ATP-binding cassette sub-family A member

Overview
NameATP-binding cassette sub-family A member
Smed IDSMED30012877
Length (bp)780
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-binding cassette sub-family A member (SMED30012877) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-binding cassette sub-family A member (SMED30012877) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-binding cassette sub-family A member (SMED30012877) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-binding cassette sub-family A member (SMED30012877) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012877

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30012877SMESG000068605.1 SmedASXL_004889SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30012877SMESG000068605.1 dd_Smed_v4_32573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012877SMESG000068605.1 dd_Smed_v4_32573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012877SMESG000068605.1 dd_Smed_v4_32573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012877SMESG000068605.1 dd_Smed_v4_32573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30012877SMESG000068605.1 dd_Smed_v6_32573_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30012877SMESG000068605.1 dd_Smed_v6_32573_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30012877SMESG000068605.1 OX_Smed_1.0.08391ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Human
Match: ABCA12 (ATP binding cassette subfamily A member 12 [Source:HGNC Symbol;Acc:HGNC:14637])

HSP 1 Score: 114.775 bits (286), Expect = 3.283e-28
Identity = 77/223 (34.53%), Postives = 124/223 (55.61%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIAL-KFIQNHVPDAKMMEETRSQWTIVLPQSENNCS-KFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKL-DALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISE 663
            LSDRIA + QG L+CCGS  +LK+ FG+GY+L + K +S       N  ++   +A+   IQ+H+P+A + E+   +   VLP      S  +  L   LD  M DL I  YG+SDT++EEVFL +  + S +   +  + LT +K+ ++  +G + P   S+ S    S F   ++  ++  + E     L G  L +++I+ + IKRFH+TRRN K  I++
Sbjct: 1543 LSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKKKSPNL----NANAVCDTMAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDNGMGDLNIGCYGISDTTVEEVFLNLTKE-SQKNSAMSLEHLTQKKIGNSNANGISTPDDLSVSS----SNFTDRDD--KILTRGE----RLDGFGLLLKKIMAILIKRFHHTRRNWKGLIAQ 1750          

HSP 2 Score: 56.6102 bits (135), Expect = 2.101e-8
Identity = 37/128 (28.91%), Postives = 59/128 (46.09%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYL-IIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADD 384
            L  R+AI+  GK QC GS   +K  FG G+ + + +K   +  E              KF+Q H P   + ++  S     +P +    +   ++FD L+     L I  + +S T+LEEVF+  A D
Sbjct: 2455 LCTRLAIMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTMETLT-----------KFMQLHFPKTYLKDQHLSMLEYHVPVTAGGVA---NIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2568          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Human
Match: ABCA12 (ATP binding cassette subfamily A member 12 [Source:HGNC Symbol;Acc:HGNC:14637])

HSP 1 Score: 114.39 bits (285), Expect = 3.968e-28
Identity = 77/223 (34.53%), Postives = 124/223 (55.61%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIAL-KFIQNHVPDAKMMEETRSQWTIVLPQSENNCS-KFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKL-DALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISE 663
            LSDRIA + QG L+CCGS  +LK+ FG+GY+L + K +S       N  ++   +A+   IQ+H+P+A + E+   +   VLP      S  +  L   LD  M DL I  YG+SDT++EEVFL +  + S +   +  + LT +K+ ++  +G + P   S+ S    S F   ++  ++  + E     L G  L +++I+ + IKRFH+TRRN K  I++
Sbjct: 1225 LSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKKKSPNL----NANAVCDTMAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDNGMGDLNIGCYGISDTTVEEVFLNLTKE-SQKNSAMSLEHLTQKKIGNSNANGISTPDDLSVSS----SNFTDRDD--KILTRGE----RLDGFGLLLKKIMAILIKRFHHTRRNWKGLIAQ 1432          

HSP 2 Score: 56.6102 bits (135), Expect = 2.063e-8
Identity = 37/128 (28.91%), Postives = 59/128 (46.09%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYL-IIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADD 384
            L  R+AI+  GK QC GS   +K  FG G+ + + +K   +  E              KF+Q H P   + ++  S     +P +    +   ++FD L+     L I  + +S T+LEEVF+  A D
Sbjct: 2137 LCTRLAIMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTMETLT-----------KFMQLHFPKTYLKDQHLSMLEYHVPVTAGGVA---NIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2250          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Human
Match: ABCA4 (ATP binding cassette subfamily A member 4 [Source:HGNC Symbol;Acc:HGNC:34])

HSP 1 Score: 111.694 bits (278), Expect = 4.351e-27
Identity = 85/287 (29.62%), Postives = 141/287 (49.13%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIV-KTESIQWE------------------------DFQNELSISGGI--ALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDP-SGEV--GGIKEKK--LTPEK--LDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAII+QG+L C G+ +FLK  FG G YL +V K ++IQ +                        D   E  + G +   +  + +HVP+AK++E    +   +LP        +  LF +L+  + DLG+ ++G+SDT LEE+FLKV +D  SG +  GG ++K+  + P    L      G  P+ +++ S       A   E +           + TG  L +Q +  L +KRF +T R+ K F++++VLP   + + + L  +  P  + P + + PW+
Sbjct: 1126 LGDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVNPRHPCLGPREKAGQTPQDSNVCS---PGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWI 1409          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Human
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:HGNC Symbol;Acc:HGNC:29])

HSP 1 Score: 107.071 bits (266), Expect = 1.479e-25
Identity = 89/289 (30.80%), Postives = 137/289 (47.40%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTE----------------SIQWEDFQNELSISGGIAL---------------KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEK-LDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEI----TYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS GKL C GSS+FLK + G GYYL +VK +                 ++ ED  ++ S   G+                   I+ HV +A+++E+   + T VLP        F +LF ++D  + DLGI +YG+S+T+LEE+FLKVA++ SG      +  L   +   A  D  +  RP +     D ++     E R     S +    +Y  + G  L  QQ + L  KR    RR+ K F +++VLP + + + +    I  P    P + + PW+
Sbjct: 1097 LGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE-SGVDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQ-VKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWM 1383          

HSP 2 Score: 50.0618 bits (118), Expect = 2.878e-6
Identity = 39/134 (29.10%), Postives = 63/134 (47.01%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIA-LKFIQNH----VPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPS 390
            L  R+AI+  G+ +C GS   LK  FG+GY +++                I+G    LK +Q+      P + + E+ R+     LP S    S    +F  L ++ + L I  Y +S T+L++VF+  A D S
Sbjct: 2110 LCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVV---------------RIAGSNPDLKPVQDFFGLAFPGSVLKEKHRNMLQYQLPSS---LSSLARIFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQS 2225          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Human
Match: ABCA7 (ATP binding cassette subfamily A member 7 [Source:HGNC Symbol;Acc:HGNC:37])

HSP 1 Score: 102.834 bits (255), Expect = 2.758e-24
Identity = 78/274 (28.47%), Postives = 128/274 (46.72%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGI-------------------ALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKV----ADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISP 756
            L DR+A+++ G+L CCGS +FL++  G+GYYL +VK       + + +  + G +                    L  +Q+ VP A+++EE   +  +VLP +  +   F  LF +LD  + +L +  YG+SDTSLEE+FLKV    A D   E G   +   T   +  L        P    +L +        E  + S    +    + G +L  QQ+  L +KRF   RR+ +   +++VLP L + + +    I  P    P + +SP
Sbjct:  161 LGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVDTRQEKKNGSQGSRVGTPQLLALVQHWVPGARLVEELPHELVLVLPYTGAHDGSFATLFRELDTRLAELRLTGYGISDTSLEEIFLKVVEECAADTDMEDGSCGQHLCT--GIAGLDVTLRLKMPPQETALENGEPAGSAPETDQGSGPDAV--GRVQGWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPALRLSP 430          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Celegans
Match: abt-4 (ABC Transporter family [Source:UniProtKB/TrEMBL;Acc:Q9TXV8])

HSP 1 Score: 82.0333 bits (201), Expect = 1.938e-17
Identity = 46/125 (36.80%), Postives = 73/125 (58.40%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVA 378
            L DRIAI++ G+L+CCGS +FLK+++G+GY+L IV  ++    D      I        I+ ++P+A +      + T +L  S  +   FP LF +L+      GI ++G+S T++EEVFLKV 
Sbjct:  793 LGDRIAIMAHGQLECCGSPMFLKQQYGDGYHLTIVY-DTTSTPDVSKTTDI--------IREYIPEAHVFSYIGQEATYLL--SATHRPIFPKLFKELEDHQTQCGITSFGVSITTMEEVFLKVG 906          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 55.4546 bits (132), Expect = 1.703e-8
Identity = 50/238 (21.01%), Postives = 98/238 (41.18%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENN------------------CSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISE 663
            L D + I+S GKL   G++ +LK++FG GY L +V        D   +      I      ++V +A+  E    Q  I+LP++                      + F ++ + L   +  L + ++GLS  +LE+VF+ + D     +   +  +++    +A         P+   +  D     K  +  +    S+      +G++  + Q I +  K+F Y+RRN     ++
Sbjct:  797 LGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVL-------DHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSRNA-------SEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEKSGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 1020          

HSP 2 Score: 48.1358 bits (113), Expect = 4.054e-6
Identity = 35/129 (27.13%), Postives = 68/129 (52.71%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVL----PQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVA 378
            L  RIA++++G L   GSS  LK  +GN Y + +   E  Q +           + ++ +Q  +P++ +++ T +  T+ L    P+ + +C  +   F+ +    +DLG+  + L+ +SLEE FL++A
Sbjct: 1623 LCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSLYEPNQRD-----------MVVQLVQTRLPNS-VLKTTSTNKTLNLKWQIPKEKEDC--WSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLA 1737          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 55.0694 bits (131), Expect = 2.057e-8
Identity = 50/238 (21.01%), Postives = 98/238 (41.18%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENN------------------CSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISE 663
            L D + I+S GKL   G++ +LK++FG GY L +V        D   +      I      ++V +A+  E    Q  I+LP++                      + F ++ + L   +  L + ++GLS  +LE+VF+ + D     +   +  +++    +A         P+   +  D     K  +  +    S+      +G++  + Q I +  K+F Y+RRN     ++
Sbjct:  743 LGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVL-------DHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSRNA-------SEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEKSGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 966          

HSP 2 Score: 48.1358 bits (113), Expect = 4.465e-6
Identity = 35/129 (27.13%), Postives = 68/129 (52.71%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVL----PQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVA 378
            L  RIA++++G L   GSS  LK  +GN Y + +   E  Q +           + ++ +Q  +P++ +++ T +  T+ L    P+ + +C  +   F+ +    +DLG+  + L+ +SLEE FL++A
Sbjct: 1569 LCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSLYEPNQRD-----------MVVQLVQTRLPNS-VLKTTSTNKTLNLKWQIPKEKEDC--WSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLA 1683          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 55.0694 bits (131), Expect = 2.293e-8
Identity = 50/238 (21.01%), Postives = 98/238 (41.18%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENN------------------CSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISE 663
            L D + I+S GKL   G++ +LK++FG GY L +V        D   +      I      ++V +A+  E    Q  I+LP++                      + F ++ + L   +  L + ++GLS  +LE+VF+ + D     +   +  +++    +A         P+   +  D     K  +  +    S+      +G++  + Q I +  K+F Y+RRN     ++
Sbjct:  730 LGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVL-------DHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSRNA-------SEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEKSGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 953          

HSP 2 Score: 47.7506 bits (112), Expect = 4.971e-6
Identity = 35/129 (27.13%), Postives = 68/129 (52.71%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVL----PQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVA 378
            L  RIA++++G L   GSS  LK  +GN Y + +   E  Q +           + ++ +Q  +P++ +++ T +  T+ L    P+ + +C  +   F+ +    +DLG+  + L+ +SLEE FL++A
Sbjct: 1556 LCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSLYEPNQRD-----------MVVQLVQTRLPNS-VLKTTSTNKTLNLKWQIPKEKEDC--WSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLA 1670          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Celegans
Match: ced-7 (ABC transporter ced-7 [Source:UniProtKB/Swiss-Prot;Acc:P34358])

HSP 1 Score: 55.0694 bits (131), Expect = 2.314e-8
Identity = 50/238 (21.01%), Postives = 98/238 (41.18%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENN------------------CSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISE 663
            L D + I+S GKL   G++ +LK++FG GY L +V        D   +      I      ++V +A+  E    Q  I+LP++                      + F ++ + L   +  L + ++GLS  +LE+VF+ + D     +   +  +++    +A         P+   +  D     K  +  +    S+      +G++  + Q I +  K+F Y+RRN     ++
Sbjct:  730 LGDWVFIMSHGKLVASGTNQYLKQKFGTGYLLTVVL-------DHNGDKRKMAVILTDVCTHYVKEAERGEMHGQQIEIILPEARKKEFVPLFQALEAIQDRNYRSNVFDNMPNTLKSQLATLEMRSFGLSLNTLEQVFITIGDKVDKAIASRQNSRISHNSRNA-------SEPSLKPAGYDTQSSTKSADSYQKLMDSQARGPEKSGVAKMVAQFISIMRKKFLYSRRNWAQLFTQ 953          

HSP 2 Score: 47.7506 bits (112), Expect = 4.882e-6
Identity = 35/129 (27.13%), Postives = 68/129 (52.71%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVL----PQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVA 378
            L  RIA++++G L   GSS  LK  +GN Y + +   E  Q +           + ++ +Q  +P++ +++ T +  T+ L    P+ + +C  +   F+ +    +DLG+  + L+ +SLEE FL++A
Sbjct: 1554 LCSRIAVLNRGSLIAIGSSQELKSLYGNNYTMTLSLYEPNQRD-----------MVVQLVQTRLPNS-VLKTTSTNKTLNLKWQIPKEKEDC--WSAKFEMVQALAKDLGVKDFILAQSSLEETFLRLA 1668          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Fly
Match: CG6052 (gene:FBgn0036747 transcript:FBtr0075195)

HSP 1 Score: 80.8777 bits (198), Expect = 5.643e-17
Identity = 50/134 (37.31%), Postives = 70/134 (52.24%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGG 405
            L DRIAI+S+GKLQC G+S +LKK FG GY L+ +          Q+   +  G   + I+ +VP  K      ++ T  LP   +   KF +L  DLD     L +V YGLS  +LE+VF+ V  D   + G 
Sbjct:  711 LGDRIAILSEGKLQCQGTSFYLKKRFGTGYLLVCI---------MQSGCDV--GAVTQLIRKYVPPIKPERVLGTELTYRLPTEYSK--KFAELLQDLDEKCAQLQLVGYGLSGATLEDVFMAVNTDKRVQGGA 831          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0306679)

HSP 1 Score: 76.2554 bits (186), Expect = 2.038e-15
Identity = 47/139 (33.81%), Postives = 79/139 (56.83%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKK 420
            L DRIAI+  G+L+C G+S FLKK++G+GY LI VK +  +     NE++         +  ++P  K   +  ++ +  LP S +  +KF ++F  L+   ++L +  YG+  TS+EEVF+KV  +     G IK++ 
Sbjct:  733 LGDRIAIMCDGELKCQGTSFFLKKQYGSGYRLICVKRDDCE----TNEVT-------ALLNKYIPGLKPECDIGAELSYQLPDSAS--AKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKD-NTGNIKDQH 857          

HSP 2 Score: 47.3654 bits (111), Expect = 8.579e-6
Identity = 36/145 (24.83%), Postives = 68/145 (46.90%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIAL--------------------KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVA 378
            L  R+AI+  G+ +C GS+  LK +F  G   +I+K +  +  +   +  +SGG A                     +F++   P++ + EE +   T  +P +     K+  +F  ++   + L +  Y +S T+LEE+FL+ A
Sbjct: 1565 LCTRLAIMVNGEFKCIGSTQHLKNKFSKG---LILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTG---VKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1703          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332488)

HSP 1 Score: 76.2554 bits (186), Expect = 2.076e-15
Identity = 50/139 (35.97%), Postives = 79/139 (56.83%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKK 420
            L DRIAI+  G+L+C G+S FLKK++G+GY LI VK +  +     NE++    +  K+I    P+  +  E   Q    LP S +  +KF ++F  L+   ++L +  YG+  TS+EEVF+KV  +     G IK++ 
Sbjct:  711 LGDRIAIMCDGELKCQGTSFFLKKQYGSGYRLICVKRDDCE----TNEVT---ALLNKYIPGLKPECDIGAELSYQ----LPDSAS--AKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKD-NTGNIKDQH 835          

HSP 2 Score: 47.3654 bits (111), Expect = 8.500e-6
Identity = 36/145 (24.83%), Postives = 68/145 (46.90%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIAL--------------------KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVA 378
            L  R+AI+  G+ +C GS+  LK +F  G   +I+K +  +  +   +  +SGG A                     +F++   P++ + EE +   T  +P +     K+  +F  ++   + L +  Y +S T+LEE+FL+ A
Sbjct: 1543 LCTRLAIMVNGEFKCIGSTQHLKNKFSKG---LILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTG---VKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1681          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Fly
Match: ABCA (gene:FBgn0031170 transcript:FBtr0332489)

HSP 1 Score: 76.2554 bits (186), Expect = 2.113e-15
Identity = 47/139 (33.81%), Postives = 79/139 (56.83%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKK 420
            L DRIAI+  G+L+C G+S FLKK++G+GY LI VK +  +     NE++         +  ++P  K   +  ++ +  LP S +  +KF ++F  L+   ++L +  YG+  TS+EEVF+KV  +     G IK++ 
Sbjct:  711 LGDRIAIMCDGELKCQGTSFFLKKQYGSGYRLICVKRDDCE----TNEVT-------ALLNKYIPGLKPECDIGAELSYQLPDSAS--AKFEEMFGQLEEQSDELHLNGYGVGITSMEEVFMKVGAEKD-NTGNIKDQH 835          

HSP 2 Score: 47.3654 bits (111), Expect = 8.647e-6
Identity = 36/145 (24.83%), Postives = 68/145 (46.90%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIAL--------------------KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVA 378
            L  R+AI+  G+ +C GS+  LK +F  G   +I+K +  +  +   +  +SGG A                     +F++   P++ + EE +   T  +P +     K+  +F  ++   + L +  Y +S T+LEE+FL+ A
Sbjct: 1543 LCTRLAIMVNGEFKCIGSTQHLKNKFSKG---LILKIKVRRNLEALRQARLSGGYARNPDEQTVPAQMSQRDIDAVKEFVETEYPNSILQEEYQGILTFYIPLTG---VKWSRIFGLMESNRDQLNVEDYSVSQTTLEEIFLEFA 1681          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Fly
Match: CG1494 (gene:FBgn0031169 transcript:FBtr0332306)

HSP 1 Score: 76.2554 bits (186), Expect = 2.299e-15
Identity = 42/139 (30.22%), Postives = 80/139 (57.55%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKK 420
            ++DR+AI+S G+L+C G+  FLK  +G+GY L  VK ++ +    ++EL          + +++P+  +  +   + T VL     +  +FP L DDL+  M+ LG+V++ + DTS+EE+FL+   + + + G  +  +
Sbjct:  739 IADRMAIMSNGELKCTGTKPFLKNMYGHGYRLTCVKGKNYK----RDEL-------FGMMNSYMPNMSIERDIGYKVTFVLENKFED--QFPMLIDDLEENMQQLGVVSFRIRDTSMEEIFLRFGCEDNDQSGAFQSHE 864          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 121.709 bits (304), Expect = 8.573e-31
Identity = 93/292 (31.85%), Postives = 136/292 (46.58%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTES----------------IQWEDFQNELSISGG-----------------IALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIE------EIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS GKL C GSS+FLK + G GYYL +VK  +                ++ +D  +E S   G                 I  + I  HVP A+M+E+   + T VLP        F +LF DLD  + DLGI +YG+SDT+LEE+FLKVA+D   +   + +  L   +      G +       L+  D  +  + E      E   +S         + G SL  QQ + L  KR  Y RR+ K F +++VLP + + + +    I  P    P + ++PW+
Sbjct: 1099 LGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEMLSDGTLPVRRQRRHAFGADHQSCLKPLTEDDSFDCNESEGDPESKETDYLSGSDGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALNPWM 1390          

HSP 2 Score: 54.6842 bits (130), Expect = 5.258e-8
Identity = 39/125 (31.20%), Postives = 62/125 (49.60%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVA 378
            L  R+AI+  G+ +C GS   LK  FG+G Y II++       D Q          +KFI++ +P + + E+ R+     LP S    +    +F  L +  E L I  Y +S T+L++VF+  A
Sbjct: 2119 LCTRMAIMVNGRFRCLGSVQHLKNRFGDG-YTIILRVAGPD-PDLQP--------VMKFIESELPGSTLKEKHRNMLQYQLPSS---LTSLAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFA 2230          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Zebrafish
Match: abca4b (ATP-binding cassette, sub-family A (ABC1), member 4b [Source:ZFIN;Acc:ZDB-GENE-050517-4])

HSP 1 Score: 121.324 bits (303), Expect = 1.081e-30
Identity = 90/288 (31.25%), Postives = 142/288 (49.31%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWE-----DFQNELSISGGIALKF-----------------------IQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEK--LDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYS-MLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLMMPK 774
            LSDR+AIIS+GKL C GS +FLK  FG G+YL +V+    Q +     D  +E S +     ++                       I +HVP+AK++E    + T +LP        +  LF +L+  + D+G+ ++G+SDTSLEE+FLKV  D     G      +TPE+  L    +G  F +   +      +E A        S  SE   S  + G SL ++Q   L +KRFH+  R+ K F++++VLP   +L+ +    I  P  + P + ++PW+  P+
Sbjct: 1177 LSDRVAIISKGKLHCSGSPLFLKNCFGVGFYLTLVRRMKDQRKKENECDCASECSCTCSTCTRYKEESQALQPERVLDGNVESITTLIHHHVPEAKLIEMIGQEMTYLLPNKGFKYRAYASLFRELEETLGDMGLSSFGISDTSLEEIFLKVTAD-----GEAANSSVTPEQWMLQQRKNGNGFMKDTGL------AEDANGVGASLESDSSEGRASRQVKGFSLVLKQFHALLVKRFHHATRSHKDFLAQIVLPASFVLIALVFTMIVPPFGEYPCLTLTPWMYGPQ 1453          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Zebrafish
Match: abca4b (ATP-binding cassette, sub-family A (ABC1), member 4b [Source:ZFIN;Acc:ZDB-GENE-050517-4])

HSP 1 Score: 117.472 bits (293), Expect = 2.569e-29
Identity = 88/285 (30.88%), Postives = 139/285 (48.77%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWE-----DFQNELSISGGIALKF-----------------------IQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLMMPK 774
            LSDR+AIIS+GKL C GS +FLK  FG G+YL +V+    Q +     D  +E S +     ++                       I +HVP+AK++E    + T +LP        +  LF +L+  + D+G+ ++G+SDTSLEE+FLKV  D  GE        ++    DA   G      AS+ S  D SE     +++              G SL ++Q   L +KRFH+  R+ K F++++VLP   +L+ +    I  P  + P + ++PW+  P+
Sbjct: 1096 LSDRVAIISKGKLHCSGSPLFLKNCFGVGFYLTLVRRMKDQRKKENECDCASECSCTCSTCTRYKEESQALQPERVLDGNVESITTLIHHHVPEAKLIEMIGQEMTYLLPNKGFKYRAYASLFRELEETLGDMGLSSFGISDTSLEEIFLKVTAD--GEAANSSIMCVSGLVTDANGVG------ASLES--DSSEGRASRQVK--------------GFSLVLKQFHALLVKRFHHATRSHKDFLAQIVLPASFVLIALVFTMIVPPFGEYPCLTLTPWMYGPQ 1356          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Zebrafish
Match: abca1b (ATP-binding cassette, sub-family A (ABC1), member 1B [Source:ZFIN;Acc:ZDB-GENE-030131-9826])

HSP 1 Score: 117.472 bits (293), Expect = 2.626e-29
Identity = 93/303 (30.69%), Postives = 136/303 (44.88%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTES----------------IQWEDFQNELSISGG----------------------------IALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIE------EIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS GKL C GSS+FLK + G GYYL +VK  +                ++ +D  +E S   G                            I  + I  HVP A+M+E+   + T VLP        F +LF DLD  + DLGI +YG+SDT+LEE+FLKVA+D   +   + +  L   +      G +       L+  D  +  + E      E   +S         + G SL  QQ + L  KR  Y RR+ K F +++VLP + + + +    I  P    P + ++PW+
Sbjct: 1099 LGDRIAIISHGKLCCVGSSLFLKTQLGTGYYLTLVKKNTEPSLSSCRNSSSTVSFVKKDDNASESSSDAGLGSDQESEAATAIGTSWPESPVVPVDVTIISRLILKHVPAARMVEDQGHEITYVLPYESAKNGAFVELFHDLDDRLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEMLSDGTLPVRRQRRHAFGADHQSCLKPLTEDDSFDCNESEGDPESKETDYLSGSDGKGSYQVKGWSLKRQQFVALLWKRLLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALNPWM 1401          

HSP 2 Score: 54.6842 bits (130), Expect = 4.980e-8
Identity = 39/125 (31.20%), Postives = 62/125 (49.60%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVA 378
            L  R+AI+  G+ +C GS   LK  FG+G Y II++       D Q          +KFI++ +P + + E+ R+     LP S    +    +F  L +  E L I  Y +S T+L++VF+  A
Sbjct: 2130 LCTRMAIMVNGRFRCLGSVQHLKNRFGDG-YTIILRVAGPD-PDLQP--------VMKFIESELPGSTLKEKHRNMLQYQLPSS---LTSLAHIFSILAKNKEFLRIEDYSVSQTTLDQVFVNFA 2241          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Zebrafish
Match: abca4a (ATP-binding cassette, sub-family A (ABC1), member 4a [Source:ZFIN;Acc:ZDB-GENE-050517-3])

HSP 1 Score: 117.087 bits (292), Expect = 3.240e-29
Identity = 87/288 (30.21%), Postives = 130/288 (45.14%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVK-----------------------------------TESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            LSDR+AIISQG+L CCGS +FLK   G G+YL +V+                                   TE  +  + Q E +I    AL  + +HVP+A+++E    + T +LP        +  LF +L+  + D+G+ ++G+SDTSLEEVFLKV  D  GE   I     T                       D+S          V  K       + G  L ++Q   L IKRFH+T R+ K F++++VLP   + + +    I  P  + P + +SPW+
Sbjct: 1144 LSDRVAIISQGRLYCCGSPLFLKNCLGAGFYLTLVRRIKEQPAPVRKEGQCDCTDDCSCKCSLCTKFKASDTEKPRVSERQMEGNIESITAL--VHHHVPEARLIEVIGQELTFLLPSRAFKHRSYASLFRELEETLADMGLSSFGVSDTSLEEVFLKVTAD--GEAAHINTASDT-----------------------DRSHANGQSNSANVISKEGRGSQQVKGFFLVVKQFFALLIKRFHHTTRSGKDFLAQIVLPASFVFISLMFTLIVPPFGEYPSLTLSPWM 1404          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 119.398 bits (298), Expect = 7.080e-30
Identity = 91/279 (32.62%), Postives = 136/279 (48.75%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTES----------IQWEDFQNELSISGGIALKF------------IQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEI----TYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS GKL C GSS+FLK + G GYYL +VK ++               +  +  ++G + L F            I  HVP+A+++E+   + T VLP        F +LF ++D  + DLGI +YG++DT+LEE+FLKVADD   +            K  A  D  +  RP +     D ++     E R   + S I    +Y  L   +L  QQ   L  KR  Y +R+ K F +++VLP + +L+ +    I  P    P + + PW+
Sbjct: 1091 LGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKKFMTGFLLLCFAGLTDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQ-LKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWM 1368          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 119.013 bits (297), Expect = 9.147e-30
Identity = 92/288 (31.94%), Postives = 137/288 (47.57%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTES----------------IQWEDFQNELSISGGIAL---------------KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEI----TYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS GKL C GSS+FLK + G GYYL +VK ++                ++ ED  ++ S   G+                   I  HVP+A+++E+   + T VLP        F +LF ++D  + DLGI +YG++DT+LEE+FLKVADD   +            K  A  D  +  RP +     D ++     E R   + S I    +Y  L   +L  QQ   L  KR  Y +R+ K F +++VLP + +L+ +    I  P    P + + PW+
Sbjct: 1037 LGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQ-LKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWM 1323          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 119.013 bits (297), Expect = 9.766e-30
Identity = 92/288 (31.94%), Postives = 137/288 (47.57%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTES----------------IQWEDFQNELSISGGIAL---------------KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEI----TYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS GKL C GSS+FLK + G GYYL +VK ++                ++ ED  ++ S   G+                   I  HVP+A+++E+   + T VLP        F +LF ++D  + DLGI +YG++DT+LEE+FLKVADD   +            K  A  D  +  RP +     D ++     E R   + S I    +Y  L   +L  QQ   L  KR  Y +R+ K F +++VLP + +L+ +    I  P    P + + PW+
Sbjct: 1063 LGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQ-LKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWM 1349          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 119.013 bits (297), Expect = 1.009e-29
Identity = 92/288 (31.94%), Postives = 137/288 (47.57%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTES----------------IQWEDFQNELSISGGIAL---------------KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEI----TYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS GKL C GSS+FLK + G GYYL +VK ++                ++ ED  ++ S   G+                   I  HVP+A+++E+   + T VLP        F +LF ++D  + DLGI +YG++DT+LEE+FLKVADD   +            K  A  D  +  RP +     D ++     E R   + S I    +Y  L   +L  QQ   L  KR  Y +R+ K F +++VLP + +L+ +    I  P    P + + PW+
Sbjct: 1098 LGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQ-LKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWM 1384          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Xenopus
Match: ABCA1 (ATP binding cassette subfamily A member 1 [Source:NCBI gene;Acc:100491942])

HSP 1 Score: 119.013 bits (297), Expect = 1.029e-29
Identity = 92/288 (31.94%), Postives = 137/288 (47.57%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTES----------------IQWEDFQNELSISGGIAL---------------KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEI----TYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS GKL C GSS+FLK + G GYYL +VK ++                ++ ED  ++ S   G+                   I  HVP+A+++E+   + T VLP        F +LF ++D  + DLGI +YG++DT+LEE+FLKVADD   +            K  A  D  +  RP +     D ++     E R   + S I    +Y  L   +L  QQ   L  KR  Y +R+ K F +++VLP + +L+ +    I  P    P + + PW+
Sbjct: 1096 LGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKRDNDSSLSSCRNSSSTMSYLKKEDSVSQSSSDAGLGSDHESDTMTIDVSAISNLINKHVPEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGIADTTLEEIFLKVADDTGVDAETSDGTLPARRKRYAFGDHQSCLRPFTEDDAFDTNDSDMDPESRETDYLSGIDGKGSYQ-LKSWNLMRQQFTALLWKRLLYAKRSRKGFFAQIVLPAVFVLIALVFSLIVPPFGKYPSLELEPWM 1382          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Mouse
Match: Abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:MGI Symbol;Acc:MGI:2676312])

HSP 1 Score: 116.316 bits (290), Expect = 7.662e-29
Identity = 79/223 (35.43%), Postives = 123/223 (55.16%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIAL-KFIQNHVPDAKMMEETRSQWTIVLPQSENNCS-KFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKL-DALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISE 663
            LSDRIA + QG L+CCGS  +LK+ FG+GY+L + K +S   +      +I   +A+   IQ+H+P+A + E+   +   VLP      S  +  L   LD+ M  L I  YG+SDT++EEVFL +  D S +   +  + LT  K+ +   +G + P   S+ S    S F   ++  +V  +SE     L G  L +++I+ + IKRFH+TRRN K  I++
Sbjct: 1543 LSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKKKSPNLDTN----AICDTVAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDKGMGKLNIGCYGISDTTVEEVFLNLTKD-SQKSSNMSLEHLTQRKVGNPSANGTSTPDDLSVSS----SNFTDRDD--KVLTRSE----KLEGFGLLLKKIMAILIKRFHHTRRNWKGLIAQ 1750          

HSP 2 Score: 55.4546 bits (132), Expect = 2.710e-8
Identity = 36/128 (28.12%), Postives = 59/128 (46.09%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYL-IIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADD 384
            L  R+AI+  G+ QC GS   +K  FG G+ + + +K   +  E              KF+Q H P   + ++  S     +P +    +   ++FD L+     L I  + +S T+LEEVF+  A D
Sbjct: 2455 LCTRLAIMVNGRFQCIGSLQHIKSRFGRGFTVKVHLKNNKVSMETLT-----------KFMQLHFPKTYLKDQHLSMLEYHVPVTAGGVA---NIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2568          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Mouse
Match: Abca4 (ATP-binding cassette, sub-family A (ABC1), member 4 [Source:MGI Symbol;Acc:MGI:109424])

HSP 1 Score: 114.39 bits (285), Expect = 2.676e-28
Identity = 87/293 (29.69%), Postives = 139/293 (47.44%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIV-KTESIQWE------------------------DFQNELSISGGIA--LKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGE---VGGIKEKK----------LTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIISQG+L C G+ +FLK  FG G+YL +V K ++IQ +                        +   E  + G +   +  + +HVP+AK++E    +   +LP        +  LF +L+  + DLG+ ++G+SDT LEE+FLKV +D       VGG ++K+             EKL       +   P  +     K + +   E   V F         TG  L +Q +  L +KRFH+T R+ K F++++VLP   + + + L  I  P  + P + + PW+
Sbjct: 1126 LGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDP--PKGQPSPEPEDPGVPFN--------TGARLILQHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWM 1408          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Mouse
Match: Abca1 (ATP-binding cassette, sub-family A (ABC1), member 1 [Source:MGI Symbol;Acc:MGI:99607])

HSP 1 Score: 106.686 bits (265), Expect = 1.276e-25
Identity = 91/302 (30.13%), Postives = 141/302 (46.69%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTE----------------SIQWEDFQNELSISGGIA---------------LKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDK-------SEFAKIE----EIRRVSFKSEITYSM-------LTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS GKL C GSS+FLK + G GYYL +VK +                 ++ ED  ++ S   G+                   I+ HV +A+++E+   + T VLP        F +LF ++D  + DLGI +YG+S+T+LEE+FLKVA++ SG              +DA T  G  P   +  +  DK       +E   ++    +I   S ++++   M       L G  L  QQ + L  KR    RR+ K F +++VLP + + + +    I  P    P + + PW+
Sbjct: 1097 LGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSCLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE-SG--------------VDAETSDGTLPARRNRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWM 1383          

HSP 2 Score: 49.2914 bits (116), Expect = 3.077e-6
Identity = 35/130 (26.92%), Postives = 64/130 (49.23%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLII-VKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPS 390
            L  R+AI+  G+ +C GS   LK  FG+GY +++ +   +   +  Q           +F     P + + E+ R+     LP S ++ ++   +F  L ++ + L I  Y +S T+L++VF+  A D S
Sbjct: 2110 LCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTIVVRIAGSNPDLKPVQ-----------EFFGLAFPGSVLKEKHRNMLQYQLPSSLSSLAR---IFSILSQSKKRLHIEDYSVSQTTLDQVFVNFAKDQS 2225          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Mouse
Match: Abca16 (ATP-binding cassette, sub-family A (ABC1), member 16 [Source:MGI Symbol;Acc:MGI:2388711])

HSP 1 Score: 103.219 bits (256), Expect = 1.973e-24
Identity = 72/217 (33.18%), Postives = 109/217 (50.23%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVAD--DPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMK 648
            L DR+AI+ +G L CCGSSVFLK+ +G GY++++   E  Q+ D  N +++        IQ HVP A +     ++ + +LP+     S+F  LF +L+   + LGI ++G S T++EEVF+KV     P   +  I+   L   K+    +  N   P +      K  F  + EI  V F         TG+ L+ QQ   L IKR  +  RN K
Sbjct:  709 LGDRVAIMVRGTLHCCGSSVFLKQIYGAGYHIVM---EKQQYCDVDNIIAM--------IQQHVPGAVLENNIENELSFILPKKY--VSRFETLFTELEMRQKALGIASFGASITTMEEVFVKVNKLATPQKSIQTIQPYYLAYRKMRQ-DEQQNVNMPIN----YSKPNFPYLSEIATVKFN--------TGVPLYRQQFYSLFIKRALFISRNWK 899          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Mouse
Match: Abca7 (ATP-binding cassette, sub-family A (ABC1), member 7 [Source:MGI Symbol;Acc:MGI:1351646])

HSP 1 Score: 103.219 bits (256), Expect = 2.028e-24
Identity = 84/301 (27.91%), Postives = 137/301 (45.51%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKT-------------ESIQWE-------------------DFQNELSISGGIA--------LKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKE----KKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLMMPK 774
            L DR+A+++ G L CCGS +FL++  G GYYL +VK+             E  + E                   D  N+    G +         L+ +Q HVP A+++E+   +  +VLP +      F  +F +LD+ +E LG+  YG+SDT+LEE+FLKV +D   E G  +     +  TP+           P      S+ +  E AK+    +         + + G +L  QQ+  L  KRF   RR+ +   +++VLP L + + +    I  P    PP+ +SP +  P+
Sbjct: 1001 LGDRVAMVAGGSLCCCGSPLFLRRHLGCGYYLTLVKSSQSLVTHDAKGDSEDPRREKKSDGNGRTSDTAFTRGTSDKSNQAPAPGAVPITPSTARILELVQQHVPGAQLVEDLPHELLLVLPYAGALDGSFAMVFQELDQQLELLGLTGYGISDTNLEEIFLKVVEDAHREGGDSRPQLHLRTCTPQ-----------PPTGPEASVLENGELAKLVLDPQAPQGLAPNAAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQVVLPALFVGLALFFSLIVPPFGQYPPLQLSPAMYGPQ 1290          
BLAST of ATP-binding cassette sub-family A member vs. UniProt/SwissProt
Match: sp|Q86UK0|ABCAC_HUMAN (ATP-binding cassette sub-family A member 12 OS=Homo sapiens OX=9606 GN=ABCA12 PE=1 SV=3)

HSP 1 Score: 114.775 bits (286), Expect = 1.576e-27
Identity = 77/223 (34.53%), Postives = 124/223 (55.61%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIAL-KFIQNHVPDAKMMEETRSQWTIVLPQSENNCS-KFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKL-DALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISE 663
            LSDRIA + QG L+CCGS  +LK+ FG+GY+L + K +S       N  ++   +A+   IQ+H+P+A + E+   +   VLP      S  +  L   LD  M DL I  YG+SDT++EEVFL +  + S +   +  + LT +K+ ++  +G + P   S+ S    S F   ++  ++  + E     L G  L +++I+ + IKRFH+TRRN K  I++
Sbjct: 1543 LSDRIAFLEQGGLRCCGSPFYLKEAFGDGYHLTLTKKKSPNL----NANAVCDTMAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGAYLSLLRALDNGMGDLNIGCYGISDTTVEEVFLNLTKE-SQKNSAMSLEHLTQKKIGNSNANGISTPDDLSVSS----SNFTDRDD--KILTRGE----RLDGFGLLLKKIMAILIKRFHHTRRNWKGLIAQ 1750          

HSP 2 Score: 56.6102 bits (135), Expect = 1.009e-7
Identity = 37/128 (28.91%), Postives = 59/128 (46.09%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYL-IIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADD 384
            L  R+AI+  GK QC GS   +K  FG G+ + + +K   +  E              KF+Q H P   + ++  S     +P +    +   ++FD L+     L I  + +S T+LEEVF+  A D
Sbjct: 2455 LCTRLAIMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTMETLT-----------KFMQLHFPKTYLKDQHLSMLEYHVPVTAGGVA---NIFDLLETNKTALNITNFLVSQTTLEEVFINFAKD 2568          
BLAST of ATP-binding cassette sub-family A member vs. UniProt/SwissProt
Match: sp|O35600|ABCA4_MOUSE (Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=2 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.872e-27
Identity = 87/293 (29.69%), Postives = 139/293 (47.44%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIV-KTESIQWE------------------------DFQNELSISGGIA--LKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGE---VGGIKEKK----------LTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIISQG+L C G+ +FLK  FG G+YL +V K ++IQ +                        +   E  + G +   +  + +HVP+AK++E    +   +LP        +  LF +L+  + DLG+ ++G+SDT LEE+FLKV +D       VGG ++K+             EKL       +   P  +     K + +   E   V F         TG  L +Q +  L +KRFH+T R+ K F++++VLP   + + + L  I  P  + P + + PW+
Sbjct: 1126 LGDRIAIISQGRLYCSGTPLFLKNCFGTGFYLTLVRKMKNIQSQRGGCEGVCSCTSKGFSTRCPTRVDEITEEQVLDGDVQELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDAGAGSMFVGGAQQKREQAGLRHPCSAPTEKLRQYAQAPHTCSPGQVDP--PKGQPSPEPEDPGVPFN--------TGARLILQHVQALLVKRFHHTIRSRKDFVAQIVLPATFVFLALMLSIIVPPFGEFPALTLHPWM 1408          
BLAST of ATP-binding cassette sub-family A member vs. UniProt/SwissProt
Match: sp|Q7TNJ2|ABCA7_RAT (ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus OX=10116 GN=Abca7 PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.017e-26
Identity = 84/299 (28.09%), Postives = 139/299 (46.49%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKT-ESIQWEDFQNE---------------------------------------LSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADD--PSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLMMPK 774
            L DR+A+++ G L CCGS +FL++  G GYYL +VK+ +S+   D + +                                       ++ S  + L+ +Q HVP A+++EE   +  + LP +      F  +F +LD+ +E LG+  YG+SDT+LEE+FLKV ++    GE G        P +   L      P      S+ +  E AK+    +    S  T + + G +L  QQ+  L  KRF   RR+ +   +++VLP L + + +    I  P    PP+ +SP +  P+
Sbjct: 1002 LGDRVAMVASGSLCCCGSPLFLRRHLGCGYYLTLVKSSQSLVTHDLKGDTEDPRREKKSGSEGKTADTVLTRDGPHRSSQVPAPDAVPVTPSAALILELVQRHVPGAQLVEELPHELVLALPYAGALDGSFATVFQELDQQLERLGLTGYGISDTNLEEIFLKVVEEAHAHGEGG-------DPRQQQHLLTATPQPHTGPEASVLENGELAKLVLDPQAPKGSAPTTAQVQGWTLTCQQLRALLHKRFLLARRSRRGLFAQIVLPALFVGLALFFTLIVPPFGQYPPLQLSPAMYGPQ 1293          
BLAST of ATP-binding cassette sub-family A member vs. UniProt/SwissProt
Match: sp|P78363|ABCA4_HUMAN (Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Homo sapiens OX=9606 GN=ABCA4 PE=1 SV=3)

HSP 1 Score: 111.694 bits (278), Expect = 2.090e-26
Identity = 85/287 (29.62%), Postives = 141/287 (49.13%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIV-KTESIQWE------------------------DFQNELSISGGI--ALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDP-SGEV--GGIKEKK--LTPEK--LDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAII+QG+L C G+ +FLK  FG G YL +V K ++IQ +                        D   E  + G +   +  + +HVP+AK++E    +   +LP        +  LF +L+  + DLG+ ++G+SDT LEE+FLKV +D  SG +  GG ++K+  + P    L      G  P+ +++ S       A   E +           + TG  L +Q +  L +KRF +T R+ K F++++VLP   + + + L  +  P  + P + + PW+
Sbjct: 1126 LGDRIAIIAQGRLYCSGTPLFLKNCFGTGLYLTLVRKMKNIQSQRKGSEGTCSCSSKGFSTTCPAHVDDLTPEQVLDGDVNELMDVVLHHVPEAKLVECIGQELIFLLPNKNFKHRAYASLFRELEETLADLGLSSFGISDTPLEEIFLKVTEDSDSGPLFAGGAQQKRENVNPRHPCLGPREKAGQTPQDSNVCS---PGAPAAHPEGQPPPEPECPGPQLNTGTQLVLQHVQALLVKRFQHTIRSHKDFLAQIVLPATFVFLALMLSIVIPPFGEYPALTLHPWI 1409          
BLAST of ATP-binding cassette sub-family A member vs. UniProt/SwissProt
Match: sp|O95477|ABCA1_HUMAN (Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3)

HSP 1 Score: 107.071 bits (266), Expect = 7.103e-25
Identity = 89/289 (30.80%), Postives = 137/289 (47.40%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTE----------------SIQWEDFQNELSISGGIAL---------------KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEK-LDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEI----TYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS GKL C GSS+FLK + G GYYL +VK +                 ++ ED  ++ S   G+                   I+ HV +A+++E+   + T VLP        F +LF ++D  + DLGI +YG+S+T+LEE+FLKVA++ SG      +  L   +   A  D  +  RP +     D ++     E R     S +    +Y  + G  L  QQ + L  KR    RR+ K F +++VLP + + + +    I  P    P + + PW+
Sbjct: 1097 LGDRIAIISHGKLCCVGSSLFLKNQLGTGYYLTLVKKDVESSLSSCRNSSSTVSYLKKEDSVSQSSSDAGLGSDHESDTLTIDVSAISNLIRKHVSEARLVEDIGHELTYVLPYEAAKEGAFVELFHEIDDRLSDLGISSYGISETTLEEIFLKVAEE-SGVDAETSDGTLPARRNRRAFGDKQSCLRPFTEDDAADPNDSDIDPESRETDLLSGMDGKGSYQ-VKGWKLTQQQFVALLWKRLLIARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWM 1383          
BLAST of ATP-binding cassette sub-family A member vs. TrEMBL
Match: N1PB02 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226736 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 5.904e-39
Identity = 105/281 (37.37%), Postives = 146/281 (51.96%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTE----SIQWEDFQNELSISGGIA-----LKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEE---------------IRRVSFKSEITYSM-LTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLMMP 771
            L DRIAII+QGKL C GSS+FLK  FG GYYL +VK E    S    D + E +   G A       FI   VP+A ++E    + T  LP  +++ + F  LF DLD  +  LG+++YG+SDT+LEEVFLKVA++ S E   + E+ +  +  + LTDGG + RP + LS R ++ FA  +                +   S     T S  +TG+SL  +Q + + IKRF+Y RR+ K+FIS+                        P M I PWLM P
Sbjct: 1092 LGDRIAIINQGKLCCVGSSLFLKSNFGGGYYLTLVKDERKGDSASTSDVKVENATEDGNAGEISTTAFIMERVPEAVLVESIGIEMTYQLPNDKSHTASFEKLFRDLDAHLSSLGLLSYGVSDTTLEEVFLKVANE-SEEANHLSEEDVR-QGTERLTDGGMYARPVTRLSFRKRNFFASKDRESNELLDADGNPDSAVSTASISCNGTGSYKVTGLSLIPRQFLAIFIKRFNYLRRSKKAFISQE-----------------------PAMEIHPWLMSP 1347          
BLAST of ATP-binding cassette sub-family A member vs. TrEMBL
Match: A0A3P8NFP8 (Uncharacterized protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.840e-37
Identity = 107/308 (34.74%), Postives = 157/308 (50.97%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVK-------------------------------------TESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPA---SILSLRDKSE---------FAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLM-MPKT 777
            L DRIAIIS GK++CCGSS+FLKK FG+GYYL +V+                                     ++S    D    LS  G    + +Q HVP+A  +E    + T +LP        F  LF +LDRAM DLG+ +YG+SDT+LEE+FLKVA+D      G+ +  + P K   + D     R A   SI S+  K+E          +K+E+IR+    S    +++TG  L  QQ + L IKRFH+ RR+ K  I+++VLP   + + +    I  P ++ PP+ + PW+  +P+T
Sbjct: 1089 LGDRIAIISHGKMRCCGSSIFLKKCFGSGYYLTLVRDGSGKMTAQRNGIISQAKGGKKETDCPLSSSPDEGFGSQSWSNSDPSANLSAVG----QLVQRHVPEAIFLESIGQEITYILPYGGAKDGTFGTLFRELDRAMADLGLTSYGISDTTLEEIFLKVAEDT-----GV-DADIQPTKELFVRDSKRRSREAKRNSIASVHSKTEQTTGKSEKFTSKVEDIRKSPSDSGRGSAVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAFFVCLSLIFSLIVPPFTEFPPLELQPWMYGLPQT 1386          
BLAST of ATP-binding cassette sub-family A member vs. TrEMBL
Match: A0A4U5VYY4 (ATP-binding cassette sub-family A member 1 OS=Collichthys lucidus OX=240159 GN=D9C73_027198 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 3.089e-36
Identity = 93/261 (35.63%), Postives = 146/261 (55.94%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIAL--KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLM-MPKT 777
            L DRIAIIS GK++CCGSS+FLKK FG+GYYL +V+ E I+    Q    I   +    + ++ HVP+A  +E    + T +LP +      F  LF +LD AM DLG+ +YG+SDT+LEE+FLKVA+D +G    + + K T                            +K+E++++ +  S    +++TG  L  +Q + L IKRFHY RR+ K  I+++VLP + + + +    I  P ++ P + + PW+  +P+T
Sbjct: 1120 LGDRIAIISHGKMRCCGSSIFLKKCFGSGYYLTLVR-EGIEKMTAQRNGIIHADLTAVGQLVRRHVPEAAFLESIGQEITYILPYTGARDGTFALLFQELDLAMADLGLTSYGISDTTLEEIFLKVAED-TGVDAEMNKLKFT----------------------------SKVEDLKKNASVSGKGSTVITGWKLIRRQFLALFIKRFHYARRSRKGLIAQVVLPAVFVCLSLIFSLIVPPFTEYPNLELQPWMYGLPQT 1350          
BLAST of ATP-binding cassette sub-family A member vs. TrEMBL
Match: A0A0P4ZVF7 (ATP-binding cassette sub-family A member OS=Daphnia magna OX=35525 GN=APZ42_019391 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 3.266e-35
Identity = 98/269 (36.43%), Postives = 148/269 (55.02%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESI---------QWEDFQ---NELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSE----NNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIISQG+L+CCGSS+FLK++ G+GYYL +V+ +           Q  + Q   N + I     +  ++ H+P+A ++E   S     LP+ +       +KFP LFD+LD  ME L + +YG+SDT+LEE+FL+VADDPS +                     NFP P S+  L D++ + + E     SF  E +   L G  L  QQ+  + IKRF+ ++RN+K F  E+VLP +++++           +  PP+V+SPWL
Sbjct: 1030 LGDRIAIISQGQLKCCGSSLFLKQKLGSGYYLTVVRKDDTSHDGPINNGQANENQVPRNAMEIDTERIVTLVKRHIPNATIVENVGSDIVFCLPEFDEAGLRQRNKFPHLFDELDLNMEQLRVDSYGVSDTTLEEIFLRVADDPSAD--------------------SNFP-PPSVSDLGDENPYRE-ENGGSDSFNLE-SNEKLKGKKLVAQQMKAMYIKRFNNSKRNVKGFFCEIVLPCILVIIGELFSLTLDLETPQPPLVLSPWL 1275          
BLAST of ATP-binding cassette sub-family A member vs. TrEMBL
Match: A0A482DHK7 (ATP-binding cassette sub-family A member 1 isoform X2 OS=Daphnia magna OX=35525 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 4.552e-35
Identity = 99/272 (36.40%), Postives = 149/272 (54.78%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIA-----------LKFIQNHVPDAKMMEETRSQWTIVLPQSEN----NCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDK----SEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIISQG+L+CCGSS+FLK++ G+GYYL +VK +  Q     N  +    ++           +  ++ H+ +  ++E   S     LP+ ++       KFP LFD+LD  ME L + +YG+SDT+LEE+FLKVA+DPS      +E   TP + D +T  G+ P   S+  +  +     E  +IE        + ++   LTG  L  QQ I L +KRF  ++RN+K F  E+VLP L+I++        S +S  P + +SPWL
Sbjct: 1100 LGDRIAIISQGQLKCCGSSLFLKQKLGSGYYLTVVKKDG-QSASVDNAQATENPVSQNSTETDVERIVNVVKRHIQNGSVVENVGSDIVFCLPEFDDAGLRQRDKFPHLFDELDLNMEQLRVDSYGVSDTTLEEIFLKVANDPS------EENVTTPLETDQVT-SGDLPVLKSLQKIGTRECVYEEVPQIEGNDTSDTFNLLSSEKLTGSVLICQQFIALYVKRFCNSKRNLKGFFCEIVLPALLIIINQLTTMSLSAISPEPSIELSPWL 1363          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Cavefish
Match: zgc:172302 (zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5])

HSP 1 Score: 122.479 bits (306), Expect = 4.507e-31
Identity = 91/255 (35.69%), Postives = 135/255 (52.94%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFP--RPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIISQGKL CCGSS+FLK   G GYYL  VK E       +   S SG   +   Q++V  A+++E+   +  I LP + +          +LD+   + GI++YGLSDT+LEE+FLKVA++    V    ++  TP  +   +  G  P  R A + + +    + + +E   +S     + S LTG  L  QQ+  L  KR  Y  R+ K FI+++VLP L IL+ +    I  P+   P + + PW+
Sbjct: 1002 LGDRIAIISQGKLCCCGSSLFLKSHLGTGYYLTAVKKEL----QSRTPTSASGNGLVALAQHYVSGARLVEDVGREVVINLPHAASEDGTLALFLAELDKRQAEFGIISYGLSDTTLEEIFLKVAEETG--VDAEPDEAATPPAVSP-SQQGEPPEDRDAVLFNQQVSLLYTEAQETDPLSGDGRGSVS-LTGWGLTWQQLRALFTKRLLYATRSRKGFIAQIVLPALFILIDLLFSLIVPPMGKYPALELQPWM 1248          

HSP 2 Score: 50.0618 bits (118), Expect = 1.358e-6
Identity = 35/120 (29.17%), Postives = 57/120 (47.50%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEV 363
            L  R+AI+  G+ QC GS   LK  FG+GY +I+  +   +     +   +       +I+N      + E   +     LP   N+CS    +FD L    E+LG+  Y +S T+L++V
Sbjct: 1961 LCTRMAIMVNGRFQCLGSVQHLKNRFGDGYTIILRLSAPPK-----DPCPVDA-----YIKNSFTGIVLKERHHNVLQYQLP--SNSCS-LARVFDVLSNNYEELGVTDYSISQTTLDQV 2067          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Cavefish
Match: ENSAMXT00000016919.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:9912642:9956080:1 gene:ENSAMXG00000016432.2 transcript:ENSAMXT00000016919.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.324 bits (303), Expect = 9.726e-31
Identity = 93/292 (31.85%), Postives = 139/292 (47.60%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTES----------------IQWEDFQNELSISGGIALK----------------FIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIE---EIRRVSFKS----EITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS GKL C GSS+FLK   G GYYL +VK E                 ++ +D  +E S   G+                    I  HVP+A+M+E+   + T +LP        F +LF D+D  + DLGI +YG+SDT+LEE+FLKVA+D   +   + +      +      G +       L+  D+ +  + E   E R   + S    + +Y  + G SL  QQ + L  KRF Y RR+ K F +++VLP + + + +    I  P    P + + PW+
Sbjct:  992 LGDRIAIISHGKLCCVGSSLFLKTHLGTGYYLTLVKKEPEASLSSCRNSSSTVSYVKKDDEASESSSDAGLGSDHESDAATAIDISLISGLIIKHVPNARMVEDLGHEITYILPYESAKDGAFVELFHDMDDHLADLGISSYGVSDTTLEEIFLKVAEDSGVDTEILSDGTFPIRRRRRHAFGADHQSCLKPLTEDDRYDGNESEVDPESRETDYLSGSDGKGSYQ-IQGWSLKRQQFLALLWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLALQPWM 1282          

HSP 2 Score: 57.3806 bits (137), Expect = 4.950e-9
Identity = 41/129 (31.78%), Postives = 64/129 (49.61%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPS 390
            L  R+AI+  G+ +C GS   LK  FG+G Y II++       D Q          +KFI++ +P + + E+ R+     LP S    S    +F  L +  + L I  Y +S T+L++VF+  A D S
Sbjct: 2005 LCTRMAIMVNGRFRCLGSVQHLKNRFGDG-YTIILRVAGPD-PDLQP--------VMKFIESELPGSTLKEKHRNMLQYQLPSS---VSSLAHIFSILAKHKDFLRIEDYSVSQTTLDQVFVNFAKDQS 2120          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 118.627 bits (296), Expect = 8.569e-30
Identity = 83/286 (29.02%), Postives = 137/286 (47.90%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVK--------TESIQWEDFQNELSISGGIALKF-------------------------IQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            LSDR+AIISQG+L CCGS +FLK   G G+YL +V+        T      D +++ S    I  ++                         + +HVP+A+++E    + T +LP        +  LF +L+  + D+G+ ++G+SDTSLEE+FLKV  D    +G     K       A  +G    +P +  S   + + ++                 + G+SL ++Q + L IKRFH+T R+ K F +++VLP   +L+ +    I  P  + P + +SPW+
Sbjct: 1176 LSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGQTKSAGRQMDGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEIFLKVTADGETSLGKSAADK------KACANG----QPTAGGSSSGEGQGSR----------------QVKGVSLVVKQFLALLIKRFHHTTRSGKDFFAQIVLPASFVLVSLMFTLIVPPFGEYPSLTLSPWI 1435          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Cavefish
Match: abca4a (retinal-specific ATP-binding cassette transporter-like [Source:NCBI gene;Acc:103024609])

HSP 1 Score: 118.242 bits (295), Expect = 1.048e-29
Identity = 87/299 (29.10%), Postives = 142/299 (47.49%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVK--------TESIQWEDFQNELSISGGIALKF-------------------------IQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEI--RRVSFKSEIT-----------YSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            LSDR+AIISQG+L CCGS +FLK   G G+YL +V+        T      D +++ S    I  ++                         + +HVP+A+++E    + T +LP        +  LF +L+  + D+G+ ++G+SDTSLEE+FLKV  D    +G       +   L AL +       +S+   RD +     EE   ++     + T              + G+SL ++Q + L IKRFH+T R+ K F +++VLP   +L+ +    I  P  + P + +SPW+
Sbjct: 1176 LSDRVAIISQGRLHCCGSPLFLKSMLGAGFYLTLVRRMKDDTPPTRKEGQCDCKDDCSCKCSICTEYKESTCGQTKSAGRQMDGDVETITNLVHHHVPEARLVEAVGQELTFLLPSRGFKHRAYASLFRELEETLADIGLSSFGVSDTSLEEIFLKVTADGETSLGK------SAADLRALQETSR----SSV--FRDTTVTVNTEEPEDKKACANGQPTAGGSSSGEGQGSRQVKGVSLVVKQFLALLIKRFHHTTRSGKDFFAQIVLPASFVLVSLMFTLIVPPFGEYPSLTLSPWI 1462          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Cavefish
Match: ENSAMXT00000022236.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:13397857:13560117:1 gene:ENSAMXG00000021540.2 transcript:ENSAMXT00000022236.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 2.383e-28
Identity = 87/274 (31.75%), Postives = 136/274 (49.64%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKT--------ESIQWEDFQNELSISGGIAL-------KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALT-DGGNFPRPASILSL-----RDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS G++ CCGSS+FLKK +G+GYYL +V+            Q +DF  +  I G  +L         ++ HVP+A  +E    +   +LP + +    F  LF +LD   E LGI +YG+SDTSLEEV           +       L+ +  D L  D     R +   S+     + + E +K ++ R+    +    S+++G  L   Q + L IKRFH+ RR+ K  I+++VLP   + + +    I  P  + P + + PW+
Sbjct:  858 LGDRIAIISHGRVCCCGSSLFLKKTYGSGYYLTLVQANQERGARKHQSQCDDFSLDEGI-GSSSLSNVADLSALVRRHVPEAVFLEVLGQELVYILPYTGSKDGSFASLFKELDLEKERLGISSYGISDTSLEEVH---------TLAQTHTHTLSIQYKDTLVRDWKRSSRESRTHSISSAMEQKEKESSKCDDQRQSVCLNGKGSSVMSGWPLIRHQFLALFIKRFHHARRSRKGIIAQVVLPAFFVCLSLIFSLIVPPFVEYPSLELQPWM 1121          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002495.1 (pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene:ENSPMAG00000002218.1 transcript:ENSPMAT00000002495.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.346 bits (342), Expect = 1.041e-36
Identity = 92/278 (33.09%), Postives = 143/278 (51.44%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVK--------------TESIQWEDFQNELSISGGIAL-------KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPE--KLDAL--TDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS G+L+CCGSS+FLK  FG GYYL +VK                S   E F ++ S    IA        + +Q HVPDA+++E    + T +LP        F  LF +LD  + +LG+ +YG+SDT+LEE+FLKVA++P+         KL+    K   L     G   +  S    +  +E  ++E++  +  K       ++G+ L + Q   L IKRFH+ RR+ K F+++++LP + + + +    I  P    P + + PW+
Sbjct:  560 LGDRIAIISHGRLRCCGSSLFLKNAFGAGYYLTMVKRSGSGGSNSSCLAGLASSSDEGFGSDESNPDSIAANHVSSVTRLLQQHVPDARLIENFGQELTYLLPSHGAKDGTFALLFKELDEKLAELGVSSYGVSDTTLEEIFLKVAEEPAANSHFTNGVKLSARNSKYTYLQPVHAGCICKNYSTCK-KAPAELGELEKLNELDGKGT---QQISGVQLILLQFKALFIKRFHHARRSRKGFVAQIILPAVFVCLALVFSLIIPPFGKYPMLQLQPWM 833          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Sea Lamprey
Match: abca12 (ATP-binding cassette, sub-family A (ABC1), member 12 [Source:ZFIN;Acc:ZDB-GENE-030131-9790])

HSP 1 Score: 62.7734 bits (151), Expect = 1.724e-11
Identity = 65/273 (23.81%), Postives = 107/273 (39.19%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIAL------------KFIQNHVPDAKMME------ETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFL---KVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPA--SILSLRDKSEFAKIEEIRRVSFKSE-----------------------------------ITYSMLTGISLFIQQIIGLQIKRFHYTRRNMK 648
            LSDRIA++  GKL+CCGS  +LK+ +G G  L + K   +        L +S  + L              +++ V  A +           +    +LP    N          L+  ME+LG+  Y +SDT+LEEV L   +V  +P+        +  TP    +L        P   S   L  ++E  ++++I   S ++E                                   +    +TGI L +++   L  KRFH+ RR++K
Sbjct:  580 LSDRIAVLEHGKLRCCGSPQYLKEIYGQGLTLTLTKKVRV--------LCLSQSVTLGSRPPFDPERVVSLVRSGVAGAALKSGEDSSGNRNADMVFLLPAHSQNVLG-QSFLVTLEENMEELGLSGYAISDTTLEEVCLRQQRVMSEPALGCSA-SARYFTPTSAASLLTKATQCGPGLYSCSQLVQEAEDQRLKDITNKSPEAESGSINSETAAPPDHTSPAASSILCLSSLWRTEKHLVKKERVTGIHLLVRKTQALIYKRFHHWRRDVK 842          

HSP 2 Score: 60.4622 bits (145), Expect = 9.147e-11
Identity = 39/130 (30.00%), Postives = 65/130 (50.00%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIA-----LKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVA 378
            L D++AI+  G+ +C G+   LK  FGNG+ +               +L +S G +      +FI +H P A + E+  SQ    +P   +N  K  ++F  L++  E L I  Y +S T+L++VF+  A
Sbjct: 1650 LCDKLAIMVNGQFKCLGTLQHLKNRFGNGHMI---------------KLRLSSGNSKVTEVTEFITSHFPGAYLKEQHISQLEFQVP---SNAGKLSEIFIALEKEKESLSIQHYSISQTTLDQVFINFA 1761          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006855.1 (pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene:ENSPMAG00000006189.1 transcript:ENSPMAT00000006855.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 1.243e-7
Identity = 35/132 (26.52%), Postives = 60/132 (45.45%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLE---EVFLKVADDPS 390
            L  R+AI+  G  +C GS   LK  FG+GY + I    ++  ++            L+F     PDA + E      T V  Q ++       +F  +++ ++ LG+  Y +S T+L+   +VF+  A   S
Sbjct:  189 LCTRLAIMVNGHFKCLGSIQHLKNRFGDGYMITIRTRSTLHVKE-----------VLRFFSRSFPDAVLKER---HHTKVQYQLKSETLSLAAVFTKMEQVLDVLGVEDYSVSQTTLDNDPQVFVNFAKKQS 306          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010397.1 (pep scaffold:Pmarinus_7.0:GL480213:155963:163950:1 gene:ENSPMAG00000009413.1 transcript:ENSPMAT00000010397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 1.470e-7
Identity = 35/126 (27.78%), Postives = 62/126 (49.21%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLII-VKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVA 378
            L  RIAI+  G+ +C GS   LK  +G+GY L+  ++ E    + F++           F++   P + + ++   Q  +    ++ N S +  +F  L++A  D  +  Y +S  SLE+VFL  A
Sbjct:  181 LCTRIAIMVNGQFRCLGSQQHLKSRYGSGYTLLARIRAEQADTQPFKH-----------FVETTFPGSILKDQ--HQGLVHYHLTDMNMS-WAQVFGMLEKAKRDYCLDDYSISQISLEQVFLGFA 292          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006988.1 (pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-1 gene:ENSPMAG00000006318.1 transcript:ENSPMAT00000006988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.595 bits (109), Expect = 3.250e-6
Identity = 19/35 (54.29%), Postives = 28/35 (80.00%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIV 108
            L+D  A++SQG+L+C GSS+FLK +FG GY L ++
Sbjct:  648 LADWKAVLSQGRLKCAGSSLFLKTKFGVGYRLTLI 682          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Nematostella
Match: EDO46878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNL9])

HSP 1 Score: 135.576 bits (340), Expect = 3.730e-36
Identity = 86/254 (33.86%), Postives = 130/254 (51.18%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKT------ESIQWED-------------------------FQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGN---FPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISE 663
            L DRIAIISQGKLQCCG+S+FLK  +GNGYYL + K       +S+   +                         + NE S++      FI++H+P A ++E   ++ T VLP       KF D+F++LDR +  L + +YG+SDT+LEEVFLKVA++   E  G   +   P +    T   +     +P +    ++ S    +E   R S           G++L ++Q   L +KRFH+ RRN K+FI++
Sbjct:  568 LGDRIAIISQGKLQCCGTSLFLKSHYGNGYYLTLTKKTPGLGLDSVDASERDSLGSRSSDSDPISDSVLGDYSDVYCNEKSVT-----SFIKSHIPSASLVEHVGTELTYVLPSHAAKEGKFQDMFEELDRNLHKLHVGSYGVSDTTLEEVFLKVAEEAQSEEAGTSAE--VPVRRSTFTFSSHPVKCLQPPAQGDSKNDSVDGSLEFDDRES-----------GLALLLRQFFALLVKRFHHCRRNRKAFIAQ 803          

HSP 2 Score: 46.9802 bits (110), Expect = 4.357e-6
Identity = 34/128 (26.56%), Postives = 62/128 (48.44%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLII-VKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADD 384
            L +R+AI+  G+++C GS   LK +FG+GY +I+ V   +   E              +FI    P+A + ++  +     +P    + S+   LF  L+   +   I  Y ++ T+L++VF+  A D
Sbjct: 1523 LCNRVAIMVNGQMKCLGSPQHLKNKFGDGYTVILRVAGSNPDTEQ-----------VCQFIIQCFPNAVLKDKHHNMVEYQIPCQGLSVSR---LFGHLEANRKMFDIEDYSVTQTTLDQVFINFAKD 1636          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Nematostella
Match: EDO38879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBQ0])

HSP 1 Score: 99.7525 bits (247), Expect = 8.979e-24
Identity = 81/272 (29.78%), Postives = 115/272 (42.28%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALK-----------FIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKV---------------------------ADDPSGEVGGIKEKKLTP--------EKLDALTDGGNFP------RPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISE 663
            L DRIAIIS GKL+C GS ++LK+ FG GY L +VK               S    L+           FI +H+  A++  +T  ++T +LP +      F  LF DL++ ++ LGI +YG++ T LEEVFLKV                           AD P G +G +      P        E  D + + G         +P S       + + +            +    LTG +L  QQ   L +KRFHY RRN K  IS+
Sbjct:  800 LGDRIAIISSGKLRCVGSPLYLKRRFGEGYNLTLVKKSISSPHGSIGSFRRSTSSNLEASRRSEEKLTSFITSHISSAQLKHKTNQEFTFILPDNSIKRGAFKKLFADLEQNIDVLGIDSYGITHTLLEEVFLKVTDVSLNETGNMPHHRQDKLPTQLLQFPADKP-GHLGHVLLSPPLPTLPTNEGLEMSDVVRNRGEDTERLLGYQPLSDSGTHQGNLYNEASNGHAAGLFEGVGSHTLTGSALQWQQFYALMLKRFHYARRNFKGVISQ 1070          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Nematostella
Match: EDO48951 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI12])

HSP 1 Score: 90.5077 bits (223), Expect = 1.263e-20
Identity = 70/222 (31.53%), Postives = 111/222 (50.00%), Query Frame = 1
Query:    1 YLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIE-EIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISE 663
            +L DRIAI++ G+L+CCGSS+FLK  +G GY+L +VK      ED  +   I+       ++  VP A+++    ++   VL    +    F  LF  L+   ED GI +YG+S T++EEVF+KV +     V  I    L                   ILS +    +  I+ +I R+  KS   Y + TG +L  Q    + +KRF  ++R+ KS +++
Sbjct:  697 FLGDRIAIMADGQLRCCGSSLFLKSRYGVGYHLTLVKK-----EDCDDNAIINA------VRETVPSAQVLSNVGAEIEFVLNGEASK--DFESLFVKLENNKEDYGIASYGVSCTTMEEVFMKVGEGSEKTVEDILNLLL------------------RILSSQSLLRYQNIKIKILRL-LKSN--YPLQTGFALQWQHYKAMLVKRFINSKRDKKSVVTQ 884          

HSP 2 Score: 62.3882 bits (150), Expect = 3.972e-11
Identity = 42/131 (32.06%), Postives = 67/131 (51.15%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGE 396
            L  R+AI+  G+ +C GS+  LK  FG GY L++ K E+        E         +F+ +  P A+++E      T  +  +E + S+   +F +L+R    L IV Y +S TSLE+VFL +A +   E
Sbjct: 1609 LCTRLAIMVNGQFKCVGSAQHLKSRFGMGYTLML-KVEARLVPVSNTE---------QFVSSTFPGAQLLESHNGMLTYQINSTELSWSR---IFGELERNRASLNIVDYSVSQTSLEQVFLNLAKEQYSE 1726          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Nematostella
Match: EDO32071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW57])

HSP 1 Score: 68.1662 bits (165), Expect = 2.141e-13
Identity = 45/141 (31.91%), Postives = 71/141 (50.35%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWE----DFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKE 414
            L  R+ I+ +G+L+C GS+  LK +FG+GY L I  + S Q      D Q +L       + F++   P+AK  E    +    +P+S  N SK    F  L+     +GI  Y  S ++LE+VFL+ A +   +  G K+
Sbjct:  181 LCSRVGIMVKGQLKCLGSTQHLKSKFGSGYTLEIKLSPSFQSSDPDVDMQTQL-------VAFVEGLFPNAKRTESFGDRVIYKVPKS--NVSKLSSTFATLEEGKRSIGIEEYSFSQSTLEQVFLEFAREQDDDRTGAKD 312          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Nematostella
Match: EDO28092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7F9])

HSP 1 Score: 57.3806 bits (137), Expect = 2.955e-10
Identity = 37/121 (30.58%), Postives = 63/121 (52.07%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLII-VKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEV 363
            L  R+AI+  G+ +C GS+  LK  FG GY L++ V+   +   + +         A +F+ +  P A+++E      T  +  +E + S+   +F +L+R    L IV Y +S TSLE+V
Sbjct:   73 LCTRLAIMVNGQFKCVGSAQHLKSRFGMGYTLMLKVEARLVPVSNTEQ--------AQQFVSSTFPGAQLLESHNGMLTYQINSTELSWSR---IFGELERNRASLNIVDYSVSQTSLEQV 182          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Medaka
Match: ENSORLT00000045391.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 137.117 bits (344), Expect = 3.401e-36
Identity = 99/308 (32.14%), Postives = 153/308 (49.68%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVK----------------------TES-------------IQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSL----------RDKSEFA-----KIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLMMPKT 777
            L DRIAIIS GK++CCGSS+FLKK FG+GYYL +V+                      TES              Q  D  N   +      +F++ HVP+A  +E    + T +LP +      F  LF +LD+ M+ LG+ +YG+SDT+LEE+FLKVA+D      G+ +K+L+P K   + D     R +   S+            K E       K+E+ ++ +  +     ++TG  L  QQ + L IKRFH+ RR+ K  I+++VLP + + + +    I    +D P + + PW+   +T
Sbjct:  752 LGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKH--VTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDT-----GV-DKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNTKDELKKKLSNKVEDFKKSASVNGRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQT 1051          

HSP 2 Score: 50.0618 bits (118), Expect = 1.379e-6
Identity = 39/137 (28.47%), Postives = 61/137 (44.53%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIA--LK----FIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGE 396
            L  R+AI+  G+ QC GS   LK  FG+GY LI+                  GG    LK    F++   P   + E+  +     L   E   +K   +F +L    ++LG+  Y +S T+L++VF+  A +   E
Sbjct: 1755 LCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVR----------------VGGCPPDLKPVEDFVEETFPGTVLKEKHHNTLQYQLLSQEGALAK---IFTELTDHQQELGLEDYSVSQTTLDQVFVNFAKEQHDE 1872          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Medaka
Match: ENSORLT00000046301.1 (ATP-binding cassette sub-family A member 1-like [Source:NCBI gene;Acc:101164844])

HSP 1 Score: 137.117 bits (344), Expect = 3.708e-36
Identity = 99/308 (32.14%), Postives = 153/308 (49.68%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVK----------------------TES-------------IQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSL----------RDKSEFA-----KIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLMMPKT 777
            L DRIAIIS GK++CCGSS+FLKK FG+GYYL +V+                      TES              Q  D  N   +      +F++ HVP+A  +E    + T +LP +      F  LF +LD+ M+ LG+ +YG+SDT+LEE+FLKVA+D      G+ +K+L+P K   + D     R +   S+            K E       K+E+ ++ +  +     ++TG  L  QQ + L IKRFH+ RR+ K  I+++VLP + + + +    I    +D P + + PW+   +T
Sbjct:  752 LGDRIAIISHGKMRCCGSSIFLKKSFGSGYYLTLVRSGTEVMTAQRSGIISGIAEEKPTESDCPSSSSLDEDRGCQSSDNSNPTDLKH--VTQFVRRHVPEAVFLESIGQEITFILPYARARDGTFATLFQELDKVMDKLGLTSYGVSDTTLEEIFLKVAEDT-----GV-DKELSPTKEPVVKDYKKDSRESKRRSMSRFHGKAAKGNTKDELKKKLSNKVEDFKKSASVNGRGSVVITGWKLIRQQFLALFIKRFHHARRSRKGLIAQVVLPAIFVCLALVFSLIVPSFTDYPSLELQPWMYNSQT 1051          

HSP 2 Score: 50.0618 bits (118), Expect = 1.523e-6
Identity = 39/137 (28.47%), Postives = 61/137 (44.53%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIA--LK----FIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGE 396
            L  R+AI+  G+ QC GS   LK  FG+GY LI+                  GG    LK    F++   P   + E+  +     L   E   +K   +F +L    ++LG+  Y +S T+L++VF+  A +   E
Sbjct: 1755 LCTRMAIMVNGRFQCLGSIQHLKNRFGDGYTLIVR----------------VGGCPPDLKPVEDFVEETFPGTVLKEKHHNTLQYQLLSQEGALAK---IFTELTDHQQELGLEDYSVSQTTLDQVFVNFAKEQHDE 1872          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Medaka
Match: abca4a (retinal-specific ATP-binding cassette transporter [Source:NCBI gene;Acc:101171449])

HSP 1 Score: 117.472 bits (293), Expect = 2.061e-29
Identity = 83/276 (30.07%), Postives = 132/276 (47.83%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIV---------------------KTESIQWEDFQNELSISGGIA--LKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            LSDR+AI+SQG+L CCGS +FLK  FG G+YL +V                     K  ++        LS +G I   +  + +HVP A+++E    + T +LP        +  LF +L+  + D+G+ ++G+SDTSLEE+FLKV  D +        +K  PE         N   P+ I          K     R S++       + G+ L ++Q + L IKR H+  R+ K F++++VLP   +   +    I  P  + P + +SPW+
Sbjct: 1111 LSDRVAILSQGRLYCCGSPIFLKNCFGAGFYLTLVRRMKNDPPKVGRKPPVCFCAFKARAVSSNSKTAFLS-TGNIESIMALVHHHVPQARLIETIGQELTFLLPNQNFQPRAYASLFRELEETLVDIGLSSFGVSDTSLEEIFLKVTADGT-------NRKCIPES--------NGQDPSQI----------KEGSAGRGSYR-------VRGVCLTVKQFLALLIKRLHHATRSYKDFVAQIVLPASFVFFSLMFNLIVPPFGEYPSLTLSPWM 1353          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Medaka
Match: zgc:172302 (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101162276])

HSP 1 Score: 115.161 bits (287), Expect = 1.324e-28
Identity = 89/287 (31.01%), Postives = 140/287 (48.78%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESI----------------------QWEDFQNELSISGGIA-----------LKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSM-LTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS+GKL CCGS +FLK + G+GYYL +VK E                          +D ++ LS   G+            L  +Q H+P A ++EE+R +  I LPQ              LD+ + +LGI +YGLSD++LEE+FL+VA++ +G     ++++L+P          N  +P+        +E  + E +       +      L+G  L  QQ+  L IKR+ Y RR+ + F +++VLP L +L+ +    I  P    P + + PW+
Sbjct: 1126 LGDRIAIISKGKLCCCGSPLFLKSQLGSGYYLTVVKREETNPNTPSGSSFSTSTSIITNKLPHAKDSESSLSEDTGLGSDESSSCVAALLALVQQHIPSASLVEESRREAVINLPQKAAKDGSLAIFLSKLDQRLPELGISSYGLSDSTLEEIFLRVAEE-TGVDAEPEQEELSP----------NSQQPSGERVEEQPAEQPEPEPLETDLLSGDCRGGEPLSGSWLMWQQLKALFIKRWLYARRSRRGFFAQIVLPALFVLVALLFSLIVPPFGRYPSVELQPWM 1401          

HSP 2 Score: 55.4546 bits (132), Expect = 2.283e-8
Identity = 38/133 (28.57%), Postives = 64/133 (48.12%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLII------VKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADD 384
            L  R+AI+  G+ QC GS   LK  FG+GY +I+        TES   ++              ++    P+ ++ E+ ++     LP   + CS    +FD L    E+LG+  + +S T+L++VF+  A D
Sbjct: 2131 LCTRMAIMVNGQFQCLGSVQHLKNRFGDGYTVILRLADTKSDTESCPVDE--------------YMTKSFPNIELKEQHQNVLQYHLP--SHGCS-LALIFDALANNCEELGVADFSVSQTTLDQVFISFAKD 2246          
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Medaka
Match: ENSORLT00000025407.2 (ATP-binding cassette sub-family A member 1 [Source:NCBI gene;Acc:101163308])

HSP 1 Score: 111.694 bits (278), Expect = 2.061e-27
Identity = 96/310 (30.97%), Postives = 138/310 (44.52%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVK---------------TESIQWEDFQN-----------------ELSISGGIAL----------------KFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTD---GGNFPRPASILSLRDKSEFAKIE------EIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWL 762
            L DRIAIIS GKL C GSS++LK + G+GYYL +VK               T S   +D +N                   +I  G A                   I  HVP A+++E+   + T +LP S      F +LF DLD  + +LGI +YG+SDT+LEE+FLKVA+D   +   + +  L P +    T    GG        +S  D  +    E      E   +S         + G SL  QQ + L  KRF Y RR+ K F +++VLP + + + +    I  P    P + + PW+
Sbjct: 1103 LGDRIAIISHGKLCCVGSSLYLKNQLGSGYYLTLVKKDPETSLSSCRNSSSTISFNKKDEENTSVSSSDAGLGSEHESEAATIENGPAASICTVPFVPTDTSLVSALILRHVPTARLVEDLGHELTYILPYSAAKNGAFVELFKDLDLKLHELGISSYGVSDTTLEEIFLKVAEDNGVDTEVLSDGTL-PVRARRRTHAFGGGEHQSCLKPISEDDTYDCNDSEGDPDCRETDWLSCTEGKGSYQVNGWSLRRQQFVALMWKRFLYARRSRKGFFAQIVLPAVFVCIALVFSLIVPPFGKYPSLELQPWM 1411          

HSP 2 Score: 52.373 bits (124), Expect = 2.614e-7
Identity = 37/134 (27.61%), Postives = 63/134 (47.01%), Query Frame = 1
Query:    4 LSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGG-----IALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPS 390
            L  R+AI+  G+ +C GS   LK  FG+GY +I               L ++G        +KFI++ +  + + E+ R+     LP S    +    +F  L +  + L I  Y ++ T+L++VF+  A D S
Sbjct: 2140 LCTRMAIMVNGRFRCLGSVQHLKNRFGDGYTII---------------LRVAGPDPDLLPVMKFIESELSGSTLKEKHRNMLQYQLPSS---LTSLAHIFSILAKNKDTLRIEDYSVTQTTLDQVFVNFAKDQS 2255          
BLAST of ATP-binding cassette sub-family A member vs. Planmine SMEST
Match: SMESG000068605.1 (SMESG000068605.1)

HSP 1 Score: 492.271 bits (1266), Expect = 4.833e-161
Identity = 257/260 (98.85%), Postives = 259/260 (99.62%), Query Frame = 1
Query:    1 YLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLMMPKTR 780
            YLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTI LPQSENNCSKFPDLFD+LDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFI+ELVLPVLMILMIIGLLNISSPLSDAPPMVISPWLMMPKTR
Sbjct:  907 YLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIALPQSENNCSKFPDLFDNLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFIAELVLPVLMILMIIGLLNISSPLSDAPPMVISPWLMMPKTR 1166          
BLAST of ATP-binding cassette sub-family A member vs. Planmine SMEST
Match: SMESG000032896.1 (SMESG000032896.1)

HSP 1 Score: 305.449 bits (781), Expect = 6.197e-95
Identity = 165/260 (63.46%), Postives = 207/260 (79.62%), Query Frame = 1
Query:    1 YLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLMMPKTR 780
            YLSDRIAIISQGKLQCCGSSVFLKKEFG+GYYLI+VK    Q EDF++ +S SG   L FI+ H+ DAKM+EETR+QWTIVLPQ+E N  KF DLF D+DR++  L  V+YGLSDTSLEEVFLKVADDP+G V  IK+K++T E LD+LTD GNFPRP+S LS RDK EF + +++  + ++S    S+LTG +L  QQ++GLQ+KRFHYT+RN+K F++ELVLP+L+I+++I    ISS L+  PPM ISPWLMMPK R
Sbjct:  871 YLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINIGKFSDLFADIDRSLSGLNFVSYGLSDTSLEEVFLKVADDPAGSVQEIKDKQITAEDLDSLTDDGNFPRPSSRLSFRDKLEFPRFDDLNSIPYESGAPSSLLTGSALLRQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVVMIAFSKISSNLNYQPPMEISPWLMMPKAR 1130          
BLAST of ATP-binding cassette sub-family A member vs. Planmine SMEST
Match: SMESG000032896.1 (SMESG000032896.1)

HSP 1 Score: 305.064 bits (780), Expect = 8.199e-95
Identity = 165/260 (63.46%), Postives = 207/260 (79.62%), Query Frame = 1
Query:    1 YLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLMMPKTR 780
            YLSDRIAIISQGKLQCCGSSVFLKKEFG+GYYLI+VK    Q EDF++ +S SG   L FI+ H+ DAKM+EETR+QWTIVLPQ+E N  KF DLF D+DR++  L  V+YGLSDTSLEEVFLKVADDP+G V  IK+K++T E LD+LTD GNFPRP+S LS RDK EF + +++  + ++S    S+LTG +L  QQ++GLQ+KRFHYT+RN+K F++ELVLP+L+I+++I    ISS L+  PPM ISPWLMMPK R
Sbjct:  868 YLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINIGKFSDLFADIDRSLSGLNFVSYGLSDTSLEEVFLKVADDPAGSVQEIKDKQITAEDLDSLTDDGNFPRPSSRLSFRDKLEFPRFDDLNSIPYESGAPSSLLTGSALLRQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVVMIAFSKISSNLNYQPPMEISPWLMMPKAR 1127          
BLAST of ATP-binding cassette sub-family A member vs. Planmine SMEST
Match: SMESG000032861.1 (SMESG000032861.1)

HSP 1 Score: 303.908 bits (777), Expect = 2.726e-94
Identity = 165/260 (63.46%), Postives = 207/260 (79.62%), Query Frame = 1
Query:    1 YLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLMMPKTR 780
            YLSDRIAIISQGKLQCCGSSVFLKKEFG+GYYLI+VK    Q EDF++ +S SG   L FI+ H+ DAKM+EETR+QWTIVLPQ+E N  KF DLF D+DR++  L IV+YGLSDTSLEEVFLKVADDP+G V  IK+K++T E LD+LTD GNFPRP+S LS R K EF + +++  + ++S    S+LTG +L  QQ++GLQ+KRFHYT+RN+K F++ELVLP+L+I+++I    ISS L+  PPM ISPWLMMPK R
Sbjct:  881 YLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLPQNEINSGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITAEDLDSLTDDGNFPRPSSRLSFRCKREFPRFDDLNSIPYESGAPSSLLTGSALLRQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVVMIAFSKISSNLNYQPPMEISPWLMMPKAR 1140          
BLAST of ATP-binding cassette sub-family A member vs. Planmine SMEST
Match: SMESG000032891.1 (SMESG000032891.1)

HSP 1 Score: 303.138 bits (775), Expect = 4.590e-94
Identity = 165/260 (63.46%), Postives = 207/260 (79.62%), Query Frame = 1
Query:    1 YLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNELSISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLDRAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALTDGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQIIGLQIKRFHYTRRNMKSFISEXXXXXXXXXXXXXXXXXSSPLSDAPPMVISPWLMMPKTR 780
            YLSDRIAIISQGKLQCCGSSVFLKKEFG+GYYLI+VK    Q EDF++ +S SG   L FI+ H+ DAKM+EETR+QWTIVL Q+E N  KF DLF D+DR++  L IV+YGLSDTSLEEVFLKVADDP+G V  IK+K++T E LD+LTD GNFPRP+S LS RDK EF + +++  + ++S    S+LTG +L  QQ++GLQ+KRFHYT+RN+K F++ELVLP+L+I+++I    ISS L+  PPM ISPWLMMPK R
Sbjct:  871 YLSDRIAIISQGKLQCCGSSVFLKKEFGDGYYLILVKNSRSQEEDFRSGISSSGEKVLNFIRAHITDAKMIEETRTQWTIVLSQNEINNGKFSDLFADIDRSLSGLNIVSYGLSDTSLEEVFLKVADDPAGTVEEIKDKQITTEDLDSLTDDGNFPRPSSRLSFRDKREFPRFDDLNSIPYESGAPSSLLTGSALLCQQLLGLQVKRFHYTKRNIKGFVAELVLPILLIVIMIAFSKISSNLNYQPPMEISPWLMMPKAR 1130          
The following BLAST results are available for this feature:
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA123.283e-2834.53ATP binding cassette subfamily A member 12 [Source... [more]
ABCA123.968e-2834.53ATP binding cassette subfamily A member 12 [Source... [more]
ABCA44.351e-2729.62ATP binding cassette subfamily A member 4 [Source:... [more]
ABCA11.479e-2530.80ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA72.758e-2428.47ATP binding cassette subfamily A member 7 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abt-41.938e-1736.80ABC Transporter family [Source:UniProtKB/TrEMBL;A... [more]
ced-71.703e-821.01ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
ced-72.057e-821.01ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
ced-72.293e-821.01ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
ced-72.314e-821.01ABC transporter ced-7 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG60525.643e-1737.31gene:FBgn0036747 transcript:FBtr0075195[more]
ABCA2.038e-1533.81gene:FBgn0031170 transcript:FBtr0306679[more]
ABCA2.076e-1535.97gene:FBgn0031170 transcript:FBtr0332488[more]
ABCA2.113e-1533.81gene:FBgn0031170 transcript:FBtr0332489[more]
CG14942.299e-1530.22gene:FBgn0031169 transcript:FBtr0332306[more]
back to top
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abca1b8.573e-3131.85ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4b1.081e-3031.25ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4b2.569e-2930.88ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca1b2.626e-2930.69ATP-binding cassette, sub-family A (ABC1), member ... [more]
abca4a3.240e-2930.21ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCA17.080e-3032.62ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA19.147e-3031.94ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA19.766e-3031.94ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA11.009e-2931.94ATP binding cassette subfamily A member 1 [Source:... [more]
ABCA11.029e-2931.94ATP binding cassette subfamily A member 1 [Source:... [more]
back to top
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abca127.662e-2935.43ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca42.676e-2829.69ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca11.276e-2530.13ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca161.973e-2433.18ATP-binding cassette, sub-family A (ABC1), member ... [more]
Abca72.028e-2427.91ATP-binding cassette, sub-family A (ABC1), member ... [more]
back to top
BLAST of ATP-binding cassette sub-family A member vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86UK0|ABCAC_HUMAN1.576e-2734.53ATP-binding cassette sub-family A member 12 OS=Hom... [more]
sp|O35600|ABCA4_MOUSE1.872e-2729.69Retinal-specific phospholipid-transporting ATPase ... [more]
sp|Q7TNJ2|ABCA7_RAT1.017e-2628.09ATP-binding cassette sub-family A member 7 OS=Ratt... [more]
sp|P78363|ABCA4_HUMAN2.090e-2629.62Retinal-specific phospholipid-transporting ATPase ... [more]
sp|O95477|ABCA1_HUMAN7.103e-2530.80Phospholipid-transporting ATPase ABCA1 OS=Homo sap... [more]
back to top
BLAST of ATP-binding cassette sub-family A member vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
N1PB025.904e-3937.37Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A3P8NFP81.840e-3734.74Uncharacterized protein OS=Astatotilapia callipter... [more]
A0A4U5VYY43.089e-3635.63ATP-binding cassette sub-family A member 1 OS=Coll... [more]
A0A0P4ZVF73.266e-3536.43ATP-binding cassette sub-family A member OS=Daphni... [more]
A0A482DHK74.552e-3536.40ATP-binding cassette sub-family A member 1 isoform... [more]
back to top
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1723024.507e-3135.69zgc:172302 [Source:ZFIN;Acc:ZDB-GENE-081205-5][more]
ENSAMXT00000016919.29.726e-3131.85pep primary_assembly:Astyanax_mexicanus-2.0:8:9912... [more]
abca4a8.569e-3029.02retinal-specific ATP-binding cassette transporter-... [more]
abca4a1.048e-2929.10retinal-specific ATP-binding cassette transporter-... [more]
ENSAMXT00000022236.22.383e-2831.75pep primary_assembly:Astyanax_mexicanus-2.0:21:133... [more]
back to top
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002495.11.041e-3633.09pep scaffold:Pmarinus_7.0:GL480265:53:27909:1 gene... [more]
abca121.724e-1123.81ATP-binding cassette, sub-family A (ABC1), member ... [more]
ENSPMAT00000006855.11.243e-726.52pep scaffold:Pmarinus_7.0:GL486953:391:4596:1 gene... [more]
ENSPMAT00000010397.11.470e-727.78pep scaffold:Pmarinus_7.0:GL480213:155963:163950:1... [more]
ENSPMAT00000006988.13.250e-654.29pep scaffold:Pmarinus_7.0:GL478499:147909:176415:-... [more]
back to top
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO468783.730e-3633.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388798.979e-2429.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489511.263e-2031.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320712.141e-1331.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO280922.955e-1030.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-binding cassette sub-family A member vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045391.13.401e-3632.14ATP-binding cassette sub-family A member 1-like [S... [more]
ENSORLT00000046301.13.708e-3632.14ATP-binding cassette sub-family A member 1-like [S... [more]
abca4a2.061e-2930.07retinal-specific ATP-binding cassette transporter ... [more]
zgc:1723021.324e-2831.01ATP-binding cassette sub-family A member 1 [Source... [more]
ENSORLT00000025407.22.061e-2730.97ATP-binding cassette sub-family A member 1 [Source... [more]
back to top
BLAST of ATP-binding cassette sub-family A member vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068605.14.833e-16198.85SMESG000068605.1[more]
SMESG000032896.16.197e-9563.46SMESG000032896.1[more]
SMESG000032896.18.199e-9563.46SMESG000032896.1[more]
SMESG000032861.12.726e-9463.46SMESG000032861.1[more]
SMESG000032891.14.590e-9463.46SMESG000032891.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012877 ID=SMED30012877|Name=ATP-binding cassette sub-family A member|organism=Schmidtea mediterranea sexual|type=transcript|length=780bp
TATCTCAGTGACAGAATTGCTATAATTTCTCAAGGCAAACTCCAATGCTG
TGGTTCTTCAGTTTTTTTAAAAAAAGAATTCGGTAATGGCTATTATCTGA
TAATTGTGAAGACCGAGAGTATACAATGGGAAGATTTTCAAAATGAATTA
TCAATTAGTGGAGGAATTGCTTTAAAATTCATACAAAACCACGTTCCCGA
TGCAAAGATGATGGAAGAGACTCGATCCCAATGGACAATTGTGTTGCCAC
AAAGTGAAAATAATTGTAGCAAATTTCCAGATTTATTTGACGATCTTGAT
CGTGCAATGGAAGATTTGGGTATCGTTACATACGGTCTTTCTGACACATC
ACTTGAAGAGGTTTTCTTGAAAGTAGCTGACGATCCGTCAGGTGAAGTCG
GTGGGATAAAAGAAAAAAAATTAACCCCGGAAAAATTGGATGCACTAACT
GACGGAGGCAATTTTCCAAGACCAGCGTCAATTTTGAGTTTAAGAGATAA
ATCAGAATTTGCAAAAATTGAGGAAATTAGAAGAGTGTCATTTAAATCGG
AAATAACGTACAGTATGTTGACTGGTATTTCACTATTTATTCAACAGATA
ATCGGACTACAAATTAAAAGATTTCATTATACCAGGAGAAATATGAAAAG
TTTCATTTCTGAGCTTGTGTTGCCAGTATTGATGATACTGATGATAATTG
GCCTTTTGAACATTTCAAGTCCCCTGAGTGATGCACCGCCAATGGTTATA
AGTCCCTGGTTAATGATGCCTAAAACTCGA
back to top

protein sequence of SMED30012877-orf-1

>SMED30012877-orf-1 ID=SMED30012877-orf-1|Name=SMED30012877-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
YLSDRIAIISQGKLQCCGSSVFLKKEFGNGYYLIIVKTESIQWEDFQNEL
SISGGIALKFIQNHVPDAKMMEETRSQWTIVLPQSENNCSKFPDLFDDLD
RAMEDLGIVTYGLSDTSLEEVFLKVADDPSGEVGGIKEKKLTPEKLDALT
DGGNFPRPASILSLRDKSEFAKIEEIRRVSFKSEITYSMLTGISLFIQQI
IGLQIKRFHYTRRNMKSFISELVLPVLMILMIIGLLNISSPLSDAPPMVI
SPWLMMPKTR
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0000166nucleotide binding
GO:0005215transporter activity
GO:0005524ATP binding
GO:0016887ATPase activity
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR026082ABCA
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026082ABC transporter APANTHERPTHR19229ATP-BINDING CASSETTE TRANSPORTER SUBFAMILY A ABCAcoord: 2..247
NoneNo IPR availablePANTHERPTHR19229:SF185coord: 2..247
NoneNo IPR availableTMHMMTMhelixcoord: 217..239