+RIR++         E +   D+MED  +L  I+  +L +I LQGIPQI+KVY+ +P T DKKR++I   G F+ V EW+LETDGTCL +VLAER VD   T SN I EIFE  GIEA R AIE EM +VISFDGSYVNYRHLALLC+IMT KG LM+I RHG+NR +TGALAR SFEETVDILM+A  HAECDPM GVSE+IMLGQLA++GTGCFD+L++ A+  EAQ +P+   V   LF   G
Sbjct:    4 MAGGGPPLRDVRSLQFGILSPDEIKEMSVTNDGGIKYAETMEGGKPKIGGLMDPRQGCVDRGSICQTCSGNVSNCPGHFGHVELAKPVFHIGFMKKTLKLLRCVCFHCSKILVDVQSPQIQEILRKTKNDNRRRMMFMYEECKSRTECLSNEDQNGGENDTLENKTKRAGCGRYQPRFRRIGLELTAEWKKINEESQERKITLTAERVLEVFKRISDEDCLSLGFDPRYARPDWMIITVLPVPPLAVRPAVVMYGATRNQDDLTHKLADIIKANNQLRRDEQNGAASHILAEDIRMLQFHVTTMTDNDVPGLPKAIQKSGRPLKSIKTRLKGKAGRIRGNLMGKRVDFSARTVITADPNLNLDQVGVPRTIAQNLTYPENVTQFNIDHLQKLVQNGTLYPGAKFIVRENGDRIDLRYHPKVADLTLQVGYVVERHMLNDDYVIFNRQPTLHKMSMMCHRVKVLPWSTFRLNLSVTSPYNADFDGDEMNLHLPQSVETKAEISQLARVSRLVITPQANKPVMSIVQDTLTAVNKMTQRDVFLNRAEMMNLLMYLPTWNGRMPKPAIYKPQRLWTGKQLFTLIIPGRVNCIRTHSTHPEDEDGGPYRWISPGDTKVIVDDGDLIAGILCKKTLGSGSGSLIHIVALEHHHEQVSMFFNNIQTVVNNWLLIEGHTIGIADTLYDQVTRRQIGETITKAKDAVFEIIDQAHNYDLQPTPGNTLRQTFENSVNKILNDARDKTGSCAQRSLSKYNNFNIMVVAGSKGSRINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIQDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVKYDGTVRNQINQLIQLRYGEDGLDATHVEFQRLPTFKPSHAAFEHGFRFDIGNERALRRCMPEDVVRSLATDSQTQAELDAEWMQLCADRETLRSIIRK-TDDTVVLPCNINRLVMNAQKIFEIDPLSKTNVHPRQVVEMVRETCKRLVVVPGDDRLSREANANATLLMGALIRSSLCAKKVINEYRLSYEALDWVLGEIRARFQQAQIHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKKPKTPSMTIYLTGPAARDAERTKDVVARLEHTTLRRLVNSTYIYYDPDPKNSVVEEDREWVSTYYELPDFDVNAISSWMLRIEFARKGMTGKKLSMEQISDKITRAFGNDLICHIPDDNLKLVMRIRIMNSDLEKDLKEADTTSDKMEDDTFLRFIEANLLSDITLQGIPQITKVYMHRPQTQDKKRVVIKDDGSFDAVAEWMLETDGTCLMRVLAERDVDPTRTVSNDIVEIFEALGIEAVRKAIECEMYHVISFDGSYVNYRHLALLCDIMTVKGHLMAITRHGLNRLDTGALARCSFEETVDILMDAATHAECDPMAGVSETIMLGQLAKIGTGCFDLLLDSAKCQEAQPIPLAGVVGMGLFNAPG 1490          
BLAST of DNA-directed RNA polymerase subunit vs. TrEMBL
Match: A0A075AJW9 (DNA-directed RNA polymerase subunit OS=Opisthorchis viverrini OX=6198 GN=T265_00004 PE=3 SV=1)

HSP 1 Score: 1954.87 bits (5063), Expect = 0.000e+0
Identity = 956/1488 (64.25%), Postives = 1167/1488 (78.43%), Query Frame = 1
Query:  253 MAIATVTLREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESE-ECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXX-----XXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGG 4692
            MA     LR++K +QFGILS  E++ +SV++  GI Y E  + GKPK  GLMDPRQG +D+ S+CQTCSGNVS CPGHFGH+ LA+PV++IG+ +K +K+LR VCF CSK+LV++  P+I+EI++KT+   R+R   ++EECK    C    D++  E +   N   R GC   QP+FRR GL+ + E K  + +  + K  L A +V+EVFKRIS+EDC+ +GF+ +Y+RP+ MI+TVL VPP+AVRPA+VM  + +  DDLTHKL +I+K NN++R+ E+NG AS I+ E    LQ+HV T+ DN+   LP AIQKSGRPLKS+K RLKGK GR+R NLMGKR D++ARTVITADPNLNLDQVGVPR IAQNLT+PE VT FN   LQ+LV+NGT+YPGAKF++RENGDRIDL+  P  +D+ L  G +VERHMLNDD+V+FNRQPTLHKMSMM HRVKVLP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI+ LARV++LVITPQ+N+PVMSIVQD+LTA NKMT RD FLN AEMM+LLM+LP+WNG MPKP I KPQRLWTGKQLF+LIIPG+VNC RTHSTHPE ED GPY+WIS  DT+V++++G LI GILCKKTLGS SGSL+HI+ALE   + +  FFNNIQTVVNNWLL EGHTIGI DTLY+ ATR +I   I KAKD VF+ I + H+ +L  TPG +L QTFE  VN ILN+ARDKTGS AQ+SLSKYN+FN+MVV+G+KGS+INISQVIACVGQQNVEGKRIPFGF+ RTLPHFI+ D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+KAMESVMVKYD TVRNQI+QLIQLRYGEDGLD   VEFQ LPT+K ++  FE  FRFDI +   L R + E  V+ +  ++    ++DAEW QL  DRE LR  +++ T   + LPCN+ RL+ NA+  F+ID L KT++ P  +V  VR  C  L+VVPG+DR+S  AN N+TLL+  LIRS LC KKVI + RLS EAL+W++GEIR  F ++Q+HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKEIINVS+ PKTPS+TI L G AA+D E  K + A LEHTTLR+L  S+ IYYDPDP+NSVVE DR+WV TYYE PDFDV+  S ++LRI   RK +T KKLS++ I++KIT  F ND+ICH+PD+NL LV+RIR++         E +   D+MED  +L  I+  +L +I LQGIPQI+KVY+ +P T DKKR++I   G F+ V EW+LETDGTCL +VLAER VD   T SN I EIFE  GIEA R AIE EM +VISFDGSYVNYRHLALLC+IMT KG LM+I RHG+NR +TGALAR SFEETVDILM+A  HAECDPM GVSE+IMLGQLA++GTGCFD+L++ A+  EAQ +P+   V   LF   G
Sbjct:    4 MAGGGPPLRDVKALQFGILSPDEIKEMSVTNDGGIKYAETMEGGKPKIGGLMDPRQGCVDRGSICQTCSGNVSNCPGHFGHVELAKPVFHIGFMKKTLKLLRCVCFHCSKILVDVQSPQIQEILRKTKNDNRRRMMFMYEECKSRTECLSNEDQNGGESDTLENKTKRAGCGRYQPRFRRIGLELTAEWKKINEESQERKITLTAERVLEVFKRISDEDCLSLGFDPRYARPDWMIVTVLPVPPLAVRPAVVMYGATRNQDDLTHKLADIIKANNQLRRDEQNGAASHILAEDIRMLQFHVTTMTDNDVPGLPKAIQKSGRPLKSIKTRLKGKAGRIRGNLMGKRVDFSARTVITADPNLNLDQVGVPRTIAQNLTYPENVTQFNIDHLQKLVQNGTLYPGAKFIVRENGDRIDLRYHPKVADLTLQVGYVVERHMLNDDYVIFNRQPTLHKMSMMCHRVKVLPWSTFRLNLSVTSPYNADFDGDEMNLHLPQSVETKAEISQLARVSRLVITPQANKPVMSIVQDTLTAVNKMTQRDVFLNRAEMMNLLMYLPTWNGRMPKPAIYKPQRLWTGKQLFTLIIPGRVNCIRTHSTHPEDEDGGPYRWISPGDTKVIVDDGDLIAGILCKKTLGSGSGSLIHIVALEHHHEQVSMFFNNIQTVVNNWLLIEGHTIGIADTLYDQATRRQIGETITKAKDAVFEIIDQAHNYDLQPTPGNTLRQTFENSVNKILNDARDKTGSCAQRSLSKYNNFNIMVVAGSKGSRINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIQDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVKYDGTVRNQINQLIQLRYGEDGLDATHVEFQRLPTFKPSHAAFEHGFRFDIGNERALRRCMPEDVVRSLATDSQTQAELDAEWMQLCTDRETLRSIIRK-TDDTVVLPCNINRLVMNAQKIFEIDPLSKTNVHPRQVVEMVRETCKRLVVVPGDDRLSREANANATLLMGALIRSSLCAKKVINEYRLSYEALDWVLGEIRARFQQAQIHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKKPKTPSMTIYLTGPAARDAERTKDVVARLEHTTLRRLVNSTYIYYDPDPKNSVVEEDREWVSTYYELPDFDVNAISSWMLRIEFARKGMTGKKLSMEQISDKITRAFGNDLICHIPDDNLKLVMRIRIMNSDLEKDLKEADTTSDKMEDDTFLRFIEANLLSDITLQGIPQITKVYMHRPQTQDKKRVVIKDDGSFDAVAEWMLETDGTCLMRVLAERDVDPTRTVSNDIVEIFEALGIEAVRKAIECEMYHVISFDGSYVNYRHLALLCDIMTVKGHLMAITRHGLNRLDTGALARCSFEETVDILMDAATHAECDPMAGVSETIMLGQLAKIGTGCFDLLLDSAKCQEAQPIPLAGVVGMGLFNAPG 1490          
BLAST of DNA-directed RNA polymerase subunit vs. TrEMBL
Match: A0A095APJ2 (DNA-directed RNA polymerase subunit OS=Schistosoma haematobium OX=6185 GN=MS3_04490 PE=3 SV=1)

HSP 1 Score: 1953.72 bits (5060), Expect = 0.000e+0
Identity = 957/1483 (64.53%), Postives = 1165/1483 (78.56%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLN---TIIRQGCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXX-----XXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGG 4692
            LRE++ +QFGILS  E++ LSV+   GI Y E  + GKPK  GLMDPRQG +D+ S+CQTCSG+VS CPGHFGH+ LA+PV++IG+ +K +K+LR VCF CSK+LV++   +I+EI++KT+G  R+R   ++EECK    C +  D+  + E  ++    + R GC   QP+FRRNGL+ + E K  + +  + K  L A +V+EVFKR+S+EDC+ +GF+ +Y+RP+ MI TVL VPP+ VRPA+VM  + +  DDLTHKL +I+K NN++R+ E+NG A+ II E    LQ+HV T++DNE   LP AIQKSGRPLKS+KQRLKGK GR+R NLMGKR D++ARTVITADPNLNLDQVGVPR IAQNLT+PE VT FN   LQ+LV+NGT+YPGAKF++RENGDRIDL+  P  SD+ L  G IVERHMLNDDFV+FNRQPTLHKMSMM HRVKVLP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI+ LARV++LVITPQ+N+PVM IVQD+LTA NKMT RD FLN +EMM+LLM+LP+WNG MPKP I KPQRLWTGKQLFSL+IPG+VNC RTHSTHPE ED GPYKWIS  DT+V++++G LI GILCKKTLGS +GSL+HI+ALE   D +  FFNNIQTVVNNWLL EGHTIGI DTLY+ ATR +I   I KAKD VF+ I + H+ +L  TPG +L QTFE  VN ILN+ARDKTGS AQ+SLSKYN+FN+MVV+G+KGS+INISQVIACVGQQNVEGKRIPFGF+ RTLPHFI+ D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+KAMESVM+KYD TVRNQI+QLIQLRYGEDGLD   VEFQ LPT+K +N  FE  FRFDI +   L R + E  V+ +  ++   +++++EW QL  DRE LR  +K+ T   + LPCN+ RL+ NA+  F+ID L KT+I P  +V  VR  C  LIVVPG+DR+S  AN N+TLLL  LIR+ LC KKVI D RLS EAL+W++GE+R  F ++ +HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKEIINVS+ PKTPS+TI L G AA+D E  K + A LEHTTLRKL  S+ IYYDPDP+N+VVE DR+WV TYYE PDFDV   S ++LRI   RK +T KKLS++ IA+KIT  F ND+ICH+PD+NL LV+RIR++  D      + +   D+MED  +L  I+  +L +I LQGIPQI+KVY+  P T DKKR++I   G F+ V EW+LETDGTCL +VLAER VD   T SN I EIFE  GIEA R AIE EM +VISFDGSYVNYRHLALLC+IMT KG LM+I RHG+NR +TGALAR SFEETVDILMEA  H+ECDPM GVSE+IMLGQLAR+GTGCFD+L++ A+  EAQ +P+   +   LF   G
Sbjct:   11 LREVRALQFGILSPDEIKELSVTADGGIKYAETMEGGKPKLGGLMDPRQGCVDRSSICQTCSGSVSSCPGHFGHVELAKPVFHIGFLKKTMKVLRCVCFYCSKILVDVQSSRIQEILRKTKGDNRRRMSFMYEECKTRSEC-ISNDDQVQSENDVSLSSKVKRSGCGRYQPRFRRNGLELTAEWKKVNEESQERKINLTAERVLEVFKRMSDEDCLSLGFDPRYARPDWMIATVLPVPPLCVRPAVVMYGATRNQDDLTHKLADIIKANNQLRRDEQNGAAAHIIAEDIKMLQFHVTTMVDNEVPGLPKAIQKSGRPLKSIKQRLKGKAGRIRGNLMGKRVDFSARTVITADPNLNLDQVGVPRTIAQNLTYPEVVTQFNIDHLQKLVQNGTLYPGAKFIVRENGDRIDLRYHPKVSDLTLQVGYIVERHMLNDDFVIFNRQPTLHKMSMMCHRVKVLPWSTFRLNLSVTSPYNADFDGDEMNLHLPQSVETKAEISQLARVSRLVITPQANKPVMGIVQDTLTAVNKMTQRDVFLNRSEMMNLLMYLPTWNGRMPKPAIYKPQRLWTGKQLFSLVIPGRVNCIRTHSTHPEEEDIGPYKWISPGDTKVIVDDGDLISGILCKKTLGSGAGSLIHIVALEHHHDQVNMFFNNIQTVVNNWLLIEGHTIGIADTLYDQATRRQISGTITKAKDAVFEIIDQAHNYDLQPTPGNTLRQTFENSVNKILNDARDKTGSCAQRSLSKYNNFNIMVVAGSKGSRINISQVIACVGQQNVEGKRIPFGFRHRTLPHFIQDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDGTVRNQINQLIQLRYGEDGLDATHVEFQRLPTFKPSNAVFEHGFRFDIGNERVLRRCMPEDVVRSLATDSQTQSELESEWLQLCSDREILRSVIKK-TDDSVVLPCNINRLVMNAQKIFEIDPLSKTNIHPRQVVEMVRETCKRLIVVPGDDRLSKEANANATLLLSSLIRASLCAKKVIIDYRLSYEALDWVLGEVRARFQQAHIHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKRPKTPSMTIFLTGQAARDAERTKDVVARLEHTTLRKLVNSTYIYYDPDPQNTVVEEDREWVSTYYELPDFDVSAISSWMLRIEFTRKGMTGKKLSMEQIADKITRAFGNDLICHIPDDNLKLVMRIRIMNSDLEKDFKDADTTSDKMEDDTFLRFIEANLLTDITLQGIPQITKVYMHLPKTQDKKRVVIKDDGSFDTVAEWMLETDGTCLMRVLAERDVDPVRTVSNDIVEIFEALGIEAVRKAIECEMHHVISFDGSYVNYRHLALLCDIMTVKGHLMAITRHGLNRLDTGALARCSFEETVDILMEAAIHSECDPMAGVSETIMLGQLARIGTGCFDLLLDSAKCQEAQPIPLGGVLGMGLFNAPG 1491          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Cavefish
Match: polr2a (RNA polymerase II subunit A [Source:NCBI gene;Acc:103029187])

HSP 1 Score: 1762.27 bits (4563), Expect = 0.000e+0
Identity = 902/1565 (57.64%), Postives = 1151/1565 (73.55%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTC-------NVICDESEECEKGLNTIIRQG-CNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXXX----YXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMS------PSPGLGFSPMMSPKTPHDYFYGLNSPG 4902
            LR IK VQFGI+S  EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  KI+K+LR VCF CSKLLV+ ++PKI++I+ K++G  RKR   +++ CK    C       N    E  E ++ L      G C   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRIS+E+ +I+G + KY+RPE MI+TVL VPP+AVRPA+VM  S +  DDLTHKL +IVK+NN++R+ E++G A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKS+KQRLKGK GRVR NLMGKR D++ARTVIT DPNL +DQVGVPR+IA N+TFPE VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G +P+P I KP+ LWTGKQ+FSLIIPG +N  RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTVVNNWLL EGH+IGI D++ +A T  +I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVV+G+KGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MES+MVKYDATVRN I+Q++QLRYGEDGL G  VEFQ + T K +N  FE+ F+F+  +   L R L E  ++++   A + + ++ E+E+++ DRE LR     +   ++ LPCN+ R+IWNA+  F+I+    TD+ P  +V  V+ L  +L++V G+D +S  A +N+TLL    +RS LC +++  + RLS EA EW++GEI   F +S  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG AA+D E AK I   LEHTTLRK+  ++ IYYDP+P+N+VV  D++WV  YYE PDFDV + S ++LRI L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  D+ K +E +E+ D+     +L  I++ +L ++ LQGI QISKVY+  P TD+KK++II   G+F+ ++EWILETDG  L +VL+E+ VD   TTSN I EIF   GIEA R A+E E+ +VISFDGSYVNYRHLALLC+ MT +G LM+I RHGINRQ+TG L + SFEETVD+LMEA +H ECDPMKGVSE+IMLGQLA  GTGCFD+L     LD  +C   M  +  N+  +  A               + + +   S G+  A+SP+  S           PSPG   SP  SP +P    Y   SPG
Sbjct:   13 LRLIKRVQFGIISPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERSGRCQTCAGNMTECPGHFGHIELAKPVFHVGFVTKIMKVLRCVCFFCSKLLVDANNPKIKDILSKSKGQPRKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPENDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEEDLILGMDPKYARPEWMIVTVLPVPPLAVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQSGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSIKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLQIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAIHKPRPLWTGKQIFSLIIPGHINVIRTHSTHPDDEDSGPYKHISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVVNNWLLIEGHSIGIGDSIADAKTYLDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVAGSKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESIMVKYDATVRNSINQVVQLRYGEDGLAGEAVEFQNMATLKPSNKAFEKKFKFEYTNERALRRTLQEDVLKDVMTNAHVQSSLEREFEKMREDREILRAIFP-TGDSKVVLPCNLARMIWNAQKIFRINPRTPTDLNPLRVVEGVQELSKKLVIVNGDDPLSKQAQQNATLLFNIHLRSTLCSRRMTEEFRLSTEAFEWLLGEIEAKFNQSIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKRPKTPSLTVFLLGQAARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVAEDQEWVNVYYEMPDFDVTRISPWLLRIELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKFQEDEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGINRQDTGPLMKCSFEETVDVLMEASSHGECDPMKGVSENIMLGQLAPAGTGCFDLL-----LDAEKCKYGME-IPTNIPGISVAGRSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPASPYIPSPGGAMSPNYSPTSPA---YEPRSPG 1566          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Cavefish
Match: polr2a (RNA polymerase II subunit A [Source:NCBI gene;Acc:103029187])

HSP 1 Score: 1760.35 bits (4558), Expect = 0.000e+0
Identity = 897/1555 (57.68%), Postives = 1155/1555 (74.28%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTC-------NVICDESEECEKGLNTIIRQG-CNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXXX----YXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPM-MSGVA----QNLFMVGGATPMNXXXXXXX---XXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGL--GFSPMMSP 4860
            LR IK VQFGI+S  EL+ +SV++  GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  KI+K+LR VCF CSKLLV+ ++PKI++I+ K++G  RKR   +++ CK    C       N    E  E ++ L      G C   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRIS+E+ +I+G + KY+RPE MI+TVL VPP+AVRPA+VM  S +  DDLTHKL +IVK+NN++R+ E++G A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKS+KQRLKGK GRVR NLMGKR D++ARTVIT DPNL +DQVGVPR+IA N+TFPE VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G +P+P I KP+ LWTGKQ+FSLIIPG +N  RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTVVNNWLL EGH+IGI D++ +A T  +I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVV+G+KGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MES+MVKYDATVRN I+Q++QLRYGEDGL G  VEFQ + T K +N  FE+ F+F+  +   L R L E  ++++   A + + ++ E+E+++ DRE LR     +   ++ LPCN+ R+IWNA+  F+I+    TD+ P  +V  V+ L  +L++V G+D +S  A +N+TLL    +RS LC +++  + RLS EA EW++GEI   F +S  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG AA+D E AK I   LEHTTLRK+  ++ IYYDP+P+N+VV  D++WV  YYE PDFDV + S ++LRI L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  D+ K +E +E+ D+     +L  I++ +L ++ LQGI QISKVY+  P TD+KK++II   G+F+ ++EWILETDG  L +VL+E+ VD   TTSN I EIF   GIEA R A+E E+ +VISFDGSYVNYRHLALLC+ MT +G LM+I RHGINRQ+TG L + SFEETVD+LMEA +H ECDPMKGVSE+IMLGQLA  GTGCFD+L++  +      +P  + G++      +F     +PM+  SP ++     +     + + S G G+    +GFS +  S + G   G+SP  SP
Sbjct:   13 LRLIKRVQFGIISPDELKRMSVTEG-GIKYPETTEGGRPKLGGLMDPRQGVIERSGRCQTCAGNMTECPGHFGHIELAKPVFHVGFVTKIMKVLRCVCFFCSKLLVDANNPKIKDILSKSKGQPRKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPENDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEEDLILGMDPKYARPEWMIVTVLPVPPLAVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQSGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSIKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLQIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKVPQPAIHKPRPLWTGKQIFSLIIPGHINVIRTHSTHPDDEDSGPYKHISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVVNNWLLIEGHSIGIGDSIADAKTYLDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVAGSKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESIMVKYDATVRNSINQVVQLRYGEDGLAGEAVEFQNMATLKPSNKAFEKKFKFEYTNERALRRTLQEDVLKDVMTNAHVQSSLEREFEKMREDREILRAIFP-TGDSKVVLPCNLARMIWNAQKIFRINPRTPTDLNPLRVVEGVQELSKKLVIVNGDDPLSKQAQQNATLLFNIHLRSTLCSRRMTEEFRLSTEAFEWLLGEIEAKFNQSIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKRPKTPSLTVFLLGQAARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVAEDQEWVNVYYEMPDFDVTRISPWLLRIELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKFQEDEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGINRQDTGPLMKCSFEETVDVLMEASSHGECDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGISVAGPTGMFFGSAPSPMSGMSPAMTPWNTGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSP 1565          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Cavefish
Match: polr3a (polymerase (RNA) III (DNA directed) polypeptide A [Source:ZFIN;Acc:ZDB-GENE-050208-103])

HSP 1 Score: 485.337 bits (1248), Expect = 2.872e-144
Identity = 298/879 (33.90%), Postives = 491/879 (55.86%), Query Frame = 1
Query:  388 PKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHD-PKIREIMKKTEGSYRKRFDL---IHEECKK-------------VKTCN---VICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETK---DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGT-MYPGAKFVIRENGDRIDLKR-----RPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFL-----PSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESED-SGPYKWISHADTRVLIENGQLIMGILCKKTLGSSS-GSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAA---TREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVE 2907
            P   G++D R G  +K   C+TC  N+++C GH+G+++L  P ++IGY +  I IL+ +C  CS+++++  +  +  + +++   +Y ++  L   I ++C+K             VK C    +I ++ +  +K ++ I+    +F+Q        D ++E     +S   + ++ L    V+ +F+RI NED  ++  N +  +P  +ILT L VPP+ +RP++         DDLT KLTEI+ +N+ I++   +G  + +I+E  + LQ   A  +++E + +P+ +    +  +   QRLKGK GR R NL GKR D++ RTVI+ DPNL +D+V VP  +A+ LT+PE+V   N + +++LV+NG  ++PGA F+ + +   + +KR       +    +L  G++VERHM++ D V+FNRQP+LHK+S+M H V   P+                         +  + +AT   ANL       +TP++  P+++ +QD LT    +T++DTF + A+   ++  +           +P+P I KP RLWTGKQ+FSLI+    +C    +   + +   G  + +   D+ V+I+N +L+ G L K TLGS S  ++ +I+  +    +  N  + +  +   +L   G +IGI D          ++E+     K  D+  + +  G   +L   PG +  +T E  +   L+  RD  GS+  + L K NS  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV +S+ +GLTPTEFFFH M GREG++DTAVKTAETGY+QRRL+K++E +  +YD TVR+    +IQ  YG DGLD   +E
Sbjct:   50 PLSYGVLDHRMGTSEKDRPCETCGKNLADCLGHYGYLDLELPCFHIGYFKATIGILQMICKTCSRIMLSKEERQQFLDYLRRPGLAYLQKRGLKKKISDKCRKKNVCLYCSAFNGPVKKCGLLKIIHEKYKTTKKVVDPIVS---DFLQ------SFDIAIEHNKEVESLLSRAQENLNPLVVLNLFRRIPNEDVPLLLMNPEAGKPADLILTRLLVPPLCIRPSV---------DDLTMKLTEIIFLNDVIKKHRMSGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTYPEKVNKANIELMRKLVKNGPDVHPGANFIQQRH---MQMKRFLKYGNREKMAQELKLGDVVERHMIDGDIVLFNRQPSLHKLSIMAHIVSSNPY-------------------------IQNNPKATK--ANL-------VTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIVASILVGKDEKIKVTLPRPAIIKPMRLWTGKQIFSLILKPSQSCPVKANLRTKGKQYCGKGEDLCSNDSFVVIQNSELLCGSLDKGTLGSGSKNNIFYILLRDWGQLEAANAMSRLARLAPVYLSNRGFSIGIGDVTPGQGLLKAKQELLDAGYKKCDEYIEALNTG---KLQQQPGCTAEETLEALILRELSVIRDHAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVADSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSTGDIIQFIYGGDGLDPAAME 869          

HSP 2 Score: 172.94 bits (437), Expect = 1.113e-42
Identity = 120/412 (29.13%), Postives = 207/412 (50.24%), Query Frame = 1
Query: 3376 NRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            +R++   LE  +   R+ + ++Q+ PG  VG+L A+S+GEP TQMTL TFHFAGV++ N+TLGVPR+KEIIN S+N  TP +T  L      D + A+ +   +E T L +++   +  + PD    +V+   + +R        +V+ +++    I + + ++    +++   A          ++C  P EN                           Y+       L ++ +QGIP++++  +     DD+              +++ L  +G  L  V+A   V+   TTSN+  E+ +T GIEAAR  I  E+   +   G  ++ RH+ LL ++M++KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    +GTG F +L
Sbjct:  960 DRITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIITAHL--DTEDDADFARLVKGRIEKTLLGEISEYIDEVFLPDDCFILVKLSLERIRLLR----LEVNAETVRY-SICMSKLRVKPGDIAVHGEA----------VVCVSPREN---------------------SKSSMYYVLQWLKQELPKVVVQGIPEVARAVIH---IDDQ-----------SGRQKFKLLVEGDNLRAVMATHGVNGSRTTSNNTYEVEKTLGIEAARTTIINEIQYTMVNHGMSIDRRHVMLLADLMSYKGEILGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLL 1319          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Cavefish
Match: ENSAMXT00000011874.2 (pep primary_assembly:Astyanax_mexicanus-2.0:24:12476100:12482137:1 gene:ENSAMXG00000011553.2 transcript:ENSAMXT00000011874.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.889 bits (481), Expect = 1.510e-50
Identity = 147/446 (32.96%), Postives = 212/446 (47.53%), Query Frame = 1
Query: 2410 FEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACV-GQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFE--RNFRFDIDDIDQLSRHLTEKRVQEIRN------------------EADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVR-NLCN-----------ELIVVPGNDRISITANRNSTLL-LCCLIRSYLCCK--KVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTIRLL 3636
            F+E+VN + N                 N+  LMV SGAKG + NI   I+C+ GQ  +EG+R P     ++LP F   +  P S GFV   +L G+ P EFFFH M GREG++DTAVKT+ +GY+QR ++K +E ++V+YD TVR+    ++Q  YGEDGLD    +F     +     N+E  R  +   + + +L     +   Q I+                       L  + AE E L +D             GR+AL   +           ++  LKKT   P   +   R ++C            E  +   N +    ++  S LL + C +R+ L  K  + +CD                         PGE VG LAA+S+GEP+TQMTLNTFHFAG    NVTLG+PRL+EI+ + S N KTP ++I +L
Sbjct:    6 FKEEVNQVNNNINKVCMPLGLHRSFPENNLQLMVQSGAKG-RSNI--CISCLLGQIELEGRRPPLMPSGKSLPCFQPYEAEPRSGGFVTGRFLTGIKPPEFFFHCMAGREGLVDTAVKTSRSGYLQRCVIKHLEGLVVQYDLTVRDSDGSVVQFLYGEDGLDIPKTQFLQPRQFPFIKENYEVIRKSKCLDEVLAKLDPKAAQSHFQAIKKWKAKHEHASPRTGAFLLFSQKKLGKMKAEAEGLSVDL----------NNGRVALTLQLMEKWKTLDDGSRVKYLKKTSHCPDPCLAVFRPDICFGSVSETFSSMIETYLSQFNIKHEFDSSSGSDLLCMHCSLRNLLQLKWQRALCD-------------------------PGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILLIASSNIKTPMMSIPIL 413          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Cavefish
Match: ENSAMXT00000011881.2 (pep primary_assembly:Astyanax_mexicanus-2.0:24:12464356:12466989:1 gene:ENSAMXG00000011559.2 transcript:ENSAMXT00000011881.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 5.501e-11
Identity = 29/65 (44.62%), Postives = 36/65 (55.38%), Query Frame = 1
Query:  382 GKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKC 576
            G    NGL D   GP D   +C TC  + + CPGHFGHI+L  PVYN    +K+  I+R  C  C
Sbjct:   43 GTAAPNGLYDLALGPADSKEICTTCMQDFTHCPGHFGHIDLHLPVYNPLLFDKLYLIIRGSCLSC 107          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Yeast
Match: RPO21 (RNA polymerase II largest subunit B220; part of central core; phosphorylation of C-terminal heptapeptide repeat domain regulates association with transcription and splicing factors; similar to bacterial beta-prime [Source:SGD;Acc:S000002299])

HSP 1 Score: 1297.34 bits (3356), Expect = 0.000e+0
Identity = 719/1582 (45.45%), Postives = 1003/1582 (63.40%), Query Frame = 1
Query:  244 LLNMAIATVTLREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDG--KPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLNTII-RQGCNFVQPKFRRNGLDY-SMETKDSDDGKGKQP----LYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQ-LSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDV----DKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDI-ICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSP---SGFSEA---GMSPSPGLGFSPMMSP-----KTPHDYFYGLNSPGMNP 4911
            ++    ++  LR +K VQFG+ S  E+R++S      I +PE   +   + K  GL DPR G +D+   CQTC   ++ECPGHFGHI+LA+PV+++G+  KI K+   VC  C KLL++ H+  +R+ +   +   +KRF  I   CK      ++C+     E     ++ R GC   QP  R++GL       KD   G   +P    L   +++ +FK IS +D   +GFN  +SRPE MILT L VPP  VRP+I  N S +  DDLT KL +I+K N  +   E NG     I E E+ LQ+HVAT MDN+    P A+QKSGRP+KS++ RLKGK GR+R NLMGKR D++ARTVI+ DPNL LDQVGVP++IA+ LT+PE VTP+N   L QLVRNG   +PGAK+VIR++GDRIDL+    + DIQL YG  VERH++++D V+FNRQP+LHKMSMM HRVKV+P+STFRLNLSVT PYNADFDGDEMNLH+PQS+E  AE++ L  V   +++PQSN+P M IVQD+L    K+T+RDTF+   +++++L ++P W+GV+P P I KP+ LW+GKQ+ S+ IP  ++  R         D G    +S  D  +LI +GQ+I G++ KKT+GSS+G L+H++  E+        F NIQ VVN WLL  G + GI DT+ +  T  EI   I +AK  V D   +  +N L +  G +L ++FE+ V   LNEARDK G  A+ +L   N+   MV++G+KGS INI+Q+ ACVGQQ+VEGKRI FGF  RTLPHF K D+ PES+GFVENSYL GLTP EFFFHAMGGREG+IDTAVKTAETGYIQRRL+KA+E +MV YD T RN +  +IQ  YGEDG+D   +E Q L T   ++  FE+ +R D+ + D  L   L E    EI  +  +   +D E++QL  DR+FLRE   +       LP N++R+I NA+ TF ID  K +D+   DIV  V++L   L+V+ G + I   A R++  L CCL+RS L  ++V+ + RL+ +A +W++  I   F +S VHPGEMVG LAA+S+GEPATQMTLNTFHFAGV++K VT GVPRLKEI+NV++N KTPSLT+ L    A D E AK I +++EHTTL+ + ++SEIYYDPDP ++V+  D + ++ ++   D +     D++S ++LR+ L R  + DK L++  + E+I + FKND+ +    D +  L++R R+++      E   E +    L+ I+N +L+ I L+G+  I +V + K       R + +  G++ K  EW+LETDG  L +V+    +D     +N   +I E  GIEA R A+  E+ NVI+ DGSYVNYRH+ALL ++MT +G L S+ RHG NR  TGAL R SFEETV+IL EAGA AE D  +GVSE+++LGQ+A +GTG FD++++   L   + +P            GG TP ++ S  ++      +          L FSP   SG ++A   G +   G  +    SP     + P    +G++SPG +P
Sbjct:    1 MVGQQYSSAPLRTVKEVQFGLFSPEEVRAIS---VAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDS--KKRFAAIWTLCK----TKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAIPNGIHLQRF--------DEG-TTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESG-SEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEA-NWPLPVNIRRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDH--MLKKIENTMLENITLRGVENIERVVMMK-----YDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVMIDEESL--VKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDE---------LMFSPLVDSGSNDAMAGGFTAYGGADYGEATSPFGAYGEAPTSPGFGVSSPGFSP 1544          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Yeast
Match: RPO31 (RNA polymerase III largest subunit C160; part of core enzyme; similar to bacterial beta-prime subunit and to RPA190 and RPO21 [Source:SGD;Acc:S000005642])

HSP 1 Score: 573.163 bits (1476), Expect = 2.057e-175
Identity = 334/914 (36.54%), Postives = 518/914 (56.67%), Query Frame = 1
Query:  376 QDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPK--IREIMKKTEGSYRKRFDL--IHEECKKVKTCNVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETKDSDDGKGKQPLYAH------------------QVVEVFKRISNEDCIIMGFNYKY--SRPESMILTVLAVPPMAVRPAIVMNHSGKAH-DDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNES---TFLPVAIQKSGR--PLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIREN---------GDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGV----MPKPTIAKPQRLWTGKQLFSLII------PGKVNCNRTHSTH-PESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSG-SLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNF 2961
            +D  PK NG +DP+ G       C TC GN++ C GHFGH+ LA PV++IGY +  I+IL+ +C  CS +L++  D +  + E+ +    + R+   L  I ++CKK + C      +   +K            +   FR  G   + E KD   G+ K+ L AH                  + + +FK+I + DC ++G +      RPE+ I   L  PP+ +RP+++M  S  ++ DDLT KLTEIV  ++ I+   + G++   ++E  + LQ  VA  ++++S     LP +    G+  P++   QRLKGK GR R NL GKR D++ RTVI+ DPNL++D+V VP  +A+ LT+PE+VT +N+  LQ+L+ NG  ++PGA ++++ N         GDR+ L +        L  G++VERH+ + D V+FNRQP+LH++S++ H  K+ P+ TFRLN  V  PYNADFDGDEMNLH+PQ++EA AE  NL  V   ++TP+S  P+++  QD +T    ++ +D+F + A +  LL  +   +G+    +P P I KP  LWTGKQ+FSL+I      P  +N +  +    P    S P + +S  D  V+I   Q++ G++ K  LG     S+ + I  +    +  N  N +  +   +L   G +IGI D       +++ +  +  A     + IT  +  EL + PG +  QT E K+  +L++ R++ G      L  +N+  +M   G+KGS +N+SQ++A VGQQ + G R+P GF+ R+LPHF K    P+S+GFV NS+ +GL+P EF FHA+ GREG++DTAVKTAETGY+ RRLMK++E +  +YD TVR   + ++Q  YG DGLD   +E    P      +NF R++
Sbjct:   44 KDRAPKANGALDPKMGVSSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDKRQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIHDTFRWVGKKSAPE-KDIWVGEWKEVL-AHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCELLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELIVNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAK-------NLQIGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMS--DGIEHFDIPPPAIMKPYYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNE-MSQNDGFVIIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPADDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSANGIVQFTYGGDGLDPLEMEGNAQP------VNFNRSW 939          

HSP 2 Score: 168.703 bits (426), Expect = 2.761e-42
Identity = 130/401 (32.42%), Postives = 199/401 (49.63%), Query Frame = 1
Query: 3430 FYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRM-------LXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            + K+++ PG  +G++ A+S+GEP TQMTL TFHFAGV++ NVTLGVPR+KEIIN S+   TP +   L+     D   A+ +   +E T L  +A                     +V+  Y+      D  S   +RI L        +L+++ IA  IT   K  I     D N+    RI +         K      +     D  Y        L ++ ++G+P IS+  ++    DD KR ++        VE + L  D  C   V+  R      TT+NH+ E+F   GIEAAR +I  E+   +S  G  V+ RH+ LL ++MT+KG ++ I R G+++     L  +SFE+T D L +A  + + D ++GVSE I+LGQ   +GTG F ++
Sbjct: 1078 YRKARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVAF--------------------YVQDVYK------DNLSFIQVRIDLGTIDKLQLELTIEDIAVAITRASKLKI--QASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRMQQLRRALPDVVVKGLPDISRAVIN--IRDDGKRELL--------VEGYGLR-DVMCTDGVIGSR------TTTNHVLEVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVV 1431          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Yeast
Match: RPA190 (RNA polymerase I largest subunit A190 [Source:SGD;Acc:S000005868])

HSP 1 Score: 340.887 bits (873), Expect = 2.492e-95
Identity = 236/747 (31.59%), Postives = 371/747 (49.67%), Query Frame = 1
Query:  874 VFKRISNEDCIIM-------GFNYKYSRPESMILTVLAVPPMAVR-PAIVMN--HSGKAHDDLTHKLTE---IVKVNNEIRQAEENGVA---STIILEKENSLQYHVATLMDNESTFLPVAIQKSGR-----PLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDL------KRR--------PDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFS-TFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPK-------------PTIAKPQRLWTGKQLFSLII-----PGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGR--SLLQTFEE-----------------KVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLD 2892
            VF++   E C++          + K  + +S  + VL VPP   R P+ +    H    +  L+  LT    I  +N+++ + +++ V+     +I  +   L     T+ ++ + F+  + +  GR     P+  +KQ L+ K G  R ++MGKR +Y AR+VI+ DPN+  +++GVP   A  LT+PE VT +N   L+Q V NG   +PGA  +  E+G  + L      +R+        P S+    +  + V RH+ N D V+ NRQPTLHK SMMGH+V+VLP   T RL+ + TG YNADFDGDEMN+H PQ++ A AE  NLA  +   +TP S  PV  ++QD ++A   +T +D+F    +    +     +  + P+             PTI KP  LWTGKQ+ + ++     P     N       ++E    Y      +  VL ++G L+ GIL K   G+S   ++H +      +      + +  +  N++     T G+ D L   A   + + +I K   D         +N    TP     LL+  +E                 KVN I ++   K            NS   M +SGAKGS +N+SQ++  +GQQ +EG+R+P     +TLP F   +    + G+V+  + +G+ P E++FH M GREG+IDTAVKT+ +GY+QR L K +E V V YD ++R+    L+Q  YG D +D
Sbjct:  327 VFRK---EQCVLQYVFHSRPNLSRKLVKADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQLLSKVLTTSLLIRDLNDDLSKLQKDKVSLEDRRVIFSR---LMNAFVTIQNDVNAFID-STKAQGRTSGKVPIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYI-----YGCIRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNE----YWGKGSLENEVLFKDGALLCGILDKSQYGASKYGIVHSLHEVYGPEVAAKVLSVLGRLFTNYITATAFTCGM-DDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPADDPELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYGGDAID 1056          

HSP 2 Score: 87.8113 bits (216), Expect = 1.301e-17
Identity = 52/174 (29.89%), Postives = 92/174 (52.87%), Query Frame = 1
Query: 4090 IPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            IP I +    +P  ++ KR+++    +F+ +  W  E             ++D +  TSN +  + +T+G+EAARN I  E+ NV S     V++RHL L+ ++MT +G  ++ +R G+    T +  + S+E T   L +A    E + +   S  I++G+L  +GTG FD+L
Sbjct: 1501 IPHIDRCVHPEP--ENGKRVLVTEGVNFQAM--WDQEA------------FIDVDGITSNDVAAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGM-ETSTSSFMKMSYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657          

HSP 3 Score: 85.1149 bits (209), Expect = 8.807e-17
Identity = 39/67 (58.21%), Postives = 53/67 (79.10%), Query Frame = 1
Query: 3430 FYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEII-NVSRNPKTPSLTI 3627
            + +S ++PGE VG +A++S+GEP+TQMTLNTFHFAG  A NVTLG+PRL+EI+   S   KTP +T+
Sbjct: 1174 YMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTL 1240          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Nematostella
Match: EDO39976 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7S8F9])

HSP 1 Score: 1675.99 bits (4339), Expect = 0.000e+0
Identity = 877/1596 (54.95%), Postives = 1135/1596 (71.12%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCN---------VICDESEECEKGLNTII-------RQGCNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGT-MYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXX---XXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLP---MMSGVAQNLFMVG---GA-----------TPMNXXXXXXXXXXXXXXXXXXXXTG----------FGLAFSPSGFSEAGMSPSPGLGFSPMMSPKTPHDYFYGLNSPGMNP 4911
            LR++K VQFGILS  E++ +SV+   G+ Y E  + G+PK NGLMDPRQG +D++S CQTC+GN++ECPGHFGHI LA+PV+++G+  KI+K LR VCF CSKLLV++++P+++EI+ K+ G  RKR   +++ CK    C          +  D   E EK L  I          GC   QPKFR+  L+ + E K  + D  + K  L A +V E+FKRIS+E+C  +G + K +RP+ MI+TVL VPP+ VRP+IV++ + ++ DDLTHKL +IVK NN +R+ E NG A+ II E    LQYHVATL DNE   LP A+QKSGRPLKS+KQRLK K GR+R NLMGKR D++AR VIT DPNL++DQVGVPR IAQNLTFPE VTPFN   +Q+LVR G   YPGAK++IR+NG+R+DL+  P  SD+ L +G  VERH+ ++D ++FNRQPTLHKMSMMGHRVK+LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E+ AEI  +  V + ++TPQSN+PVM IVQDSLTA  K T RD F+    MM+LLM++P+W+G +P+P I KP+ LWTGKQ+ S+IIPG VN  RTHSTHP+ EDSGPYK IS  DT+  I         LCKK+LG+SSGSL+HIIA+E   D    F++++Q VVNNWLL EGH+IGI D + ++ T +EI+    KAK +V + I K H++EL  TPG +L QTFE +VN ILN+ RDKTG SAQKSLS++N+F  MVV+G+KGSKINISQVIA VGQQNVEGKRIPFGF+ RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKT+ETGYIQRRL+KAME + V YD TVRN  +QLIQLRYGEDG+DG  +EFQ +PT + +   FER F FD  +   ++R+L E  V+++   A  L +++ E+ +L+ DRE LR+ ++ S   R+ALP N+ RLIWNA+ TF I     +D+ P  ++  VR L  +L++V G D IS  A  N+TLL   L+RS LC K+V  +  LS EA EW++GEI   F  S V PGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKEIINVS+ PKTPSLT+ L+G AA+D E+AK +   LEHTTLRK+  ++ IYYDPDP+N+V+  D+D+V  YYE PDFDV + S ++LRI L RK++TDKKL+++ I+EKI   F +D+ C   D+N + LVLRIR++       + +E+ D+M+D  +L  I+  +L ++ LQGI  ISKVY++ P  D KKR+++  +G+F+ ++EW+LETDG  L +VL+ER VD   TTSN I EIF   GIEA R A+E EM +VISFDGSYVNYRHLALLC+IMT +G LM+I RHGINRQE GAL RSSFEETVD+LM+A AHAE D ++GVSE I++G+L R+GTG FD++++  +      +P   M  G+   +  +G   GA           TP N  +      + S       + G               SP GFS + MSP+PG   SP   P +P+       SPG +P
Sbjct:   11 LRDVKRVQFGILSPDEIKQMSVTTDGGVKYSETMEGGRPKLNGLMDPRQGTIDRFSRCQTCAGNMTECPGHFGHIELAKPVFHVGFMTKIVKTLRCVCFYCSKLLVDLNNPRVKEILSKSHGQPRKRMMHMYDLCKGKNICEGGDEVDAGVLAQDNPNEAEKKLVRIYLPNAYCNHGGCGRYQPKFRKTALELTAEWKHVNEDANEKKITLTAERVYEIFKRISDEECNALGMDPKNARPDWMIVTVLPVPPLPVRPSIVLSGTARSQDDLTHKLADIVKANNNLRRNELNGAAAHIIAEDTRLLQYHVATLTDNEIPGLPRAMQKSGRPLKSVKQRLKSKEGRIRGNLMGKRVDFSARAVITPDPNLSIDQVGVPRTIAQNLTFPEIVTPFNIDSMQELVRRGNNQYPGAKYIIRDNGERVDLRFHPKPSDLHLQFGYKVERHIRDNDVIIFNRQPTLHKMSMMGHRVKILPWSTFRLNLSVTTPYNADFDGDEMNLHVPQSLESKAEITEIMMVPRNIVTPQSNKPVMGIVQDSLTAVRKFTKRDVFIEKDAMMNLLMWIPTWDGKIPQPAILKPRPLWTGKQICSMIIPGNVNVIRTHSTHPDDEDSGPYKHISPGDTKARI---------LCKKSLGTSSGSLIHIIAMELGHDIARMFYSDVQCVVNNWLLLEGHSIGIGDCIADSDTYDEIQRATKKAKKEVIEVIEKAHNDELEPTPGNTLRQTFENQVNRILNDCRDKTGGSAQKSLSEFNNFKAMVVAGSKGSKINISQVIAVVGQQNVEGKRIPFGFRHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTSETGYIQRRLVKAMEGLSVAYDGTVRNSNNQLIQLRYGEDGMDGIAIEFQNMPTMRPSKTAFERKFHFDPTNDRWMTRYLQEDLVRDLSGSATALQELEGEFNKLQEDREILRK-IQPSGNARVALPVNLSRLIWNAQKTFHITNRSASDLHPLRVIEGVRELSKKLVIVAGEDHISKQAQFNATLLFNILLRSTLCTKRVAEEFHLSSEAFEWLLGEIETRFNHSHVKPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKKPKTPSLTVFLIGQAARDAEMAKAVLCRLEHTTLRKVTANTAIYYDPDPQNTVIAEDQDFVNVYYEMPDFDVARISPWLLRIELDRKRMTDKKLTMEQISEKINLGFGDDLNCIFNDDNAEKLVLRIRIMNNDDGKMQDDEDVDKMDDDVFLRCIEANMLTDMTLQGIESISKVYMNLPHEDKKKRIVVTEQGEFKAIQEWLLETDGVSLMRVLSERDVDPVRTTSNDICEIFSVLGIEAVRKAVEREMDHVISFDGSYVNYRHLALLCDIMTCRGHLMAITRHGINRQEVGALMRSSFEETVDVLMDAAAHAETDYLRGVSECIIMGKLPRIGTGSFDLMLDAEKCKHGMEIPTNIMGPGMGGAMAAIGVFFGAAGSPSAMSPQMTPWNMGATPAYMEAWSPGMGSGMTPGAASFSPSAASDASGMSPGGFSPSWMSPTPGSPVSP--GPTSPYIPSPAAASPGYSP 1594          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Nematostella
Match: EDO36291 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7SJ34])

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 473/1444 (32.76%), Postives = 733/1444 (50.76%), Query Frame = 1
Query:  388 PKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLV----------NIHDPKIREIMKKTEGSYRKRFDLIHEEC----------KKVKTCNVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETKDSDDG---KGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMN-HSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGT-MYPGAKFVIRENGDRIDLKRRPDSSDI--QLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSW--NGV---MPKPTIAKPQRLWTGKQLFSLII-PG-KVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSS-GSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNF-RFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            P   G++DP  G   K  MC+TC   +++C GH+G+I+L  PV+++G+    I IL+ VC  C ++L+           +  P I  + KK               C          +KV    ++ ++ +   K ++ II    +F      ++  D ++E          K ++ L   +V+++F++I  +D  ++ F+   S P  +I+  +  PP+ +RP+++    SG   DD+T KLTEIV +N+ IR+    G    +I+E  + LQ   A  +++E + +P+ +Q   +  +   QRLKGK GR R NL GKR D++ RTVI+ DPNL +DQV VP  +A+ LT+PERVT  N K ++QLV NG   +PGA F+ +   +     +  +   I  QL  G+ VERH+++ D V+FNRQP+LHK+S+M H   V P  TFR N  V  PYNADFDGDEMNLH+PQ++EA AE   L  V   ++TP++  P+++ +QD +T    +T +D FL+ + +  L   + +    GV   +P P I KP RLWTGKQ+FS+++ P  KV          +   SG    ++  D+ V+I N  L+ G L K  LGS S  S+ +++  +       +    +  +   +L   G +IGI D        +  +  ++       D I +    +L + PG S   T E  +   L+  RD  G +  + L K N+   M V G+KGS INISQ+IACVGQQ + GKRIP GF+ R+LPHF +    P ++GFV+NS+ +GLTPTEFFFHAMGGREG++DTAVKTAETGY+QRRL+K++E +  +YD TVR     ++Q RYG DGLD   +E +  P      L+F R F     + + +  R LT  R +E      I   I    E     ++F  ET                  + N                   +  K+  +  +  VVP     SIT+N+         I  Y+        NR +   L+  +   R  + ++++ PG  VG++ A+S+GEP TQMTL TFHFAGV++ N+TLGVPR+KEIIN SR   TP ++ +L     +D E+A+ +   +E T L ++    E  + PD    +++ D + +R        +VD  ++       ++ ++   ++ + S A          +IC  P E+    L                      Y+       L  + ++G   +++  +     D+++     S+G     E + L  +G  L  V++   V    TTSN+  E+    GIEAAR  I  E+   +   G  ++ RH+ LL E+M  KG ++ I RHG+ + +   L  +SFE T D L EA  H   DP+ GVSE I++G    +GTG F +L
Sbjct:   50 PVPYGVLDPHMGTCSKDRMCETCGKGLADCVGHYGYIDLELPVFHVGHFRSTIIILQCVCKNCCRVLLPPAEKKQFLDTLKKPNISSLAKKGMKKKIVEKCKKISHCPYCEDLNGFVRKVGLMKIVHEKYKTTRKIVDPIIS---DF------QSSFDVALENNKELSPLLPKAQEVLNPLRVLDIFQQIPEQDYPLLMFSPGMSHPHDLIMRRILAPPVCIRPSVISELASGSNEDDVTMKLTEIVFLNDVIRKHRSVGAKVQMIMEDWDFLQLQCALYINSEMSGIPLNMQPK-KGTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDQVAVPIHVAKVLTYPERVTQSNLKLMKQLVLNGADQHPGANFIQQRETNTKRFLKYGNRKLIAKQLKIGDTVERHLIDGDVVLFNRQPSLHKLSIMAHLATVRPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALTLMGVKNNLVTPRNGEPLIAAIQDFITGAYLLTYKDVFLDRSHIAQLCASILAGKDTGVDIELPPPAIHKPCRLWTGKQVFSVLLRPNPKVKVRMNLRARGKQYTSGEDLCVN--DSFVVIHNSDLMCGALDKAVLGSGSKNSVFYVLLRDFGQQVAADAMWRVARICPFFLSNRGFSIGIGDVTPGHGLLQAKEDLLSTGYSKCEDYINEFREGKLQTQPGCSAEDTLEAVILKELSVIRDHAGKACLRELHKSNTPLTMAVCGSKGSFINISQMIACVGQQAISGKRIPDGFEDRSLPHFKRHSKLPAAKGFVKNSFFSGLTPTEFFFHAMGGREGLVDTAVKTAETGYMQRRLVKSLEDLSTQYDITVRTSTGDIVQFRYGGDGLDPTDMEGKDKP------LDFSRVFSHIQCNHVMREERPLTSSRARE------IAKGIIESSEFEMCSKDFKTET---------------SDFVEN-------------------LAKKIEKIHAQYGVVPH----SITSNK---------IVDYV--------NRCTETQLKLFLSMCREKYLRARMEPGSAVGAICAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASRKISTPIISAQL--QDDRDQELARAVKGRIERTLLGEVTEYIEEVFLPDNCYLLIKLDTERIRLL----KLEVDADTIQAAICSSRKLRLNQSQVRVHSSA----------VICVYPTESAKSSLH---------------------YVMQQLRSDLPGVLIKGYKNVTRAIIH---IDEEQ-----SRGG---EEHYKLLVEGDDLQAVISTMGVKGNGTTSNNTIEVERVLGIEAARQTIMNEIIYTMKNHGMSIDVRHVMLLAELMAFKGEILGITRHGLAKMKESVLMLASFERTADHLFEAALHGRKDPIDGVSECIIMGMPMNIGTGMFKLL 1366          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Nematostella
Match: EDO39496 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7S9W9])

HSP 1 Score: 285.034 bits (728), Expect = 2.664e-78
Identity = 187/568 (32.92%), Postives = 289/568 (50.88%), Query Frame = 1
Query: 1354 IAQNLTFPERVTPFNKKFLQQLVRNGTM-YPGAKFVIRENGDRIDL------KRRPDSSDIQLSYGE---------IVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPF-STFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGV---MPKPTIAKPQRLWTGKQLFSLI----IP-----------GKVNCNRTHSTHPESE--DSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKG-------HSNELNSTPGRSLLQ---TFEEKVNMILNEARDKTGSSAQKS---LSKY-----NSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLD 2892
             A+ LT+P+ VT +N K L+Q V NG + +PGA  V  E+G +I L      +R+  +  +    G+          V RH+ N D ++ NRQPTLH+ S+M H+V+VLP   T RL+ +    YNADFDGDEMN H PQ++ A AE   +A  N   + P+   P+  ++QD + +   MT+R    N  +   L+    ++      +  P I KP + W+GKQ+ S I    IP            K++    ++  P  +  D    K    +++ V+I +G L+ G+L K   G++   L+H           G   + +  V  ++L F G T+G+ D L      +  +  I K +    D  T         H ++L +   R+      T  +++++ + +  D    S  K+   L  Y     N+  LMV SGAKGS +N  Q+   +GQ  +EG+R P     R+LP F+  D  P + GFV+  +L G+ P E+FFH M GREG++DTAVKT+ +GY+QR L+K +E + V YD TVR+    ++Q  YGEDGLD
Sbjct:    3 FAKKLTYPQPVTTWNVKELRQAVINGPLVHPGAILVESEDGKKIRLSETDVNQRQAIAKRLLTPSGDNKGSHVNCKKVYRHIQNGDVMLLNRQPTLHRPSIMAHKVRVLPSEKTIRLHYANCKAYNADFDGDEMNAHFPQNELARAEAYTIASTNFNYLVPKDGTPLSGLIQDHMVSGVLMTIRGRMFNKLDYQQLVYGALNFKNQPIELLMPCILKPTQFWSGKQVISTILLNLIPLGSKRLNLKGKAKISAKNWNTRKPRRQFLDLEVLKGDDMSESEVVIRDGHLLCGVLDKAHYGNTPYGLVHCCNELYGGVMSGELLSALARVFTSFLQFHGFTLGVKDILVTERADKIRRKLIAKGRVSGKDAATSAFGMPEDCHRSDLEARMQRAHHNSDGTDMKELDLCMKKKTDHYQDSINKACLPLGLYQRFPGNNLQLMVQSGAKGSAVNCMQISCLLGQIELEGRRPPIMLSGRSLPSFLPYDTSPRAGGFVDGRFLTGIRPQEYFFHCMAGREGLVDTAVKTSRSGYLQRCLIKHLEGLQVAYDLTVRDSDGSIVQFYYGEDGLD 570          

HSP 2 Score: 95.9005 bits (237), Expect = 1.359e-19
Identity = 54/119 (45.38%), Postives = 77/119 (64.71%), Query Frame = 1
Query: 3415 EIRNIFY----KSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEII-NVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENS 3756
            + R++ Y    +S V PGE VG LAA+S+GEP+TQMTLNTFHFAG    NVTLG+PR++EI+   S N KTP++ + LL A  K ++ AKK+   L    L ++  S +++    P+ S
Sbjct:  741 KFRSLMYLKTLRSLVDPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRMREILMTASANIKTPTMDMPLL-AGKKVIKRAKKLQQKLNRVMLSQVLRSIDVWESLSPKES 858          

HSP 3 Score: 58.9214 bits (141), Expect = 2.380e-8
Identity = 46/143 (32.17%), Postives = 77/143 (53.85%), Query Frame = 1
Query: 4192 ILETDGTCLPKVLAERY---VDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            +L+T+G  L   +A RY   ++ +   +N I  +  T+GIEAA  AI  E+ NV    G +V+ RHL L+ + MT++G + + +R GI         + SFE T   L  A    + + +K  S  +++G++   GTG F++L
Sbjct: 1099 VLKTEGVNLQ--VAFRYPNIINVDKLYTNDIHAVARTYGIEAAARAITKEVKNVFGGYGIHVDPRHLTLVSDYMTYEGKIKAFNRIGIE-SSASPFQKMSFETTTHFLRGAVLSGDMESLKSPSSRLVVGRVVGGGTGSFELL 1238          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Nematostella
Match: EDO27435 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7T993])

HSP 1 Score: 107.071 bits (266), Expect = 6.638e-24
Identity = 117/450 (26.00%), Postives = 198/450 (44.00%), Query Frame = 1
Query:  385 KPKKNGLMDPRQ-GPMDKYS--------------MCQTCSGNVSECP---GHFGHINLARPVYNIGYKEKII-KILRSVCFKCSKLLVNIHDPKI----REIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGL--NTIIRQGCNFVQPKFRRNGLD-YSMETKDSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLN 1656
            KP+++GL   R  GP+  Y               +C  C   V+E        GHINL  P+ +I Y   +  KI   +     KL + I+  +       I +  EG    + D + EE + +   + +  E++  +       I + G   +     R  LD  S + + + + +  +     +  E  KR++  +        + + PE MIL V+ V P  +RP + ++    A  DL      ++  NN +++  E      I+  ++  LQ  V +L DN      V  + S RPLKSL   LKGK GR R NL+GKR DY+AR+VI   P + L + G+P+ +A  L       PF    +++L+  G +    K V  ++  +I  K+ P   DI      +++ H      V+ NR PTLH++ +   + K++     +L+
Sbjct:   37 KPERDGLFCERIFGPVKDYECACGKYKRIRYKGIVCDRCGVEVTEKKVRRDRVGHINLVVPIAHIWYFRSLPNKIGYILGLPSKKLDMIIYYERYVVIQPGIAQGLEGETLNKLDFLTEE-EYLNILDTLPMENQYLDDNDPNKFIAKMGAECIMDLLSRIDLDSLSFQLRHAANTETSK----QRKTEALKRLNVVESFREANKNRENLPEWMILKVIPVIPPELRPLVPLDGGRFATSDLNDLYRRVIIRNNRLKRLMEIKAPEVILRNEKRMLQEAVDSLFDNTRKASAVKTE-SNRPLKSLSDSLKGKQGRFRQNLLGKRVDYSARSVIVVGPEMRLFECGLPKDMAAEL-----YKPF---VIRKLIERGIV----KTV--KSAKKIIDKKEPVVWDI---LENVIKGHP-----VLLNRAPTLHRLGIQAFQPKLIEGKAIQLH 458          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Nematostella
Match: EDO39497 (DNA-directed RNA polymerase [Source:UniProtKB/TrEMBL;Acc:A7S9X0])

HSP 1 Score: 58.5362 bits (140), Expect = 1.509e-10
Identity = 24/45 (53.33%), Postives = 27/45 (60.00%), Query Frame = 1
Query:  388 PKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYN 522
            P   GL DP  GP D+  +C TC  N   CPGHFGHI L  PVY+
Sbjct:   27 PNHGGLYDPVLGPTDRDDLCGTCGQNNFSCPGHFGHIELPLPVYH 71          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Medaka
Match: polr2a (RNA polymerase II subunit A [Source:NCBI gene;Acc:101160848])

HSP 1 Score: 1762.27 bits (4563), Expect = 0.000e+0
Identity = 906/1565 (57.89%), Postives = 1150/1565 (73.48%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTC-------NVICDESEECEKGLNTIIRQG-CNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXXX----YXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMS------PSPGLGFSPMMSPKTPHDYFYGLNSPG 4902
            LR IK VQFGI+S  EL+ +SV+   GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  KI+K+LR VCF CSKLLV+ ++PKI++I+ K++G  RKR   ++E CK    C       N    E ++ E+ +      G C   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRIS+E+ +I+G + K++RPE MI+TVL VPP+AVRPA+VM  S +  DDLTHKL +IVK+NN++R+ E++G A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKS+KQRLKGK GRVR NLMGKR D++ARTVIT DPNL +DQVGVPR+IA N+TFPE VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G MP+P I KP+ LWTGKQ+FSLIIPG +N  RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTVVNNWLL EGH+IGI D++ +A T  +I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVV+G+KGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MESVMVKYDATVRN I+Q++QLRYGEDGL G  VEFQ L + K +N  FE+ F+FD  +   L R L E  V+++   A + + ++ E++++K DRE LR     +   ++ LPCN+ R+IWNA+  F+I+    TD+ P  +V  V+ L  +LI+V G+D +S  A  N+TLL    +RS LC K++  + RLS EA +W++GEI   F +S  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG AA+D E AK I   LEHTTLRK+  ++ IYYDP+P+N+VV  D++WV  YYE PDFDV + S ++LRI L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  D+ K +E +E+ D+     +L  I++ +L ++ LQGI QISKVY+  P TD+KK++II   G+F+ ++EWILETDG  L +VL+E+ VD   TTSN I EIF   GIEA R A+E E+ +VISFDGSYVNYRHLALLC+ MT +G LM+I RHGINRQ+TG L + SFEETVD+LMEA +H ECDPMKGVSE+IMLGQLA  GTGCFD+L     LD  +C   M  +  N+  +  A               + + +   S G+  A+SP+  S           PSPG   SP  SP +P    Y   SPG
Sbjct:   13 LRTIKRVQFGIISPDELKRMSVTTE-GIKYPETTEGGRPKLCGLMDPRQGVIERSGRCQTCAGNMTECPGHFGHIELAKPVFHVGFISKIMKVLRCVCFFCSKLLVDSNNPKIKDILTKSKGQPRKRLTHVYELCKGKNICEGGEEMDNKFGVEQQDTEEDITKEKGHGGCGRYQPRIRRSGLELFAEWKHVNEDSQEKKILLSPERVHEIFKRISDEEDLILGMDPKFARPEWMIVTVLPVPPLAVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQSGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSIKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLQIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKMPQPAILKPRPLWTGKQIFSLIIPGHINVIRTHSTHPDDEDSGPYKHISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVVNNWLLIEGHSIGIGDSIADAKTYLDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVAGSKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGENVEFQNLASLKPSNKAFEKKFKFDCTNDRALRRVLQEDVVKDVMTNAHVQSVLEKEFDKMKEDREILRAIFP-TGDSKVVLPCNLARMIWNAQKIFRINPRTPTDLNPLRVVEGVQELSKKLIIVNGDDPLSRQAQENATLLFNIHLRSTLCSKRMTEEFRLSTEAFDWLLGEIETKFNQSIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKRPKTPSLTVFLLGQAARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVAEDQEWVNVYYEMPDFDVTRISPWLLRIELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKFQEDEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGINRQDTGPLMKCSFEETVDVLMEAASHGECDPMKGVSENIMLGQLAPAGTGCFDLL-----LDAEKCKYGME-IPTNIPGISVAGRSGMTPGAAGFSPSAASDASGFSPGYSPAWSPTPGSPGSPGPLSPYIPSPGGAMSPNYSPTSPA---YEPRSPG 1566          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Medaka
Match: polr2a (RNA polymerase II subunit A [Source:NCBI gene;Acc:101160848])

HSP 1 Score: 1759.96 bits (4557), Expect = 0.000e+0
Identity = 903/1555 (58.07%), Postives = 1152/1555 (74.08%), Query Frame = 1
Query:  274 LREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTC-------NVICDESEECEKGLNTIIRQG-CNFVQPKFRRNGLDYSMETK--DSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLD-LVLRIRMLXXXXXXXXXXXXXXXXX----YXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPM-MSG--VAQNLFMVGGATP-----MNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGL--GFSPMMSP 4860
            LR IK VQFGI+S  EL+ +SV+   GI YPE T+ G+PK  GLMDPRQG +++   CQTC+GN++ECPGHFGHI LA+PV+++G+  KI+K+LR VCF CSKLLV+ ++PKI++I+ K++G  RKR   ++E CK    C       N    E ++ E+ +      G C   QP+ RR+GL+   E K  + D  + K  L   +V E+FKRIS+E+ +I+G + K++RPE MI+TVL VPP+AVRPA+VM  S +  DDLTHKL +IVK+NN++R+ E++G A+ +I E    LQ+HVAT++DNE   LP A+QKSGRPLKS+KQRLKGK GRVR NLMGKR D++ARTVIT DPNL +DQVGVPR+IA N+TFPE VTPFN   LQ+LVR G + YPGAK++IR+NGDRIDL+  P  SD+ L  G  VERHM + D V+FNRQPTLHKMSMMGHRV++LP+STFRLNLSVT PYNADFDGDEMNLH+PQS E  AEI  LA V ++++TPQSNRPVM IVQD+LTA  K T RD FL   E+M+LLMFL +W+G MP+P I KP+ LWTGKQ+FSLIIPG +N  RTHSTHP+ EDSGPYK IS  DT+V++ENG+LIMGILCKK+LG+S+GSL+HI  LE   D    F++NIQTVVNNWLL EGH+IGI D++ +A T  +I+  I KAK DV + I K H+NEL  TPG +L QTFE +VN ILN+ARDKTGSSAQKSLS+YN+F  MVV+G+KGSKINISQVIA VGQQNVEGKRIPFGFK RTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+K+MESVMVKYDATVRN I+Q++QLRYGEDGL G  VEFQ L + K +N  FE+ F+FD  +   L R L E  V+++   A + + ++ E++++K DRE LR     +   ++ LPCN+ R+IWNA+  F+I+    TD+ P  +V  V+ L  +LI+V G+D +S  A  N+TLL    +RS LC K++  + RLS EA +W++GEI   F +S  HPGEMVG+LAA+SLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKE+IN+S+ PKTPSLT+ LLG AA+D E AK I   LEHTTLRK+  ++ IYYDP+P+N+VV  D++WV  YYE PDFDV + S ++LRI L RK +TD+KL+++ IAEKI   F +D+ C   D+N + LVLRIR++  D+ K +E +E+ D+     +L  I++ +L ++ LQGI QISKVY+  P TD+KK++II   G+F+ ++EWILETDG  L +VL+E+ VD   TTSN I EIF   GIEA R A+E E+ +VISFDGSYVNYRHLALLC+ MT +G LM+I RHGINRQ+TG L + SFEETVD+LMEA +H ECDPMKGVSE+IMLGQLA  GTGCFD+L++  +      +P  + G  VA    M  G+ P     M+ A    +  +     + + S G G+    +GFS +  S + G   G+SP  SP
Sbjct:   13 LRTIKRVQFGIISPDELKRMSVTTE-GIKYPETTEGGRPKLCGLMDPRQGVIERSGRCQTCAGNMTECPGHFGHIELAKPVFHVGFISKIMKVLRCVCFFCSKLLVDSNNPKIKDILTKSKGQPRKRLTHVYELCKGKNICEGGEEMDNKFGVEQQDTEEDITKEKGHGGCGRYQPRIRRSGLELFAEWKHVNEDSQEKKILLSPERVHEIFKRISDEEDLILGMDPKFARPEWMIVTVLPVPPLAVRPAVVMQGSARNQDDLTHKLADIVKINNQLRRNEQSGAAAHVIAEDVKLLQFHVATMVDNELPGLPRAMQKSGRPLKSIKQRLKGKEGRVRGNLMGKRVDFSARTVITPDPNLQIDQVGVPRSIAANMTFPEIVTPFNIDRLQELVRRGNSQYPGAKYIIRDNGDRIDLRFHPKPSDLHLQIGYKVERHMCDGDIVIFNRQPTLHKMSMMGHRVRILPWSTFRLNLSVTTPYNADFDGDEMNLHLPQSLETRAEIQELAMVPRMIVTPQSNRPVMGIVQDTLTAVRKFTKRDVFLERGEVMNLLMFLSTWDGKMPQPAILKPRPLWTGKQIFSLIIPGHINVIRTHSTHPDDEDSGPYKHISPGDTKVIVENGELIMGILCKKSLGTSAGSLVHISYLEMGHDITRLFYSNIQTVVNNWLLIEGHSIGIGDSIADAKTYLDIQNTIKKAKQDVIEVIEKAHNNELEPTPGNTLRQTFENQVNRILNDARDKTGSSAQKSLSEYNNFKSMVVAGSKGSKINISQVIAVVGQQNVEGKRIPFGFKHRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQLRYGEDGLAGENVEFQNLASLKPSNKAFEKKFKFDCTNDRALRRVLQEDVVKDVMTNAHVQSVLEKEFDKMKEDREILRAIFP-TGDSKVVLPCNLARMIWNAQKIFRINPRTPTDLNPLRVVEGVQELSKKLIIVNGDDPLSRQAQENATLLFNIHLRSTLCSKRMTEEFRLSTEAFDWLLGEIETKFNQSIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELINISKRPKTPSLTVFLLGQAARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQNTVVAEDQEWVNVYYEMPDFDVTRISPWLLRIELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDENKFQEDEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVYMHLPQTDNKKKIIITEDGEFKALQEWILETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTVLGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGINRQDTGPLMKCSFEETVDVLMEAASHGECDPMKGVSENIMLGQLAPAGTGCFDLLLDAEKCKYGMEIPTNIPGISVAGPTGMFFGSVPSPMSGMSPAMTPWNTGATPAYGAWSPSVGSGMTPGAAGFSPSAASDASGFSPGYSPAWSP 1565          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Medaka
Match: polr3a (RNA polymerase III subunit A [Source:NCBI gene;Acc:101157164])

HSP 1 Score: 559.296 bits (1440), Expect = 3.241e-170
Identity = 344/952 (36.13%), Postives = 539/952 (56.62%), Query Frame = 1
Query:  373 TQDGK--PKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDP-KIREIMKKTEGSYRKRFDL---IHEECKK---VKTCNVICDESEECEKGLNTIIRQGCN----FVQPKFRR--NGLDYSMETKDSDD---GKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMN-HSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVI-RENGDRIDLKRRPDSSDIQ-LSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNG-----VMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESED-SGPYKWISHADTRVLIENGQLIMGILCKKTLGSSS-GSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDT--------ITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFER---NFR--FDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLR 3102
            +QD K  P  +G++D R G  +K   C TC  N+++C GH+G+++L  P +++GY + +I IL+ +C  CS +++   +  +  +++K+   +Y ++  L   I E+C+K      C+      ++C  GL  II +        V P         D ++E     +    + ++ L    V+ +F+RI +ED  ++  N +  +P  +I+T L VPP+ +RP++V +  SG   DDLT KLTEI+ +N+ I++   +G  + +I+E  + LQ   A  +++E + +P+ +    +  +   QRLKGK GR R NL GKR D++ RTVI+ DPNL +D+V VP  +A+ LT+PE V   N + +++LVRNG  ++PGA F+  R N  +  LK        Q L +G+IVERHM++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V  PYNADFDGDEMNLH+PQ++EA AE   L      ++TP++  P+++ +QD LT    +T++DTF + ++   ++  +           +P P I KP  LWTGKQ+FS+I+    +C    +   + +   G  + + + D+ V+I N +L+ G + K TLGS S  ++ +I+  +    +  N  + +  +   +L   G +IGI D              + KAK D+ D         I    + +L   PG S  +T E  +   L+  RD+ GS+  + L K NS  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV +S+ +GLTPTEFFFH M GREG++DTAVKTAETGY+QRRL+K++E +  +YD TVR+ +  +IQ  YG DGLD   +E +  P      L F+R   N R  +   D   LS++        I   AD +   D+  E++K   +F+R
Sbjct:   43 SQDTKHTPLPHGVLDHRMGTSEKDRPCLTCGKNLADCLGHYGYLDLELPCFHVGYFKAVIGILQMICKTCSSIMLTKEEKLQFLDLLKRPNLAYLQKRGLKKKISEKCRKRTVCLNCSAFNGTVKKC--GLLKIIHEKYKTTKKVVDPFVSEFMQSFDTAIEHNKLIEPLLNRAQENLNPLVVLNLFRRIPDEDIPLLLMNPEAGKPADLIITRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRMSGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTYPEMVNKANLELMRKLVRNGPDVHPGANFIQNRRNQIKRFLKYGNREKIAQELRFGDIVERHMIDGDVVLFNRQPSLHKLSIMAHIARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALILMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRSKACQIVASILVGKDEKVRISLPHPAILKPMALWTGKQIFSMILRPSKDCPVKANLRTKGKQYCGKGEDLCYNDSFVVIHNSELMCGSMDKGTLGSGSKNNIFYILLRDWGQLEAANAMSRLARLAPVYLSNRGFSIGIGDVTPGHG--------LLKAKQDLLDDGYKKCDEYIEALQTGKLQQQPGCSAEETLEALILRELSVIRDRAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVADSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSMGDIIQFIYGGDGLDPAAMEGKDEP------LEFKRVLDNIRAVYTCPDEPALSQNKLVLTSDAIMKRADFMCCRDSFLEEIK---KFIR 974          

HSP 2 Score: 175.637 bits (444), Expect = 1.755e-43
Identity = 119/414 (28.74%), Postives = 212/414 (51.21%), Query Frame = 1
Query: 3376 NRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISK--VYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            +R++   LE  +   R+ + ++Q+ PG  VG+L A+S+GEP TQMTL TFHFAGV++ N+TLGVPR+KEIIN S+N  TP +T +L      D + A+ +   +E T L +++   E  + PD    +V+   + +R        +V+ +++    I + + ++    +++   A          ++C  P EN                           Y+       L ++ +QGIP++++  +++ + +  +K +L++                +G  +  V+A   V+   TTSN+  E+ +T GIEAAR+ I  E+   +   G  ++ RH+ LL ++M++KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    +GTG F +L
Sbjct: 1004 DRITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIITAQL--DVEDDADFARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLLR----LEVNAETVRY-SICMSKLRVKPGDIAVHGEA----------VVCVSPREN---------------------NKSSMYYVLQSLKEDLPKVVVQGIPEVARAVIHIDEQSGKNKYKLLV----------------EGDNMRAVMATHGVNGSRTTSNNTYEVEKTLGIEAARSTIINEIQYTMVNHGMSIDRRHVMLLADLMSYKGEILGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLL 1363          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Medaka
Match: polr3a (RNA polymerase III subunit A [Source:NCBI gene;Acc:101157164])

HSP 1 Score: 558.91 bits (1439), Expect = 6.280e-170
Identity = 342/944 (36.23%), Postives = 534/944 (56.57%), Query Frame = 1
Query:  373 TQDGK--PKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDP-KIREIMKKTEGSYRKRFDL---IHEECKK---VKTCNVICDESEECEKGLNTIIRQGCN----FVQPKFRR--NGLDYSMETKDSDD---GKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMN-HSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVI-RENGDRIDLKRRPDSSDIQ-LSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNG-----VMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESED-SGPYKWISHADTRVLIENGQLIMGILCKKTLGSSS-GSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDT--------ITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFER---NFR--FDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQL 3078
            +QD K  P  +G++D R G  +K   C TC  N+++C GH+G+++L  P +++GY + +I IL+ +C  CS +++   +  +  +++K+   +Y ++  L   I E+C+K      C+      ++C  GL  II +        V P         D ++E     +    + ++ L    V+ +F+RI +ED  ++  N +  +P  +I+T L VPP+ +RP++V +  SG   DDLT KLTEI+ +N+ I++   +G  + +I+E  + LQ   A  +++E + +P+ +    +  +   QRLKGK GR R NL GKR D++ RTVI+ DPNL +D+V VP  +A+ LT+PE V   N + +++LVRNG  ++PGA F+  R N  +  LK        Q L +G+IVERHM++ D V+FNRQP+LHK+S+M H  +V P  TFR N  V  PYNADFDGDEMNLH+PQ++EA AE   L      ++TP++  P+++ +QD LT    +T++DTF + ++   ++  +           +P P I KP  LWTGKQ+FS+I+    +C    +   + +   G  + + + D+ V+I N +L+ G + K TLGS S  ++ +I+  +    +  N  + +  +   +L   G +IGI D              + KAK D+ D         I    + +L   PG S  +T E  +   L+  RD+ GS+  + L K NS  +M + G+KGS INISQ+IACVGQQ + G R+P GF+ R+LPHF K    P ++GFV +S+ +GLTPTEFFFH M GREG++DTAVKTAETGY+QRRL+K++E +  +YD TVR+ +  +IQ  YG DGLD   +E +  P      L F+R   N R  +   D   LS++        I   AD +   D+  E+L
Sbjct:   43 SQDTKHTPLPHGVLDHRMGTSEKDRPCLTCGKNLADCLGHYGYLDLELPCFHVGYFKAVIGILQMICKTCSSIMLTKEEKLQFLDLLKRPNLAYLQKRGLKKKISEKCRKRTVCLNCSAFNGTVKKC--GLLKIIHEKYKTTKKVVDPFVSEFMQSFDTAIEHNKLIEPLLNRAQENLNPLVVLNLFRRIPDEDIPLLLMNPEAGKPADLIITRLLVPPLCIRPSVVSDLKSGTNEDDLTMKLTEIIFLNDVIKKHRMSGAKTQMIMEDWDFLQLQCALYINSELSGIPLNMAPK-KWTRGFVQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDEVAVPVHVAKILTYPEMVNKANLELMRKLVRNGPDVHPGANFIQNRRNQIKRFLKYGNREKIAQELRFGDIVERHMIDGDVVLFNRQPSLHKLSIMAHIARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALILMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRSKACQIVASILVGKDEKVRISLPHPAILKPMALWTGKQIFSMILRPSKDCPVKANLRTKGKQYCGKGEDLCYNDSFVVIHNSELMCGSMDKGTLGSGSKNNIFYILLRDWGQLEAANAMSRLARLAPVYLSNRGFSIGIGDVTPGHG--------LLKAKQDLLDDGYKKCDEYIEALQTGKLQQQPGCSAEETLEALILRELSVIRDRAGSACLRELDKSNSPLIMALCGSKGSFINISQMIACVGQQAISGSRVPDGFENRSLPHFEKHSKLPAAKGFVADSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYMQRRLVKSLEDLCSQYDLTVRSSMGDIIQFIYGGDGLDPAAMEGKDEP------LEFKRVLDNIRAVYTCPDEPALSQNKLVLTSDAIMKRADFMCCRDSFLEEL 969          

HSP 2 Score: 175.637 bits (444), Expect = 1.806e-43
Identity = 119/414 (28.74%), Postives = 212/414 (51.21%), Query Frame = 1
Query: 3376 NRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISK--VYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDIL 4611
            +R++   LE  +   R+ + ++Q+ PG  VG+L A+S+GEP TQMTL TFHFAGV++ N+TLGVPR+KEIIN S+N  TP +T +L      D + A+ +   +E T L +++   E  + PD    +V+   + +R        +V+ +++    I + + ++    +++   A          ++C  P EN                           Y+       L ++ +QGIP++++  +++ + +  +K +L++                +G  +  V+A   V+   TTSN+  E+ +T GIEAAR+ I  E+   +   G  ++ RH+ LL ++M++KG ++ I R G+ + +   L  +SFE+T D L +A    + D + GVSE I++G    +GTG F +L
Sbjct: 1016 DRITPTQLEKFLETCRDKYMRAQMEPGSAVGALCAQSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKNISTPIITAQL--DVEDDADFARLVKGRIEKTLLGEISEYIEEVFLPDDCFILVKLSLERIRLLR----LEVNAETVRY-SICMSKLRVKPGDIAVHGEA----------VVCVSPREN---------------------NKSSMYYVLQSLKEDLPKVVVQGIPEVARAVIHIDEQSGKNKYKLLV----------------EGDNMRAVMATHGVNGSRTTSNNTYEVEKTLGIEAARSTIINEIQYTMVNHGMSIDRRHVMLLADLMSYKGEILGITRFGLAKMKESVLMLASFEKTADHLFDAAYFGQKDSVCGVSECIIMGIPMNIGTGLFKLL 1375          
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Medaka
Match: polr1a (RNA polymerase I subunit A [Source:NCBI gene;Acc:101156830])

HSP 1 Score: 327.405 bits (838), Expect = 4.274e-90
Identity = 217/640 (33.91%), Postives = 327/640 (51.09%), Query Frame = 1
Query: 1132 LQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDLK----RRPDSSDIQL---SYG------EIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFS-TFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMF-LPSWNG---VMPKPTIAKPQRLWTGKQLFSL----IIPGK-VNCNRTHSTHPESED-------SGP-YKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWL-LFEGHTIGIVDTLYNAATREEIKFNINKAKD----------------DVFDTITKGHSNELNSTPGRSLLQT----FEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLD 2892
            LQ HV  + D++   L             ++Q L+ K G  R ++MGKR DY AR+VI  D  +  +++G+P   A  LT+P+ VTP+N K L+Q V NG  ++PGA  VI E+G +  L      + ++   QL   S G      +IV RH+ N D ++ NRQPTLH+ S+  H  ++LP     RL+ +    YNADFDGDEMN H PQS+   AE   L   N+  + P+  +P+  ++QD + +  +MT+R  F    +   L+   L    G   ++P P + KPQ LWTGKQ+ S     +IP K V  N    +   S+        + P Y+  S  D++V+I  G+L++G+L K   GSS+  L+H        +  G     +  +   +L L+ G T+G+ D L      +  +  I  +++                D  D  ++     LN  P +    T    F+E  N + N+           +    N+  LMV SGAKGS +N  Q+   +GQ  +EG+R P     + LP F   D  P + GFV   +L G+ P EFFFH M GREG++DTAVKT+ +GY+QR ++K +E ++V+YD TVR+    ++Q  YGEDGLD
Sbjct:  382 LQSHVNIVFDSDMDKLMT------EKYPGVRQILEKKEGLFRKHMMGKRVDYAARSVICPDMYIETNEIGIPMVFATKLTYPQPVTPWNVKELRQAVLNGPNVHPGASMVINEDGRKTILSPTNFTQREAVAKQLLTPSLGPHKMSMKIVNRHIKNGDVLLLNRQPTLHRPSIQAHCARILPGEKVLRLHYANCKAYNADFDGDEMNAHFPQSELGRAEAYTLVSTNQQYLVPKDGKPLAGLIQDHMVSGTRMTIRGCFFTRDQYTELVFRGLTDKRGRVKLLP-PAVLKPQHLWTGKQVVSTLLLNVIPEKAVPLNLIGRSKIPSKAWIKLPPRAAPGYQPESMCDSQVVIRQGELLVGVLDKAHYGSSAYGLVHCCYELYGGETSGKLLGCLARLFTAYLQLYRGFTLGVEDILVKPGANKRRRKIIESSRNVGSQALQAAFNLPPGVDPADARSRWQDAHLN--PDQRDFSTADHKFKEVANQVNNDINKVCMPVGLHTSFPDNNLQLMVQSGAKGSTVNTMQISCLLGQIELEGRRPPLMPSGKFLPCFQPYDPSPGAGGFVSGRFLTGIKPQEFFFHCMAGREGLVDTAVKTSRSGYLQRCIIKHLEGLVVQYDLTVRDSDGSVVQFLYGEDGLD 1012          

HSP 2 Score: 84.3445 bits (207), Expect = 1.185e-15
Identity = 42/67 (62.69%), Postives = 52/67 (77.61%), Query Frame = 1
Query: 3430 FYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTI 3627
            + +S   PGE VG LAA+S+GEP+TQMTLNTFHFAG    NVTLG+PRL+EI+ V S N KTP ++I
Sbjct: 1180 WQRSLCDPGEAVGLLAAQSIGEPSTQMTLNTFHFAGRGEMNVTLGIPRLREILMVASSNIKTPMMSI 1246          

HSP 3 Score: 67.0106 bits (162), Expect = 2.138e-10
Identity = 40/143 (27.97%), Postives = 75/143 (52.45%), Query Frame = 1
Query: 4183 EEWILETDGTCLPKVLAE-RYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDI 4608
            +E +L T+G  + ++      +D     SN +  +  T+GIE A   IE E+ +V +  G  V+ RHL+L+ + M  +G    ++RH I R  +  L + +FE +   L +A      D ++  S  +++G++ + GTG F++
Sbjct: 1541 KETVLNTEGINMHEMFKYGEILDLNRLYSNEVHAMANTYGIEVALKVIEKEIKDVFAVYGIEVDPRHLSLVADYMCFEGVYKPLNRHAI-RSNSSPLQQMTFETSYKFLKQATMLGSHDQLESPSACLVVGKVVKGGTGLFEL 1682          

HSP 4 Score: 63.929 bits (154), Expect = 2.007e-9
Identity = 28/68 (41.18%), Postives = 36/68 (52.94%), Query Frame = 1
Query:  382 GKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKL 585
            G    N L D   GP D   +C TC  + + CPGHFGHI L  PVYN  + +K+  ++R  C  C  L
Sbjct:   43 GNVAPNSLYDLALGPADLKEVCSTCCQDFNNCPGHFGHIELPLPVYNPLFFDKLYLLIRGSCLSCHML 110          
BLAST of DNA-directed RNA polymerase subunit vs. Planmine SMEST
Match: SMESG000078620.1 (SMESG000078620.1)

HSP 1 Score: 3028.81 bits (7851), Expect = 0.000e+0
Identity = 1503/1503 (100.00%), Postives = 1503/1503 (100.00%), Query Frame = 1
Query:  406 MDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETKDSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSPKTPHDYFYGLNSPGMNPL 4914
            MDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETKDSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLKKDDEKEEEPDEMEDRKYLELIDNLILDEICLQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNSASPQLSQYSPSYNYSPNSSTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSPKTPHDYFYGLNSPGMNPL
Sbjct:    1 MDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETKDSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLKKDDEKEEEPDEMEDRKYLELIDNLILDEICLQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNSASPQLSQYSPSYNYSPNSSTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSPKTPHDYFYGLNSPGMNPL 1503          

HSP 2 Score: 136.732 bits (343), Expect = 1.234e-31
Identity = 88/88 (100.00%), Postives = 88/88 (100.00%), Query Frame = 1
Query: 5374 RYSATXXXXXXXXXXXXXXXXXXRLAAASPCYSPKANSYSDLSYNPSSPSIGASNGTLNSPSMLSYSPSVNSKSIGYSPNLSSPANRV 5637
            RYSATYNPLSPNLSSTSPSYSPNRLAAASPCYSPKANSYSDLSYNPSSPSIGASNGTLNSPSMLSYSPSVNSKSIGYSPNLSSPANRV
Sbjct: 1657 RYSATYNPLSPNLSSTSPSYSPNRLAAASPCYSPKANSYSDLSYNPSSPSIGASNGTLNSPSMLSYSPSVNSKSIGYSPNLSSPANRV 1744          
BLAST of DNA-directed RNA polymerase subunit vs. Planmine SMEST
Match: SMESG000010459.1 (SMESG000010459.1)

HSP 1 Score: 2433.29 bits (6305), Expect = 0.000e+0
Identity = 1195/1560 (76.60%), Postives = 1353/1560 (86.73%), Query Frame = 1
Query:  244 LLNMAIATVTLREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETKDSDDGKG-KQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXX--XXXXXXXXXXXXXTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSPKTPHDYFYGLNSPGMNPL 4914
            + N+ + +V LRE+K VQFGILS  E++ LSV    GIIY EKTQDGKPKK+GLMDPRQGP DKYS CQTC G+V+ECPGHFGHINLARPV++IG+KEKIIKILRSVCFKCSKLL +++   ++EI+KKTE + RKRFD +++EC++ K C+V   + +E +     + R GC +VQP FRRNGL+Y +  KD       KQPL A+QV+E+F+RI+ EDC++MGFN KYSRPE MI+TVL+VPP+AVRPA+VMNH+GK+HDDLTHKLTE+VKVNNEIR AEENGVASTI+LEKENSLQYHVAT +DNES FLP AIQKSGRPLK+LKQRLKGKHGR+RSNLMGKRTDY+ARTVITADPNLNLDQVGVPR IAQNLTFPE+VTPFNK +LQQLV+NGTMYPGA FVIRENGDRIDLKRRPDSSDIQL YGE VERHMLNDDFVVFNRQPTLHKMSMM HRVKVLPFSTFRLNLSVT PYNADFDGDEMNLH+PQS E  AE+++LARV KL+ITPQSN+PVMSIVQD+LTACNKMT RD FLN AE+MHLLM+LP+WNG +PKP I KP RLWTGKQ+FSLIIPG+VNC RTHSTHPE E++GPYKWIS  DT+VLIE+G+LI GILCKKTLGSS+GSL+HIIALEQ  D+ G FFNN+QTVVNNWLL EGHTIGIVD LY+A TREEIK  I++AK+ VF+TI K H+ EL STPG +L QTFE  VN ILN+ARDKTGS AQKSLSKYN+FNLMV+SGAKGSKINISQVIACVGQQNVEGKRIPFGF+QRTLPHFIK D+GPESRGFVENSYLAGLTPTEFFFHAMGGREG+IDTAVKTAETGYIQRRL+KAMESVM+KYD+TVRNQIDQLIQ RYGEDGLDG FVEFQ LPT+K     FE+ FRFDI + D+LSR+LTEKRV+EI  EAD +  +D EW+QL  DRE +R+ +K  TGGR+ LPCN+ RL+ N +  FKID+LKKTDIKP DI+ KV NLC +LIVV G+D IS TAN N+TLL CCLIRS LCCKKVI + RLS EA +W++GEI+  F +S V PGEMVG+LAAESLGEPATQMTLNTFH+AGVSAKNVTLGVPRLKEIINVSRNPKTPSLT+ L G AAKD E+AK IAA LEHTTLRKLAV SEIYYDP+PE+SV+E DR+WVRTYYE PDFD+DKKS Y+LRIVL RKK+TDKKL+LQ+IAEKITEYF+NDIICH+PD+NL+LVLRIRMLKK+DEK++E  EMEDRKYLEL++NLILDEICLQGIPQISKVY+  P TDDKK+++INS G FE   EWILETDGTCL KVLAER VDSETT SNHITEIFETFGIEAARNAIE EM +VISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLA++GTGCFDILMN+ + +EAQ LPMMSGVA NL+MVGGATPMNSASPQL+      S          FG +FSP   SE GMSP+P L FSPMMSPKTP DY +G  SP MNP+
Sbjct:    1 MANLDLPSVPLREVKRVQFGILSASEIKRLSVVGENGIIYAEKTQDGKPKKDGLMDPRQGPFDKYSYCQTCGGSVAECPGHFGHINLARPVFHIGFKEKIIKILRSVCFKCSKLLADVNSSNVKEILKKTEINPRKRFDFMYDECRRNKVCSVPNSDRDEMDLKTQEMSRSGCGYVQPIFRRNGLEYFVTLKDDSSDSDSKQPLRAYQVLEIFRRITEEDCLLMGFNPKYSRPEGMIMTVLSVPPLAVRPAVVMNHTGKSHDDLTHKLTEVVKVNNEIRTAEENGVASTILLEKENSLQYHVATFIDNESPFLPTAIQKSGRPLKTLKQRLKGKHGRIRSNLMGKRTDYSARTVITADPNLNLDQVGVPRMIAQNLTFPEKVTPFNKHYLQQLVKNGTMYPGAAFVIRENGDRIDLKRRPDSSDIQLQYGETVERHMLNDDFVVFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTSPYNADFDGDEMNLHLPQSLETKAEVSDLARVTKLIITPQSNKPVMSIVQDTLTACNKMTTRDVFLNRAEVMHLLMYLPTWNGRLPKPAIYKPLRLWTGKQIFSLIIPGRVNCIRTHSTHPEPEENGPYKWISPGDTKVLIEDGELISGILCKKTLGSSAGSLIHIIALEQHPDEAGGFFNNVQTVVNNWLLIEGHTIGIVDALYDAKTREEIKQTIDRAKEAVFETIDKAHNYELQSTPGNTLRQTFETTVNKILNDARDKTGSCAQKSLSKYNNFNLMVMSGAKGSKINISQVIACVGQQNVEGKRIPFGFQQRTLPHFIKDDYGPESRGFVENSYLAGLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKAMESVMIKYDSTVRNQIDQLIQFRYGEDGLDGAFVEFQSLPTFKPTMAEFEKRFRFDISNEDELSRYLTEKRVREITTEADTICKLDTEWDQLCKDRELIRDIVKHETGGRVVLPCNINRLVTNGQKIFKIDLLKKTDIKPMDIIEKVENLCTDLIVVKGDDNISKTANENATLLFCCLIRSMLCCKKVIDEYRLSPEAFDWVLGEIKTRFNQSLVQPGEMVGALAAESLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTVFLTGNAAKDAEMAKSIAARLEHTTLRKLAVKSEIYYDPEPESSVIEGDREWVRTYYELPDFDIDKKSPYLLRIVLTRKKMTDKKLTLQAIAEKITEYFQNDIICHIPDDNLNLVLRIRMLKKEDEKDDEKLEMEDRKYLELVENLILDEICLQGIPQISKVYIHYPKTDDKKKIVINSDGAFEGKAEWILETDGTCLQKVLAERDVDSETTISNHITEIFETFGIEAARNAIEREMHHVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLAKIGTGCFDILMNYEKCNEAQALPMMSGVAHNLYMVGGATPMNSASPQLTPWTTLSSPYTFSPKPNSFGASFSPIAHSEIGMSPNPALAFSPMMSPKTPMDYGFGRYSPSMNPI 1560          
BLAST of DNA-directed RNA polymerase subunit vs. Planmine SMEST
Match: SMESG000003379.1 (SMESG000003379.1)

HSP 1 Score: 2112.04 bits (5471), Expect = 0.000e+0
Identity = 1058/1550 (68.26%), Postives = 1258/1550 (81.16%), Query Frame = 1
Query:  250 NMAIATVTLREIKNVQFGIXXXXXXXXXXXXDACGIIYPEKTQDGKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNVICDESEECEKGLNTI---IRQGCNFVQPKFRRNGLDYSMETKDSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAKFVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFERNFRFDIDDIDQLSRHLTEKRVQEIRN-EADILTDIDAEWEQLKIDREFLRETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNLCNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALEWIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVLKRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLXXXXXXXXXXXXXX--XXXYXXXXXXXXXXXXXXQGIPQISKVYLSKPTTDDKKRLIINSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNXXXXXXXXXXXXXXXXXXXXTGFGL-AFSPSGFSEAGMSPSPGLGFSPMMSPKTPHDY 4878
            N+  A V L+ +K+VQFG+LS  E+   SV D  GIIYPEK ++G  K+NGLMD RQGP+D+YS C+TCS +VSECPGHFGHINL++PVY+IG+KEKIIK+LRSVCFKCS++L++ + P+I+ ++KKTE + + RFD+I E+ KK+K+C  +  E  E +K  +      R+GCNF+QPK++R GLDYS+  +   +    + L A+QV ++F+RISNEDC++MGF+Y++SRPESMILTVLAVPPMAVRPAI+MNHSGKAHDDLTHKLTEIVKVN +I+++E+NG AS IILEK N LQYHVATL DNESTFLP AIQKSGRPLKSLKQRLKGK GRVR+NLMGKRTD+TARTVITADPNLNLDQVGVP  IA+NLTFPE VTP N+ FLQ LV NG  YPGAK+VI+ENGDRIDLKR P++ DI LS GE VERHM+NDDFV+FNRQPTLHKMSMM HRVKVLPFSTFRLNLSVT PYNADFDGDEMNLHMPQ+QE+ AE+A LARVN+LVITPQSN+PVMS+VQDSLTAC+KMT RD  LN AEMM+LLMFLP WN VMP+P I KPQRLWTGKQLFSLIIP  +N  RTHSTH + E++GPYKWI++ DT+V +E+GQL+ GILCKK+LGSSSGSL+H+IA+E + + IGNFFN++Q V NNWLL +GH+IGI D LYN  TR+ I+ +I  AKD+VF  I      +L   PGRSL +TFE+ VN ILNE RDKTG+ AQKSLSKYNSFN MV+SGAKGSKINISQVIACVGQQNVEGKRIPF FK RTLPHF+K+D+G ES+GFVENSYLAGLTP+EFFFHAMGGREGIIDTAVKTAETGYIQRRL+KAMES+ V+YD TVRNQI+ + Q RYGEDGLDG FVEFQ+ PTYKINN  FE+ FRF  DD+  L +HL EKRV+EI + ++D L   D EWEQL +DR+++R+T+K+ +GGRL LPCN++RLIWNAK  FKID  K TDIKP DIV+ ++ LC+ LIVV G D+IS   N NS L  C L+RS L CK VI D+RLS  A EWI+GEI+N F K+ V PGEMVG+LAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRL+EIINVSRNPKTPSL IRLLG AAKD E+AKK+AA LEHTTLRKL +SS+IYYDPDP  SV+  DRDWVRTYYE  D D+     YVLRI   RKK+ DKK+SL++IAEKI+E+FKNDI CHV D+NL+LVLRIRMLKK D +++E +     D+ +L  ++NLILDE+ LQGIPQI+KVYLS+PTT DK + ++N +G FE  +EWILETDG+CL KVLAER VD   TTSNHITEIF T GIEAARNAIE EM NV+SFDGSYVNYRHL LLC++MT KG+LMS+DRHGINRQETG LARS+FEETVDIL+EAGAHA+ DPMKGVSES++ GQLA+MGTGCFDIL+N   L+EAQ LP+M G+  +    G  +P +            YN      + +G  AFSP+   E  MSP    G SP  SPKTP+ Y
Sbjct:    3 NINSACVPLKSVKSVQFGLLSATEILKASVLDPEGIIYPEKAENGIAKRNGLMDARQGPVDRYSYCETCSSSVSECPGHFGHINLSKPVYHIGFKEKIIKVLRSVCFKCSRILIDKNRPEIKILLKKTEFNLKARFDMIVEQSKKIKSC--VSAEMMETDKEQSLSDENRREGCNFLQPKYKRKGLDYSVTIQGEHNDVTTKVLQAYQVFDIFQRISNEDCLLMGFDYRFSRPESMILTVLAVPPMAVRPAIIMNHSGKAHDDLTHKLTEIVKVNEDIKRSEQNGAASVIILEKINQLQYHVATLFDNESTFLPTAIQKSGRPLKSLKQRLKGKGGRVRANLMGKRTDFTARTVITADPNLNLDQVGVPILIAKNLTFPEIVTPINRNFLQTLVGNGCEYPGAKYVIKENGDRIDLKRHPNTKDICLSIGETVERHMINDDFVIFNRQPTLHKMSMMCHRVKVLPFSTFRLNLSVTAPYNADFDGDEMNLHMPQTQESRAEVAYLARVNRLVITPQSNKPVMSVVQDSLTACDKMTRRDVLLNKAEMMNLLMFLPCWNNVMPRPAILKPQRLWTGKQLFSLIIPKGINYTRTHSTHNDDEENGPYKWITYCDTKVYVEDGQLLSGILCKKSLGSSSGSLIHVIAVEHNYEVIGNFFNDVQRVTNNWLLIQGHSIGINDCLYNPETRDLIRSSIFVAKDNVFSKIDDCQRFKLKCLPGRSLAETFEDSVNKILNEVRDKTGTIAQKSLSKYNSFNSMVMSGAKGSKINISQVIACVGQQNVEGKRIPFNFKWRTLPHFVKSDYGSESKGFVENSYLAGLTPSEFFFHAMGGREGIIDTAVKTAETGYIQRRLVKAMESIKVEYDGTVRNQIEHVYQFRYGEDGLDGAFVEFQMFPTYKINNSKFEKKFRFRYDDVTYLRKHLIEKRVKEILSYKSDALILFDKEWEQLCLDRKYIRDTIKQESGGRLPLPCNIERLIWNAKTNFKIDQTKLTDIKPLDIVDGIKKLCDSLIVVKGEDKISKETNENSKLYFCILLRSTLSCKVVIDDHRLSSAAFEWIVGEIQNNFSKALVPPGEMVGALAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLREIINVSRNPKTPSLNIRLLGKAAKDAELAKKVAARLEHTTLRKLTLSSKIYYDPDPMESVIPEDRDWVRTYYELADEDISNICPYVLRIDFNRKKVIDKKMSLETIAEKISEHFKNDITCHVSDDNLELVLRIRMLKKQDNEKDESEVETIDDKSFLMKLENLILDEVTLQGIPQITKVYLSEPTTGDKLKRVVNKEGSFEIEKEWILETDGSCLQKVLAERDVDPVNTTSNHITEIFTTLGIEAARNAIEYEMNNVLSFDGSYVNYRHLGLLCDVMTQKGYLMSMDRHGINRQETGVLARSTFEETVDILLEAGAHADIDPMKGVSESVLFGQLAKMGTGCFDILINSDLLNEAQSLPVMQGIGNSFMPSGCFSPSS--------PQYQYNPMSAPFSPYGCSAFSPTNSCE--MSP----GRSPYSSPKTPNFY 1536          
BLAST of DNA-directed RNA polymerase subunit vs. Planmine SMEST
Match: SMESG000069361.1 (SMESG000069361.1)

HSP 1 Score: 446.047 bits (1146), Expect = 1.028e-130
Identity = 299/899 (33.26%), Postives = 474/899 (52.73%), Query Frame = 1
Query:  382 GKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKLLVNIHDPKIREI-MKKTEGSYRKRFDL---IHEECKKVKTCNVICDESEECEKGLNTII-----RQGCNFVQPKFRRNGLDYSMETKDSDDGKGKQPLYAHQVVEVFKRISNEDCIIMGF-NYKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTM-YPGA-----------------KFVIRENGD----RIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFL-----PSWNGVMPKPTIAKPQRLWTGKQLFSLII-PGKVNCNRTHSTHPESE-------DSGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNF-----FNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSN-ELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIP-FGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLP 2922
             KP +NGLMD R G     + C TC      C GHFG+I+L+  ++  G+ + I+KIL+ +C  C  +L+N HD    E  ++K   +Y ++  +   I ++  K++ C   C++S    K L ++      +      Q KF     +YS E K+  +  G   L  + V ++F+ I  +    +G  N K  +  ++I   + VPP+ +RP+   +    + +D    +T ++++     Q  +N         K + +    A ++  ++T +     K  + ++ + QRL GK GR R N+MGKRT++T+RTVI+ DP+L ++++ +P   A  LTF E  T +N   L++L+ NG   YPGA                 +  +  N +    ++D ++    +  +L  G+ V+RH+ + D V+FNRQP+LH++S     + V    TF  N     P+NADFDGDEMN+H PQ+ EA AE   L    K   +P S  P+ + +QD LTA   +T +DTF N  E  +L++ +     P+   ++P+P I KP +L++GKQL SL+I P       +    P+S         S P  +++  DT V+I N +LIMG L KK LG  S   +    L+    D+G+         +  +    L   G ++GI D   +A  R  I+  + +    + +   K + N  L S PG S+ +T E K++  L++ RD+ G   + +L K NS  +M + G+KGS INISQ++ CVGQQ +EGKR+       RTL ++ +    P S+GFV NS+ +GL P EF FHAM GREG+IDTAVKTAETGY+QRRL+K +E + +++D TVR+    L+Q +YG DG D   +E    P
Sbjct:   45 AKPAENGLMDQRMGTCSS-TKCVTCDREQKYCMGHFGYIDLSNYLFPFGFLKDIVKILKCICKTCGHILLNEHDVMSHEKELRKPNLTYIQKKSIRTIIIKKSSKIRRCR-FCNDSNGSVKKLKSLSMICHKKYALKEQQKKFFEQFENYSQEIKNLLNS-GVTLLRPYDVFKLFQAIPVKHYKFLGMSNKKNIKVSNLIFKHIPVPPICIRPSAQTSSENTSRED---DITILLRM-----QIGDN---------KLHDMHSEYARMIKPDATCIRSV--KDKKVIRGMIQRLAGKKGRFRGNIMGKRTNFTSRTVISPDPSLKINEISIPEYCAMKLTFTETATAYNIAHLKKLILNGARKYPGAVAYASGIISKEPQQPMSQLKLMMNSEVMWTKLDNEKWRIEAARKLKVGDFVQRHIDSTDIVLFNRQPSLHRLSFQAFNIVVKKEKTFSFNPCCCNPFNADFDGDEMNVHFPQTFEAKAEAIELISSIKNTTSPNSGEPLTAPLQDILTAAYLLTSKDTFYNEQEFRNLILPIVKCCPPNKIVMIPRPMIMKPVKLYSGKQLMSLVISPYGTLSPDSKRVIPDSRINQIVETSSNPVDYLNPNDTLVVIHNSKLIMGQLPKKLLGGGSKLSIFFRILK----DVGDLASCQSMERLCQIALADLKSRGFSLGITDVSPSAKLRT-IQKELVEQNFAICEEFIKYYENGSLISDPGCSIEETLESKISSQLSKIRDEGGKECKTTLHKRNSPLIMAICGSKGSYINISQMVFCVGQQIIEGKRVSNISGTNRTLMYYPENCRSPMSKGFVSNSFYSGLNPIEFLFHAMSGREGLIDTAVKTAETGYMQRRLIKFLEDLAIRFDNTVRDFTGNLVQFKYGTDGFDPSKLESTYCP 916          

HSP 2 Score: 93.5893 bits (231), Expect = 1.565e-18
Identity = 49/139 (35.25%), Postives = 79/139 (56.83%), Query Frame = 1
Query: 4243 VDSETTTSNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCFDILMNFAQLDEAQCLPMMS 4659
            VD   T SNHI EI+E  GI+AA++ I  E+  V+       + RH+ LL +IM + G +    R GI++ +   L  +SFE+T+D L+EA  H + D + G+S+S+  G+   +GTG   I+ N +   + +  P +S
Sbjct: 1207 VDGINTHSNHILEIYEVLGIDAAKDMIINELNAVMGAHNLTPDIRHVMLLADIMCYTGQICGFQRSGISKSKNSVLCLASFEKTLDHLLEAAYHNQKDKLHGISDSLTFGKTTPIGTGMSTIIFNDSSEKDLRRRPTLS 1345          

HSP 3 Score: 87.4261 bits (215), Expect = 1.112e-16
Identity = 40/100 (40.00%), Postives = 65/100 (65.00%), Query Frame = 1
Query: 3430 FYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTLRKLAVSSEI 3729
            ++K+ + PG  +G +  +S+GEPATQMTL TFHFAGV++ N+T GVPR++EI+N   N KTP +T+ L     +    AK +   ++   L+ + + S++
Sbjct:  997 YFKAIIEPGTAIGVICGQSVGEPATQMTLKTFHFAGVASMNITRGVPRMQEIMNAVANIKTPIITVYLTDDVRE--SFAKTMQLKIQPVFLKNVIIQSQL 1094          
BLAST of DNA-directed RNA polymerase subunit vs. Planmine SMEST
Match: SMESG000021710.1 (SMESG000021710.1)

HSP 1 Score: 358.992 bits (920), Expect = 8.395e-101
Identity = 275/941 (29.22%), Postives = 435/941 (46.23%), Query Frame = 1
Query:  382 GKPKKNGLMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKILRSVCFKCSKL------------LVNIHDPKIR-----EIMKKTEGSYRKRFDL------IHEECKKVKTCNVICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETKDSDDGKGKQPLYA---HQVVEVFKRISNEDCIIMGFN----------------YKYSRPESMILTVLAVPPMAVRPAIVMNHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTI------ILEKENSLQYHVATLMDNESTFLPVAIQKSGRPLK------SLKQRLKGKHGRVRSNLMGKRTDYTARTVITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNG-TMYPGAKFVIRENGDRIDL--KRRP----DSSDIQLSYGE--IVERHMLNDDFVVFNRQPTLHKMSMMGHRVKVL---PFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIANLARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFLPSWNGV---------MPKPTIAKPQRLWTGKQLFSLI----IPGKVNCNRTHSTHPESED----SGPYKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGNFFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTITKGHSNELNSTPGRSLLQTFE----EKVNMILNEARD-----KTGSS---------AQKSLSKY---NSFNLMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGPESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKAMESVMVKYDATVRNQIDQLIQLRYGEDGLD 2892
            GK   NGL D   G ++    C+ C+ +  +C GHFG I  ++ VYN    + + K +++VCF C +L            L  I D  I+     E MK    S +++  L        + C +    +++  +S +CE  ++   ++  +  +P  +R  +D + + +D      ++ LY    +    +F  I  E   ++  N                +KY      +  +L  PPM   PA VMN         T  +  +V+    +R+  +   ++        I E    LQ  V    D            SGR  +       L+Q++  K G  RSN+MGKR ++  R+VI+ DP + LD++GVP      LT+PE + P NK FL Q V NG  +YPGA  V  + G+R  +     P    ++   QL   +  I+ RH L+ D ++ NRQPTLH+ SM  H +K +      T R++ S    YNADFDGDEMN H PQS  A AE   L  V     TP+   P+  ++QD + A  KM +RD+     E + L+     ++G+         +PKP I  P +LWTGKQ+ S++    IP  +       + P+       SG  + +  +D  ++I +G +  GI  K  LG S   L   +      +       N+  ++  +L++ G +  I D   N +     K  +NK +     ++ K  +  L    G       E    +K +   N+  +     KT SS          + +L +    N+  LM  +GAKG + N++++   +G   +EGKR P     RTLP F + D  P SRGF  + +++GL P E FF +M GR+G++DTAVKT+ +GY+QR L+K +E + V +D TVR+ +  +IQ RYG DGLD
Sbjct:   40 GKGAVNGLYDSSLGSLNDREPCRNCNLSFYDCNGHFGRIEFSKLVYNPLLFDTLAKFIKAVCFYCHRLNYTQGLLESICDLSQIKDSLIKRFNDYENMKSKTLSDKQKNALKIMSSQTRKNCHQCHNKSLVFKKSRKCEITVHISAKESRDKGEPSCKRMKIDENPKIRDFKSSYSQEELYGKFTNTDTSIFPEILREHLRLLWSNESENLPLILPMLKYNNFKYPTDVFFMENMLINPPMNRLPA-VMNGDQMTESPETTNMCNVVRAEAALREIIKRKDSTAAEQYYQNIREGILELQKRVNVCYD------------SGRHRELTGSQPGLRQKIDKKDGLFRSNIMGKRVNFACRSVISPDPTIGLDEIGVPIVFLSKLTYPEPLNPMNKDFLLQCVLNGPDVYPGA--VSYQIGNRFPMVIGHNPLEVVENLKFQLQNNQTVIINRHALSGDALIMNRQPTLHRPSMQAHIIKAIHDPKAKTLRMHYSNCKAYNADFDGDEMNGHYPQSLLAQAEAKLLVNVCYQHSTPKDGSPLAGLIQDHIIAGTKMCLRDSTFTRNECLDLV-----YHGLHNSNQREFKLPKPAIIFPNQLWTGKQILSIVLKNSIPAGLELPNISCSEPKKNTMWRISGDEQKLKLSDVELIIIDGYICTGIFDKVHLGPSQKGLCSDLRELYGPEVALKILTNLSRLLTRYLVYTGFSTSIKDGFLNESGECARKNILNKIRSIGSTSVGKSFNVPLMEFRGEKATSLMEFAQFDKSDKFRNKMTEIDTNFKTLSSNYIHQLVETCKNNLREKFPDNNLLLMCQTGAKGGESNVTKIAIALGAIEIEGKRCPLTVGGRTLPSFKRYDLDPVSRGFCVSRFMSGLKPQELFFESMAGRDGLVDTAVKTSTSGYLQRCLIKHLEDITVCHDGTVRDNMHNIIQFRYGYDGLD 960          

HSP 2 Score: 77.411 bits (189), Expect = 1.084e-13
Identity = 43/83 (51.81%), Postives = 58/83 (69.88%), Query Frame = 1
Query: 3400 EWIIGEIRNIFYKSQVHP-GEMVGSLAAESLGEPATQMTLNTFHFAGVSAKNVTLGVPRLKEIINV-SRNPKTPSLTIRLLGA 3642
            E ++ EI  +  +  + P GE VG LAA+S+GEP+TQMTLNTFH AG S  NVTLG+PRL+EI+ + S   KTPS+ + +L  
Sbjct: 1025 ENLLREIIAVKSEYSICPNGEAVGLLAAQSVGEPSTQMTLNTFHNAGQSEMNVTLGIPRLREILMLGSDKIKTPSMDVPILAC 1107          

HSP 3 Score: 73.9442 bits (180), Expect = 1.250e-12
Identity = 41/118 (34.75%), Postives = 68/118 (57.63%), Query Frame = 1
Query: 4264 SNHITEIFETFGIEAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINRQETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQL-ARMGTGCFDILM 4614
            SN+I ++ + +GIEAA + IE E+  V       VN RHL L+ + +TH G + + +RH +    +  L R+SFE  + +++E   +   D +K  + +IM GQL + +GT   D+LM
Sbjct: 1375 SNNIIKMSKLYGIEAAMSCIENEIKTVFKSYNIDVNSRHLRLIADFLTHSGKVGAFNRHMMTNH-SSPLQRASFETALTVIIEMLTYGTVDYIKSPTSNIMFGQLVSNIGTNAMDLLM 1491          
The following BLAST results are available for this feature:
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POLR2A0.000e+057.37RNA polymerase II subunit A [Source:HGNC Symbol;Ac... [more]
POLR2A0.000e+057.37RNA polymerase II subunit A [Source:HGNC Symbol;Ac... [more]
POLR2A0.000e+057.27RNA polymerase II subunit A [Source:HGNC Symbol;Ac... [more]
POLR3A3.312e-17136.66RNA polymerase III subunit A [Source:HGNC Symbol;A... [more]
POLR1A2.622e-9133.23RNA polymerase I subunit A [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ama-10.000e+055.74DNA-directed RNA polymerase II subunit RPB1 [Sour... [more]
ama-10.000e+055.74DNA-directed RNA polymerase II subunit RPB1 [Sour... [more]
rpc-10.000e+032.60DNA-directed RNA polymerase subunit [Source:UniPr... [more]
rpoa-13.169e-9432.05DNA-directed RNA polymerase subunit [Source:UniPr... [more]
rpoa-14.533e-1036.46DNA-directed RNA polymerase subunit [Source:UniPr... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
RpII2150.000e+057.24gene:FBgn0003277 transcript:FBtr0073542[more]
RpIIIC1600.000e+031.19gene:FBgn0030687 transcript:FBtr0300811[more]
RpI19.480e-11731.90gene:FBgn0019938 transcript:FBtr0087511[more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
polr2a0.000e+057.72polymerase (RNA) II (DNA directed) polypeptide A [... [more]
polr3a3.447e-17036.65polymerase (RNA) III (DNA directed) polypeptide A ... [more]
polr1a3.942e-8930.91RNA polymerase I subunit A [Source:ZFIN;Acc:ZDB-GE... [more]
polr1a4.752e-8930.91RNA polymerase I subunit A [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctdnep10.000e+052.73CTD nuclear envelope phosphatase 1 [Source:Xenbase... [more]
ctdnep12.327e-1159.92CTD nuclear envelope phosphatase 1 [Source:Xenbase... [more]
polr3a2.510e-17438.10polymerase (RNA) III (DNA directed) polypeptide A,... [more]
polr3a2.744e-17438.10polymerase (RNA) III (DNA directed) polypeptide A,... [more]
polr3a5.335e-17438.10polymerase (RNA) III (DNA directed) polypeptide A,... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Polr2a0.000e+057.28polymerase (RNA) II (DNA directed) polypeptide A [... [more]
Polr2a0.000e+057.37polymerase (RNA) II (DNA directed) polypeptide A [... [more]
Polr3a5.586e-17237.31polymerase (RNA) III (DNA directed) polypeptide A ... [more]
Polr3a7.346e-10836.59polymerase (RNA) III (DNA directed) polypeptide A ... [more]
Polr1a8.378e-9132.45polymerase (RNA) I polypeptide A [Source:MGI Symbo... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04052|RPB1_DROME0.000e+057.24DNA-directed RNA polymerase II subunit RPB1 OS=Dro... [more]
sp|P08775|RPB1_MOUSE0.000e+057.37DNA-directed RNA polymerase II subunit RPB1 OS=Mus... [more]
sp|P24928|RPB1_HUMAN0.000e+057.37DNA-directed RNA polymerase II subunit RPB1 OS=Hom... [more]
sp|P11414|RPB1_CRIGR0.000e+057.37DNA-directed RNA polymerase II subunit RPB1 OS=Cri... [more]
sp|P35074|RPB1_CAEBR0.000e+056.37DNA-directed RNA polymerase II subunit RPB1 OS=Cae... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMI60.000e+076.60DNA-directed RNA polymerase subunit OS=Schmidtea m... [more]
A0A419Q5000.000e+064.19DNA-directed RNA polymerase subunit OS=Clonorchis ... [more]
A0A4S2M8D40.000e+064.11DNA-directed RNA polymerase subunit OS=Opisthorchi... [more]
A0A075AJW90.000e+064.25DNA-directed RNA polymerase subunit OS=Opisthorchi... [more]
A0A095APJ20.000e+064.53DNA-directed RNA polymerase subunit OS=Schistosoma... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polr2a0.000e+057.64RNA polymerase II subunit A [Source:NCBI gene;Acc:... [more]
polr2a0.000e+057.68RNA polymerase II subunit A [Source:NCBI gene;Acc:... [more]
polr3a2.872e-14433.90polymerase (RNA) III (DNA directed) polypeptide A ... [more]
ENSAMXT00000011874.21.510e-5032.96pep primary_assembly:Astyanax_mexicanus-2.0:24:124... [more]
ENSAMXT00000011881.25.501e-1144.62pep primary_assembly:Astyanax_mexicanus-2.0:24:124... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RPO210.000e+045.45RNA polymerase II largest subunit B220; part of ce... [more]
RPO312.057e-17536.54RNA polymerase III largest subunit C160; part of c... [more]
RPA1902.492e-9531.59RNA polymerase I largest subunit A190 [Source:SGD;... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399760.000e+054.95DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
EDO362910.000e+032.76DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
EDO394962.664e-7832.92DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
EDO274356.638e-2426.00DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
EDO394971.509e-1053.33DNA-directed RNA polymerase [Source:UniProtKB/TrE... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polr2a0.000e+057.89RNA polymerase II subunit A [Source:NCBI gene;Acc:... [more]
polr2a0.000e+058.07RNA polymerase II subunit A [Source:NCBI gene;Acc:... [more]
polr3a3.241e-17036.13RNA polymerase III subunit A [Source:NCBI gene;Acc... [more]
polr3a6.280e-17036.23RNA polymerase III subunit A [Source:NCBI gene;Acc... [more]
polr1a4.274e-9033.91RNA polymerase I subunit A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DNA-directed RNA polymerase subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078620.11.234e-31100.00SMESG000078620.1[more]
SMESG000010459.10.000e+076.60SMESG000010459.1[more]
SMESG000003379.10.000e+068.26SMESG000003379.1[more]
SMESG000069361.11.028e-13033.26SMESG000069361.1[more]
SMESG000021710.18.395e-10129.22SMESG000021710.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012878 ID=SMED30012878|Name=DNA-directed RNA polymerase subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=5959bp
GATAGAATTTTTTTTTAATAGGGATTTTCCAATCATTTAGCTTCGCATGG
ATGTTATTTAATGTCATTTAGCTAACAATGATTTGCAGTTAATGAGTAAA
ATCAACAGTTTATGTATTGTATTATATAAGTTGCTAGTTTTGACTTTGAG
GGATAAAACTAAATCCAATTTAACCTTAATTTAATTATTAAAAATATTAC
TATTTTATCATATAAATTAATTTTTGTTTTAATATTTTACATTTTACTCA
ACATGGCTATAGCTACTGTTACATTAAGAGAAATAAAAAACGTCCAATTT
GGAATTCTAAGTGAAGTCGAATTAAGAAGCCTTTCAGTTAGTGATGCTTG
TGGAATAATTTATCCGGAAAAAACTCAAGATGGCAAACCTAAGAAAAATG
GTTTAATGGATCCAAGACAGGGTCCAATGGATAAATATTCAATGTGTCAA
ACGTGTTCCGGAAATGTATCTGAATGCCCGGGTCATTTTGGGCACATAAA
TCTAGCACGACCTGTCTATAATATCGGATATAAAGAAAAAATAATAAAAA
TTCTCAGATCGGTCTGTTTCAAATGTTCTAAACTTCTCGTCAACATTCAC
GACCCTAAAATTCGAGAAATTATGAAAAAAACCGAAGGTTCATACAGAAA
GCGTTTTGATTTAATTCACGAAGAATGTAAAAAAGTCAAAACCTGTAATG
TAATCTGTGATGAAAGTGAAGAATGTGAAAAGGGTCTAAATACGATTATC
CGACAGGGATGCAATTTTGTTCAACCGAAATTCCGAAGAAATGGCCTGGA
TTATTCAATGGAAACGAAAGATTCCGATGACGGTAAAGGGAAGCAACCGT
TATATGCACATCAAGTGGTAGAAGTATTTAAAAGAATATCAAATGAAGAC
TGTATAATAATGGGATTTAATTATAAATATTCGCGACCAGAATCAATGAT
CTTGACGGTACTTGCTGTTCCTCCAATGGCCGTTAGACCGGCTATTGTTA
TGAACCACAGTGGAAAGGCTCACGATGATTTAACACATAAGCTCACCGAA
ATAGTCAAAGTTAATAATGAAATCAGACAAGCAGAAGAAAATGGAGTTGC
TTCAACTATTATATTGGAAAAAGAAAATAGTTTGCAATACCACGTGGCCA
CATTAATGGACAATGAAAGTACATTTCTTCCGGTGGCAATTCAAAAGTCC
GGACGACCACTTAAATCCTTAAAACAACGATTGAAAGGTAAGCATGGAAG
AGTCCGATCGAATCTTATGGGCAAGCGAACTGATTACACGGCTAGAACTG
TAATTACTGCTGATCCAAATTTGAATCTCGACCAAGTTGGTGTTCCTAGA
GCTATTGCTCAAAATCTCACGTTTCCCGAACGTGTAACTCCATTTAATAA
AAAATTTCTCCAGCAACTCGTTAGAAACGGCACCATGTATCCCGGGGCAA
AGTTCGTAATTAGGGAAAACGGTGACAGAATCGATCTCAAACGCCGACCG
GATAGCTCAGACATACAATTATCTTACGGTGAAATAGTCGAGCGTCATAT
GCTGAATGATGATTTCGTGGTTTTCAATCGGCAACCTACTCTCCATAAAA
TGTCTATGATGGGCCATCGTGTCAAGGTGTTACCGTTTTCGACATTTCGT
TTGAATCTTTCTGTCACTGGTCCTTACAATGCCGATTTCGATGGAGACGA
GATGAATTTACACATGCCACAATCGCAGGAAGCGACAGCTGAAATTGCTA
ATCTTGCTCGAGTAAACAAGCTTGTTATTACCCCTCAAAGTAATCGACCA
GTCATGAGTATTGTGCAAGATTCTCTAACCGCGTGTAATAAAATGACTAT
GCGTGACACGTTTCTAAATGCAGCCGAAATGATGCATTTACTGATGTTCT
TGCCTTCCTGGAATGGTGTAATGCCAAAACCGACTATTGCCAAACCTCAA
CGTTTGTGGACCGGTAAACAATTGTTCTCTCTCATAATTCCCGGAAAAGT
GAACTGTAATCGAACTCACAGTACACATCCGGAATCAGAAGATTCTGGGC
CTTATAAATGGATATCACATGCTGACACTCGAGTTCTCATTGAAAACGGT
CAATTGATAATGGGTATATTGTGCAAAAAAACTCTCGGCAGCAGTTCCGG
TTCACTGATGCATATCATAGCCTTGGAACAGTCCGCTGATGATATCGGAA
ACTTTTTCAACAATATCCAAACAGTTGTCAACAATTGGCTGCTTTTTGAA
GGCCATACAATCGGTATTGTCGACACTTTATACAATGCTGCAACACGCGA
GGAAATCAAATTTAACATCAACAAAGCCAAAGATGATGTTTTTGATACAA
TTACCAAAGGTCACAGTAACGAATTAAATTCCACTCCTGGTCGATCATTA
CTGCAGACGTTCGAAGAAAAAGTCAATATGATTCTCAATGAAGCTCGAGA
TAAAACCGGTAGCTCAGCTCAAAAATCGCTTTCCAAATATAATAGTTTCA
ATTTGATGGTGGTTTCTGGAGCAAAAGGCTCGAAAATCAATATTTCTCAA
GTGATAGCCTGTGTAGGGCAGCAGAACGTCGAAGGAAAGCGAATCCCATT
TGGATTCAAACAGCGAACACTACCACATTTTATTAAAACCGATTTTGGTC
CCGAGTCCAGAGGTTTCGTTGAGAACTCATATCTAGCTGGGCTGACACCG
ACTGAGTTTTTCTTTCACGCTATGGGTGGTAGAGAAGGTATCATCGACAC
GGCCGTCAAAACTGCGGAAACCGGTTACATTCAACGGCGGTTGATGAAAG
CCATGGAGTCAGTGATGGTGAAATACGATGCAACTGTGAGAAATCAAATC
GATCAATTGATTCAATTGCGTTACGGTGAGGACGGTCTCGATGGAGGGTT
TGTGGAGTTTCAAGTGTTACCGACATATAAAATCAATAACTTAAATTTCG
AAAGGAATTTCCGATTTGACATTGATGATATCGATCAATTGAGCCGTCAT
TTGACGGAGAAACGAGTCCAGGAAATAAGAAACGAAGCCGACATCTTAAC
AGATATTGATGCAGAATGGGAGCAATTGAAAATTGATCGGGAATTTCTCC
GGGAAACTCTTAAAGAATCCACCGGTGGTCGATTGGCGTTACCTTGTAAT
GTACAACGATTAATATGGAACGCAAAAATGACATTTAAAATCGATGTGTT
GAAGAAAACCGATATCAAACCCACAGATATTGTAAACAAAGTTAGAAATC
TGTGCAATGAATTGATAGTTGTTCCTGGAAACGATAGAATCAGTATTACA
GCGAATAGGAATTCAACCCTATTGCTCTGCTGTTTGATTAGAAGTTATCT
ATGCTGCAAAAAGGTCATTTGCGATAATCGTTTAAGCTTAGAAGCCCTTG
AATGGATTATAGGTGAGATTCGAAATATATTCTACAAGTCTCAAGTTCAC
CCTGGAGAAATGGTTGGTTCCCTAGCTGCTGAAAGTCTCGGAGAACCGGC
AACCCAAATGACACTGAACACCTTTCATTTTGCCGGTGTCTCAGCAAAGA
ATGTCACTCTCGGTGTGCCTCGATTGAAAGAAATTATCAATGTCAGTCGA
AACCCAAAAACCCCCTCGCTGACAATTCGGCTTCTCGGAGCTGCAGCTAA
AGATGTTGAAATCGCAAAGAAAATCGCCGCCAGTCTCGAGCACACAACTC
TCCGTAAATTGGCAGTGAGTTCGGAAATCTATTACGATCCGGATCCGGAA
AATTCTGTTGTCGAAAGCGATAGAGATTGGGTGCGAACCTACTATGAGTT
CCCGGATTTCGATGTCGACAAAAAAAGTCTGTATGTGTTGAGAATTGTGT
TGAAGAGAAAGAAAATCACCGATAAGAAATTGAGCTTGCAAAGTATTGCT
GAGAAAATCACCGAATATTTCAAAAACGATATTATATGTCATGTTCCCGA
TGAGAACTTGGATTTGGTGCTCCGTATCAGAATGCTGAAGAAAGACGATG
AAAAGGAGGAAGAACCGGATGAAATGGAGGACAGGAAATATTTGGAATTG
ATTGATAATCTAATTTTGGATGAGATCTGTTTGCAGGGTATTCCTCAGAT
CTCTAAGGTTTACCTTTCGAAACCCACTACCGACGACAAGAAGCGATTGA
TTATCAATAGTAAGGGAGATTTTGAGAAAGTCGAAGAATGGATTTTAGAA
ACCGATGGTACTTGTTTACCGAAAGTGTTGGCGGAGCGTTATGTCGACAG
TGAAACGACTACCAGCAATCATATTACGGAAATTTTCGAAACATTTGGTA
TTGAAGCTGCCCGCAATGCAATTGAGGCAGAAATGACGAATGTTATTTCA
TTCGACGGTTCCTATGTCAACTATCGGCACTTGGCGTTACTCTGTGAAAT
AATGACCCACAAAGGATTCCTCATGTCGATTGACAGACACGGAATAAATC
GTCAGGAAACCGGCGCTCTTGCTAGATCGTCATTCGAAGAAACCGTTGAT
ATATTGATGGAAGCCGGTGCTCATGCAGAATGTGATCCAATGAAAGGGGT
TTCCGAATCGATTATGCTCGGACAGTTGGCTAGGATGGGAACCGGTTGTT
TTGATATATTGATGAATTTTGCACAACTTGACGAGGCCCAATGTCTACCA
ATGATGAGCGGGGTCGCTCAGAATCTGTTTATGGTCGGAGGAGCGACACC
AATGAATTCAGCATCACCGCAATTGTCACAATACAGTCCATCGTATAATT
ATTCTCCCAATTCCAGTACCGGATTTGGATTGGCATTTTCACCGAGCGGA
TTTTCTGAAGCCGGTATGTCACCAAGTCCCGGATTGGGTTTCAGTCCAAT
GATGAGTCCGAAAACCCCACATGATTATTTCTATGGGTTAAATTCTCCTG
GAATGAATCCACTCAGTCCTACCAGTGCCAGTCCGTTTTATTCTCCAGCA
TCAAGTCCAGGATCTAGCCCATCAAGTCCACAATTTTCGCACTCGTCTCG
TAGTCCTCATTCTCAGGGTTACTCGCCAACATCGCCTTCTTACAGTCCGA
CAAGTCCTGGATATTCGGGTAAAAGCCCCAGTTATTCAGGCACATCTCCT
TCGTATAGCCCAACGAGCCCCGGTTACTCGCCAACTAGTCCGGGTTACTC
ACCGACTAGTCCAGGATATAGCCCCACTAGCCCAAGTTATTCACCTACTA
GCCCAGGATATTCCCCTACTAGTCCCGGATATTCTCCCACTAGTCCAGGG
TATTCCCCAACTAGTCCAGGTTATTCCCCTTCTAGTCCTGGTTATTCCCC
TTCAAGCCCCGGATATTCCCCCAATAGTCCCGGGTATTCACCTACTAGTC
CAAGCTATTCACCCACTAGTCCAAGATATTCCGCTACTTATAACCCATTA
AGCCCTAATTTATCATCAACGTCTCCATCTTATAGTCCTAATCGATTGGC
AGCTGCATCTCCATGTTATTCTCCCAAAGCTAATAGCTATTCTGATTTAT
CATATAACCCATCATCTCCGTCTATCGGCGCATCAAATGGTACATTGAAT
TCTCCAAGTATGCTATCATATTCTCCATCTGTCAATTCTAAATCCATTGG
GTATTCTCCAAATCTATCTTCTCCAGCCAATCGAGTTTACACGCCAACCT
CACCGAATTATTCGCCATCTTCGCCGAATTATTCTCCAACCTCACCAAAC
TATTCGCCAACTTCACCGAATTATTCATCAATCTCACAGCGATACTCTCC
AAGCTCGACGAATTATTCACCCAGTTCGCCGAATTACTCGCCAAGCTCAC
CAAATTTCTCGCCAAGCTCACCAAATTACTCGCCAAGCTCACCGAATTAT
TCACCGAACTCTCCACAATCTACTGCAACAAATAGGGTGTATTCACCAAC
GTCGCCAGCATTTTCTCCAACTTCACCTGGATCTATTGGAAAAAAACTTT
AACTTAAAT
back to top

protein sequence of SMED30012878-orf-1

>SMED30012878-orf-1 ID=SMED30012878-orf-1|Name=SMED30012878-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1900bp
MAIATVTLREIKNVQFGILSEVELRSLSVSDACGIIYPEKTQDGKPKKNG
LMDPRQGPMDKYSMCQTCSGNVSECPGHFGHINLARPVYNIGYKEKIIKI
LRSVCFKCSKLLVNIHDPKIREIMKKTEGSYRKRFDLIHEECKKVKTCNV
ICDESEECEKGLNTIIRQGCNFVQPKFRRNGLDYSMETKDSDDGKGKQPL
YAHQVVEVFKRISNEDCIIMGFNYKYSRPESMILTVLAVPPMAVRPAIVM
NHSGKAHDDLTHKLTEIVKVNNEIRQAEENGVASTIILEKENSLQYHVAT
LMDNESTFLPVAIQKSGRPLKSLKQRLKGKHGRVRSNLMGKRTDYTARTV
ITADPNLNLDQVGVPRAIAQNLTFPERVTPFNKKFLQQLVRNGTMYPGAK
FVIRENGDRIDLKRRPDSSDIQLSYGEIVERHMLNDDFVVFNRQPTLHKM
SMMGHRVKVLPFSTFRLNLSVTGPYNADFDGDEMNLHMPQSQEATAEIAN
LARVNKLVITPQSNRPVMSIVQDSLTACNKMTMRDTFLNAAEMMHLLMFL
PSWNGVMPKPTIAKPQRLWTGKQLFSLIIPGKVNCNRTHSTHPESEDSGP
YKWISHADTRVLIENGQLIMGILCKKTLGSSSGSLMHIIALEQSADDIGN
FFNNIQTVVNNWLLFEGHTIGIVDTLYNAATREEIKFNINKAKDDVFDTI
TKGHSNELNSTPGRSLLQTFEEKVNMILNEARDKTGSSAQKSLSKYNSFN
LMVVSGAKGSKINISQVIACVGQQNVEGKRIPFGFKQRTLPHFIKTDFGP
ESRGFVENSYLAGLTPTEFFFHAMGGREGIIDTAVKTAETGYIQRRLMKA
MESVMVKYDATVRNQIDQLIQLRYGEDGLDGGFVEFQVLPTYKINNLNFE
RNFRFDIDDIDQLSRHLTEKRVQEIRNEADILTDIDAEWEQLKIDREFLR
ETLKESTGGRLALPCNVQRLIWNAKMTFKIDVLKKTDIKPTDIVNKVRNL
CNELIVVPGNDRISITANRNSTLLLCCLIRSYLCCKKVICDNRLSLEALE
WIIGEIRNIFYKSQVHPGEMVGSLAAESLGEPATQMTLNTFHFAGVSAKN
VTLGVPRLKEIINVSRNPKTPSLTIRLLGAAAKDVEIAKKIAASLEHTTL
RKLAVSSEIYYDPDPENSVVESDRDWVRTYYEFPDFDVDKKSLYVLRIVL
KRKKITDKKLSLQSIAEKITEYFKNDIICHVPDENLDLVLRIRMLKKDDE
KEEEPDEMEDRKYLELIDNLILDEICLQGIPQISKVYLSKPTTDDKKRLI
INSKGDFEKVEEWILETDGTCLPKVLAERYVDSETTTSNHITEIFETFGI
EAARNAIEAEMTNVISFDGSYVNYRHLALLCEIMTHKGFLMSIDRHGINR
QETGALARSSFEETVDILMEAGAHAECDPMKGVSESIMLGQLARMGTGCF
DILMNFAQLDEAQCLPMMSGVAQNLFMVGGATPMNSASPQLSQYSPSYNY
SPNSSTGFGLAFSPSGFSEAGMSPSPGLGFSPMMSPKTPHDYFYGLNSPG
MNPLSPTSASPFYSPASSPGSSPSSPQFSHSSRSPHSQGYSPTSPSYSPT
SPGYSGKSPSYSGTSPSYSPTSPGYSPTSPGYSPTSPGYSPTSPSYSPTS
PGYSPTSPGYSPTSPGYSPTSPGYSPSSPGYSPSSPGYSPNSPGYSPTSP
SYSPTSPRYSATYNPLSPNLSSTSPSYSPNRLAAASPCYSPKANSYSDLS
YNPSSPSIGASNGTLNSPSMLSYSPSVNSKSIGYSPNLSSPANRVYTPTS
PNYSPSSPNYSPTSPNYSPTSPNYSSISQRYSPSSTNYSPSSPNYSPSSP
NFSPSSPNYSPSSPNYSPNSPQSTATNRVYSPTSPAFSPTSPGSIGKKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038593RNA_pol_Rpb1_7_sf
IPR038120Rpb1_funnel_sf
IPR042102RNA_pol_Rpb1_3_sf
IPR006592RNA_pol_N
IPR007083RNA_pol_Rpb1_4
IPR007066RNA_pol_Rpb1_3
IPR000684RNA_pol_II_repeat_euk
IPR007081RNA_pol_Rpb1_5
IPR007080RNA_pol_Rpb1_1
IPR007075RNA_pol_Rpb1_6
IPR007073RNA_pol_Rpb1_7
IPR000722RNA_pol_asu
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003899DNA-directed 5'-3' RNA polymerase activity
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
Vocabulary: cellular component
TermDefinition
GO:0005665DNA-directed RNA polymerase II, core complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 260..280
NoneNo IPR availablePRINTSPR01217PRICHEXTENSNcoord: 1616..1637
score: 32.73
coord: 1553..1569
score: 38.82
coord: 1679..1704
score: 27.69
coord: 1592..1604
score: 36.92
coord: 1661..1678
score: 30.0
coord: 1644..1660
score: 35.29
NoneNo IPR availableGENE3DG3DSA:3.30.1490.180coord: 373..435
e-value: 3.3E-70
score: 237.5
NoneNo IPR availableGENE3DG3DSA:1.10.150.390coord: 1405..1450
e-value: 1.1E-14
score: 56.0
NoneNo IPR availableGENE3DG3DSA:2.20.25.410coord: 853..886
e-value: 5.4E-8
score: 34.3
NoneNo IPR availableGENE3DG3DSA:2.40.40.20coord: 330..499
e-value: 3.3E-70
score: 237.5
NoneNo IPR availableGENE3DG3DSA:1.20.120.1280coord: 250..303
e-value: 2.0E-8
score: 36.1
coord: 2..117
e-value: 2.2E-28
score: 100.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1558..1733
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1793..1891
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1558..1734
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1793..1899
NoneNo IPR availablePANTHERPTHR19376DNA-DIRECTED RNA POLYMERASEcoord: 10..1507
NoneNo IPR availablePANTHERPTHR19376:SF52DNA-DIRECTED RNA POLYMERASE II SUBUNIT 1coord: 10..1507
NoneNo IPR availableCDDcd02733RNAP_II_RPB1_Ncoord: 12..859
e-value: 0.0
score: 1350.66
NoneNo IPR availableCDDcd02584RNAP_II_Rpb1_Ccoord: 1043..1455
e-value: 0.0
score: 663.519
NoneNo IPR availableSUPERFAMILYSSF64484beta and beta-prime subunits of DNA dependent RNA-polymerasecoord: 5..1456
IPR006592RNA polymerase, N-terminalSMARTSM00663rpolaneu7coord: 230..532
e-value: 1.2E-170
score: 582.9
IPR000722RNA polymerase, alpha subunitPFAMPF00623RNA_pol_Rpb1_2coord: 340..503
e-value: 1.8E-68
score: 230.0
IPR007066RNA polymerase Rpb1, domain 3PFAMPF04983RNA_pol_Rpb1_3coord: 508..675
e-value: 5.1E-46
score: 156.5
IPR000684RNA polymerase II, heptapeptide repeat, eukaryoticPFAMPF05001RNA_pol_Rpb1_Rcoord: 1675..1688
e-value: 1.1
score: 9.7
coord: 1853..1866
e-value: 4.2
score: 7.9
coord: 1598..1611
e-value: 0.37
score: 11.2
coord: 1811..1824
e-value: 0.038
score: 14.4
coord: 1846..1859
e-value: 12.0
score: 6.4
coord: 1661..1674
e-value: 0.0031
score: 17.8
coord: 1633..1646
e-value: 0.036
score: 14.4
coord: 1640..1653
e-value: 0.056
score: 13.8
coord: 1839..1852
e-value: 3.7
score: 8.1
coord: 1881..1893
e-value: 0.062
score: 13.7
coord: 1626..1639
e-value: 0.0032
score: 17.7
coord: 1668..1681
e-value: 0.029
score: 14.7
coord: 1696..1709
e-value: 0.09
score: 13.2
coord: 1654..1667
e-value: 0.0031
score: 17.8
coord: 1612..1625
e-value: 0.43
score: 11.0
coord: 1619..1632
e-value: 0.0031
score: 17.8
coord: 1798..1810
e-value: 0.63
score: 10.5
coord: 1689..1702
e-value: 0.28
score: 11.6
coord: 1647..1660
e-value: 0.0032
score: 17.7
coord: 1682..1695
e-value: 0.97
score: 9.9
IPR000684RNA polymerase II, heptapeptide repeat, eukaryoticPROSITEPS00115RNA_POL_II_REPEATcoord: 1859..1865
IPR000684RNA polymerase II, heptapeptide repeat, eukaryoticPROSITEPS00115RNA_POL_II_REPEATcoord: 1817..1823
IPR000684RNA polymerase II, heptapeptide repeat, eukaryoticPROSITEPS00115RNA_POL_II_REPEATcoord: 1695..1701
IPR000684RNA polymerase II, heptapeptide repeat, eukaryoticPROSITEPS00115RNA_POL_II_REPEATcoord: 1810..1816
IPR000684RNA polymerase II, heptapeptide repeat, eukaryoticPROSITEPS00115RNA_POL_II_REPEATcoord: 1845..1851
IPR000684RNA polymerase II, heptapeptide repeat, eukaryoticPROSITEPS00115RNA_POL_II_REPEATcoord: 1796..1802
IPR000684RNA polymerase II, heptapeptide repeat, eukaryoticPROSITEPS00115RNA_POL_II_REPEATcoord: 1803..1809
IPR000684RNA polymerase II, heptapeptide repeat, eukaryoticPROSITEPS00115RNA_POL_II_REPEATcoord: 1838..1844
IPR038593RNA polymerase Rpb1, domain 7 superfamilyGENE3DG3DSA:3.30.1360.140coord: 1148..1279
e-value: 1.6E-37
score: 130.4
IPR038120RNA polymerase Rpb1, funnel domain superfamilyGENE3DG3DSA:1.10.132.30coord: 670..815
e-value: 4.5E-50
score: 171.4
IPR007080RNA polymerase Rpb1, domain 1PFAMPF04997RNA_pol_Rpb1_1coord: 9..338
e-value: 6.3E-92
score: 308.2
IPR007081RNA polymerase Rpb1, domain 5PFAMPF04998RNA_pol_Rpb1_5coord: 813..1405
e-value: 2.2E-97
score: 326.4
IPR007073RNA polymerase Rpb1, domain 7PFAMPF04990RNA_pol_Rpb1_7coord: 1148..1278
e-value: 6.5E-37
score: 126.5
IPR007083RNA polymerase Rpb1, domain 4PFAMPF05000RNA_pol_Rpb1_4coord: 702..806
e-value: 2.8E-37
score: 127.0
IPR007075RNA polymerase Rpb1, domain 6PFAMPF04992RNA_pol_Rpb1_6coord: 879..1063
e-value: 2.0E-53
score: 181.1
IPR042102RNA polymerase Rpb1, domain 3 superfamilyGENE3DG3DSA:1.10.274.100coord: 508..669
e-value: 8.6E-49
score: 167.1