Innexin

Overview
NameInnexin
Smed IDSMED30012872
Length (bp)1451
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30012872) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30012872) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30012872) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30012872) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012872

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30012872SMESG000016539.1 NB.24.11bncbi_smed_estsPMID:17670787
Oviedo et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30012872SMESG000016539.1 dd_Smed_v4_13475_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012872SMESG000016539.1 dd_Smed_v4_13475_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012872SMESG000016539.1 dd_Smed_v4_13475_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30012872SMESG000016539.1 dd_Smed_v4_13475_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012872SMESG000016539.1 dd_Smed_v4_13475_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012872SMESG000016539.1 dd_Smed_v4_13475_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 239.965 bits (611), Expect = 1.434e-74
Identity = 133/356 (37.36%), Postives = 208/356 (58.43%), Query Frame = 2
Query:  287 DFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPL----LLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNN--SPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKY 1336
            D +DKLN+ +T AII +   L+SA+QY+G PIQCWVP  FT   E Y E+ CWVQNTYFL     +P N  E  + + + YYQWV   L L+A+L Y+P + W+L S +  +    L++ A ++ L D + R +A+  +  ++EE      +    N    +   IC+ +  +  T +++  ++L   N VGQI+L+ T+LG R  ++G+Q+L  + +G +W++SG+FPRVT C   ++  G     +TVQCVL +N F EK+++FLWFW+F LA  T C+   W     +P R+  F+ +YL  ++     D +   RFV + L  DGV LLR V++ A +L   +++  LW  Y
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAER-ENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLG-NVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 229.95 bits (585), Expect = 9.767e-71
Identity = 132/370 (35.68%), Postives = 209/370 (56.49%), Query Frame = 2
Query:  287 DFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQ--KHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSH-----RFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKY----KRSRFTCTD 1363
            DFVDKLN+ +T AII     ++SA+QY+G PIQCWVP +FT AWE Y E+ CWV+NTY+L  +   P   LE  D+  + ++YYQWV   L L+A+  Y+P + W+   H         L + A +A + D D R   +  +   +E+  E     QR  + +          +  T +++  ++L +GN V Q++++ ++LG  + F+G  ILR + +G +W+ SG FPRVT C   +R  G     +TVQCVL +N F EK+++FLWFW+F +A V+  +   W I   +P +  +FI +YLRA     + D +   +FV   LG DGV  +R +S+ A D++A ++   LW  +    ++ +F  T+
Sbjct:   20 DFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFP---LEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALE----IQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLG-NVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNSTE 379          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 229.95 bits (585), Expect = 9.767e-71
Identity = 132/370 (35.68%), Postives = 209/370 (56.49%), Query Frame = 2
Query:  287 DFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQ--KHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSH-----RFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKY----KRSRFTCTD 1363
            DFVDKLN+ +T AII     ++SA+QY+G PIQCWVP +FT AWE Y E+ CWV+NTY+L  +   P   LE  D+  + ++YYQWV   L L+A+  Y+P + W+   H         L + A +A + D D R   +  +   +E+  E     QR  + +          +  T +++  ++L +GN V Q++++ ++LG  + F+G  ILR + +G +W+ SG FPRVT C   +R  G     +TVQCVL +N F EK+++FLWFW+F +A V+  +   W I   +P +  +FI +YLRA     + D +   +FV   LG DGV  +R +S+ A D++A ++   LW  +    ++ +F  T+
Sbjct:   20 DFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFP---LEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALE----IQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLG-NVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNSTE 379          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 229.18 bits (583), Expect = 8.195e-70
Identity = 130/358 (36.31%), Postives = 203/358 (56.70%), Query Frame = 2
Query:  287 DFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQ--KHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSH-----RFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYK 1339
            DFVDKLN+ +T AII     ++SA+QY+G PIQCWVP +FT AWE Y E+ CWV+NTY+L  +   P   LE  D+  + ++YYQWV   L L+A+  Y+P + W+   H         L + A +A + D D R   +  +   +E+  E     QR  + +          +  T +++  ++L +GN V Q++++ ++LG  + F+G  ILR + +G +W+ SG FPRVT C   +R  G     +TVQCVL +N F EK+++FLWFW+F +A V+  +   W I   +P +  +FI +YLRA     + D +   +FV   LG DGV  +R +S+ A D++A ++   LW  + 
Sbjct:   20 DFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFP---LEYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALE----IQREVTDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLG-NVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFN 367          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-13 (Innexin [Source:UniProtKB/TrEMBL;Acc:O44887])

HSP 1 Score: 224.172 bits (570), Expect = 1.893e-68
Identity = 132/378 (34.92%), Postives = 208/378 (55.03%), Query Frame = 2
Query:  266 LNYGGGVDFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLR----SAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERD---CDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSR 1378
            L+  G  D +D+LN+ +T  +++I    +SA+QY+G+PIQCW+P +FT AWE Y E+ C+VQNTYF+ P + +P ++++  +   + YYQWV   LGLQA+L YLP LFW+L +    + L+     A++A   D+  R +A     A + E     +RF +  S  + +  S+      T ++L  + L +   V Q  ++  +LG  + F+G+ IL  + +G +W++SG+FPRVT C   +R  G K   +TVQCVL +N F EKVYVFLWFW   +   TF N + W   L     R   I  YL+     S ++ R+    D+FV   L +DGV +   + +    + + DV   +W      RF   +D+ S+
Sbjct:   11 LHKQGDDDSIDRLNYYWTPMLLVIFALTLSAKQYVGQPIQCWIPAQFTGAWEQYSENYCFVQNTYFISPDKYIPDSEIDR-EGAEIGYYQWVPFILGLQAILFYLPSLFWRLMNFNSGVALKKMLFGAKKADRVDEKARNEAAKSTGAHLYESLTLQSRFAKYTSA-FTYGGSYL-----TYLYLFVKFLYLVQIVFQFIILNNFLGTSYTFWGLGILSDILNGREWEESGHFPRVTMCDFEVRVLGNK-HRHTVQCVLMINMFNEKVYVFLWFWLVIVGVATFLNLVNWTRKLMFRSARKAHIKSYLQIEDNFSDDNSRNGQILDKFVDYKLKSDGVFITHLIDNNGGSVFSHDVIVDMW-----DRFLQDEDNRSQ 375          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 86.2705 bits (212), Expect = 5.007e-18
Identity = 84/304 (27.63%), Postives = 129/304 (42.43%), Query Frame = 2
Query:  359 RQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPS-----------QPVPINDLETFDQ-KHVTYYQWVTIFLGLQAVLSYLPHLFWQL-GSHRFPLLLRSAREAALPD--KDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWK---QSGYFPRVTYCRVLIRRWGVKDASYTVQ--CVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDE 1210
            RQYIG PI C V +      + Y    CW+ +T F +P            QP   + +E  D+ K+  YYQWV   L  QA+L Y+P   W+     R  +L+       + D  K+ RKK +            F     R+N   +RF               V   L+  N +GQIY +  +L      +G  +L+      D +    +  FP+VT C     ++G   +  T    CVL LN   EK+YVFLWFWF  L+ ++  + +     +  P  R+      LRA  +++ ++E
Sbjct:   45 RQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILV---------DYFIGNLNRHNFYAFRF--------------FVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCT--FHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLL----LRARSRLAESEE 314          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 86.2705 bits (212), Expect = 5.007e-18
Identity = 84/304 (27.63%), Postives = 129/304 (42.43%), Query Frame = 2
Query:  359 RQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPS-----------QPVPINDLETFDQ-KHVTYYQWVTIFLGLQAVLSYLPHLFWQL-GSHRFPLLLRSAREAALPD--KDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWK---QSGYFPRVTYCRVLIRRWGVKDASYTVQ--CVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDE 1210
            RQYIG PI C V +      + Y    CW+ +T F +P            QP   + +E  D+ K+  YYQWV   L  QA+L Y+P   W+     R  +L+       + D  K+ RKK +            F     R+N   +RF               V   L+  N +GQIY +  +L      +G  +L+      D +    +  FP+VT C     ++G   +  T    CVL LN   EK+YVFLWFWF  L+ ++  + +     +  P  R+      LRA  +++ ++E
Sbjct:   45 RQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILV---------DYFIGNLNRHNFYAFRF--------------FVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCT--FHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLL----LRARSRLAESEE 314          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 86.2705 bits (212), Expect = 5.007e-18
Identity = 84/304 (27.63%), Postives = 129/304 (42.43%), Query Frame = 2
Query:  359 RQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPS-----------QPVPINDLETFDQ-KHVTYYQWVTIFLGLQAVLSYLPHLFWQL-GSHRFPLLLRSAREAALPD--KDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWK---QSGYFPRVTYCRVLIRRWGVKDASYTVQ--CVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDE 1210
            RQYIG PI C V +      + Y    CW+ +T F +P            QP   + +E  D+ K+  YYQWV   L  QA+L Y+P   W+     R  +L+       + D  K+ RKK +            F     R+N   +RF               V   L+  N +GQIY +  +L      +G  +L+      D +    +  FP+VT C     ++G   +  T    CVL LN   EK+YVFLWFWF  L+ ++  + +     +  P  R+      LRA  +++ ++E
Sbjct:   45 RQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILV---------DYFIGNLNRHNFYAFRF--------------FVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCT--FHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLL----LRARSRLAESEE 314          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 86.2705 bits (212), Expect = 5.007e-18
Identity = 84/304 (27.63%), Postives = 129/304 (42.43%), Query Frame = 2
Query:  359 RQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPS-----------QPVPINDLETFDQ-KHVTYYQWVTIFLGLQAVLSYLPHLFWQL-GSHRFPLLLRSAREAALPD--KDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWK---QSGYFPRVTYCRVLIRRWGVKDASYTVQ--CVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDE 1210
            RQYIG PI C V +      + Y    CW+ +T F +P            QP   + +E  D+ K+  YYQWV   L  QA+L Y+P   W+     R  +L+       + D  K+ RKK +            F     R+N   +RF               V   L+  N +GQIY +  +L      +G  +L+      D +    +  FP+VT C     ++G   +  T    CVL LN   EK+YVFLWFWF  L+ ++  + +     +  P  R+      LRA  +++ ++E
Sbjct:   45 RQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILV---------DYFIGNLNRHNFYAFRF--------------FVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCT--FHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRHLL----LRARSRLAESEE 314          
BLAST of Innexin vs. Ensembl Fly
Match: shakB (gene:FBgn0085387 transcript:FBtr0112571)

HSP 1 Score: 84.3445 bits (207), Expect = 2.270e-17
Identity = 73/289 (25.26%), Postives = 126/289 (43.60%), Query Frame = 2
Query:  254 NLFHLNYGGGVDFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFL-----------LPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGY---FPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFW 1078
            NL  +++      V +L++  T  I++    +I+ RQY+G PI C   ++     ED L   CW+Q+TY L           +P   +  +D +  D+KH  YYQWV   L  QA+L Y P   W+             +  AL         I  L   I  +AE   + +     ++    +   ++     + V  +L++ N +GQ++LM  +       FG++++  + +  + +       FPR+T C         +   +   C+L LN   EK+Y+FLWFW
Sbjct:   10 NLVKVSHVKTDSIVFRLHYSITVMILMSFSLIITTRQYVGNPIDCVHTKDIP---EDVLNTYCWIQSTYTLKSLFLKKQGVSVPYPGIGNSDGDPADKKHYKYYQWVCFCLFFQAILFYTPRWLWKSWE--------GGKIHAL---------IMDLDIGICSEAEKKQKKKLLLDYLWE---NLRYHNWWAYRYYVCELLALINVIGQMFLMNRFFDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 275          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 1.824e-73
Identity = 133/356 (37.36%), Postives = 208/356 (58.43%), Query Frame = 2
Query:  287 DFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPL----LLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNN--SPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKY 1336
            D +DKLN+ +T AII +   L+SA+QY+G PIQCWVP  FT   E Y E+ CWVQNTYFL     +P N  E  + + + YYQWV   L L+A+L Y+P + W+L S +  +    L++ A ++ L D + R +A+  +  ++EE      +    N    +   IC+ +  +  T +++  ++L   N VGQI+L+ T+LG R  ++G+Q+L  + +G +W++SG+FPRVT C   ++  G     +TVQCVL +N F EK+++FLWFW+F LA  T C+   W     +P R+  F+ +YL  ++     D +   RFV + L  DGV LLR V++ A +L   +++  LW  Y
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAER-ENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLG-NVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 4.981e-59
Identity = 118/365 (32.33%), Postives = 197/365 (53.97%), Query Frame = 2
Query:  287 DFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQ-----LGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRN------TTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSN---DERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYK 1339
            DFVDKLN+ +T  I+     L+SA+QY+G PIQCWVP  FT A E Y E+ CWVQNTY++   + +P  ++ +   + + YYQWV   L ++A+L Y+P + W+             L++ A +A L D +++ + +  +   ++++ + +   ++ +S           N         T +++  +VL   N + Q +L+   LG     +G  +L+ +    +W+Q+G FPRVT C   +R  G     +TVQCVL +N F EK+++FLWFWF +   VT CNT+ W + + IP +   F+ +YLR L    +    D+    +F  N L  DGV +LR +S+ A +L++ ++   LW  + 
Sbjct:  140 DFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIP-REIYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLG-NIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFN 502          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q27295|EAT5_CAEEL (Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN=eat-5 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 7.970e-57
Identity = 117/395 (29.62%), Postives = 205/395 (51.90%), Query Frame = 2
Query:  293 VDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPL----LLRSAREAALPDKDLRKKAISILTASI---------EEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDR--------------FVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIH 1396
             D+LN+ ++  II+ +   I+ARQY+G P+QCWVP +FT AWE Y E  C+V NTY++ P+  VP+   E   Q+ + YYQW    + ++A   YLP +FW + S +  +    L+ +A++A   + + RKK I I+   I         EE+    A+ QR        I         T ++LV++++ + NS  Q Y    +LG   P++G++IL  +  G DW+ SG FPR+  C   +R  G     Y++QCVL+LN F EK+++FL+ WF  +  VT  +++    N+    +  +F+ Q+L    Q  +++++  +R              F  +    D ++LL+ +++   D++  ++  ++W ++           L RF++N H
Sbjct:   20 TDRLNYYYSTLIIMGMSLTITARQYVGSPLQCWVPAQFTKAWEQYAEDYCFVYNTYWVKPNDKVPLTVEERVSQQ-LIYYQWAPFIMAIEAAFFYLPVIFWSMLSTKSGINIIKLVETAQKAEGAESEERKKQIDIICRHISNNLRKRRNEEETTKMAKIQR--------IFGMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFLGQNDPYWGMRILDDILKGTDWEHSGNFPRIAMCDFQVRVLG-NLQRYSIQCVLTLNMFNEKIFLFLYIWFLLVFFVTLFDSIFLCYNMFSSHKLVEFLQQFLDNQDQDENDEKKPEERKVYRKEQHSILLSEFCLHKFTPDIIILLKMINNHTGDIVCTEIVGRMWNEFLERDAKLV---LQRFVDNDH 401          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 5.291e-55
Identity = 124/367 (33.79%), Postives = 197/367 (53.68%), Query Frame = 2
Query:  287 DFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLET--FDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSH----RFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFIC--SFAPNSRNTT-IFLVSRVLSIGNSVGQIYLMQTYLGY-RHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDER-------DCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKY 1336
            D+ D+LN+  T  I+L    LIS +Q+ G+PI+C  P +F  +WE Y E+ CW Q+TYF+ P+Q V +   E      + ++YYQWV  FL LQA     P   W+  S+    R   ++  A+++A  ++++R+K I IL   +     F A  +R    +++ +   +F  +S   + I+L ++VL   N   Q+YLM  +LG  RH ++G  +++ +  G  W++SGYFPR   C   +R+       Y+VQCVL +N F EK++V LWFW+  L   +  + + W I L  P     F+ Q+L AL  + + ++R       D  +FV   L  DGV +LR VSS A  + A D+   L+  Y
Sbjct:   21 DWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPGSWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKVQVHKTVTFLNFQYSSGFISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWYGFGVVQDIVQGEPWERSGYFPRAAVCDFEVRQVA-NIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHL-ALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAY 385          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 1.838e-52
Identity = 109/358 (30.45%), Postives = 177/358 (49.44%), Query Frame = 2
Query:  287 DFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFW-----QLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRS 1345
            D VD+L++  T  ++     ++S +QY+G  IQCW+P EF   WE Y E  C++QNT+F+     +P  D+E   +  + YYQWV I L +QA + YLP   W     Q G   FP ++  A      D + R K ++ L   I +  +  ++ +      YRF       S  + +++  +++ + N   Q  ++  +LG     +G      + +G +W+ SG FPRVT C   +R+       YTVQCVL +N F EK+Y+F+WFWF  +   TF NTL     L     R+ +I   L        +++     F  N L  DGVLL+R +   A  ++  ++  +L+ K+  +
Sbjct:   22 DAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIP-GDVEDRQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLD-FPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYRFGKGLG--SMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLA-NVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGEN 374          
BLAST of Innexin vs. TrEMBL
Match: A0A4S2LVS8 (Innexin OS=Opisthorchis felineus OX=147828 GN=inx PE=3 SV=1)

HSP 1 Score: 480.33 bits (1235), Expect = 1.091e-164
Identity = 221/400 (55.25%), Postives = 306/400 (76.50%), Query Frame = 2
Query:  224 MDSGSILRFGNLFHLNYGG-GVDFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAI 1417
            M+  S+LR G +F+  YGG GVDFVD+LN+QFTG +++I I++I  RQY+GKPIQCWVPQEFTH+WE+Y E++CWVQNTYFL PS  VP +D E    KH+ YYQW+ I L  Q +LS++P+L W++GS R P+LLRSA+EA++PD++LR+KAIS L A++EEQAE +AR++R  S + RF+C   PN+R T +F + R   IGNSVGQIYLM+ ++G     FG+++L  + SG DW+ SG FPRVT+C V +R+ G +K ASYT+QCVL +NYF+EKVYVFLWFWF  L C+T  +T+ WA N  +P RR  +I QY+RA++Q+S+ +ERDC RFV N LG DGVL+L+ VS  +SDLIALDV+A LW+ Y+ ++ T T++D++RFLE ++++S  A+
Sbjct:    1 MNPDSVLRIGKVFYTPYGGEGVDFVDQLNYQFTGGLLIIFIAVIGIRQYVGKPIQCWVPQEFTHSWEEYAENLCWVQNTYFLHPSDNVPEDDYELTKVKHIGYYQWIAIVLAGQVMLSWVPYLLWRVGSKRLPILLRSAKEASVPDRELRQKAISCLVATLEEQAESTARYRRMTSGLKRFLCQLRPNTRITFLFFIVRFCFIGNSVGQIYLMKHFIGTNSTMFGVEVLNDIVSGKDWETSGKFPRVTFCTVRVRKMGQIKPASYTLQCVLPINYFVEKVYVFLWFWFVILTCITLLSTIHWAFNTLLPVRRIAYIKQYIRAIRQLSNTEERDCTRFVNNNLGPDGVLILQVVSRVSSDLIALDVTATLWSNYRHAKITGTEEDINRFLETVNRNSTTAV 400          
BLAST of Innexin vs. TrEMBL
Match: A0A074ZMI3 (Innexin OS=Opisthorchis viverrini OX=6198 GN=inx PE=3 SV=1)

HSP 1 Score: 480.33 bits (1235), Expect = 1.091e-164
Identity = 221/400 (55.25%), Postives = 306/400 (76.50%), Query Frame = 2
Query:  224 MDSGSILRFGNLFHLNYGG-GVDFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAI 1417
            M+  S+LR G +F+  YGG GVDFVD+LN+QFTG +++I I++I  RQY+GKPIQCWVPQEFTH+WE+Y E++CWVQNTYFL PS  VP +D E    KH+ YYQW+ I L  Q +LS++P+L W++GS R P+LLRSA+EA++PD++LR+KAIS L A++EEQAE +AR++R  S + RF+C   PN+R T +F + R   IGNSVGQIYLM+ ++G     FG+++L  + SG DW+ SG FPRVT+C V +R+ G +K ASYT+QCVL +NYF+EKVYVFLWFWF  L C+T  +T+ WA N  +P RR  +I QY+RA++Q+S+ +ERDC RFV N LG DGVL+L+ VS  +SDLIALDV+A LW+ Y+ ++ T T++D++RFLE ++++S  A+
Sbjct:    1 MNPDSVLRIGKVFYTPYGGEGVDFVDQLNYQFTGGLLIIFIAVIGIRQYVGKPIQCWVPQEFTHSWEEYAENLCWVQNTYFLHPSDNVPEDDYELTKVKHIGYYQWIAIVLAGQVMLSWVPYLLWRVGSKRLPILLRSAKEASVPDRELRQKAISCLVATLEEQAESTARYRRMTSGLKRFLCQLRPNTRITFLFFIVRFCFIGNSVGQIYLMKHFIGTNSTMFGVEVLNDIVSGKDWETSGKFPRVTFCTVRVRKMGQIKPASYTLQCVLPINYFVEKVYVFLWFWFVILTCITLLSTIHWAFNTLLPVRRIAYIKQYIRAIRQLSNTEERDCTRFVNNNLGPDGVLILQVVSRVSSDLIALDVTATLWSNYRHAKITGTEEDINRFLETVNRNSTTAV 400          
BLAST of Innexin vs. TrEMBL
Match: A0A504YQY5 (Innexin OS=Fasciola gigantica OX=46835 GN=inx PE=3 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 6.096e-163
Identity = 219/396 (55.30%), Postives = 303/396 (76.52%), Query Frame = 2
Query:  224 MDSGSILRFGNLFHLNYGG-GVDFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSS 1405
            M+  ++LR G +F+  YGG GVDFVD+LN+QFTG +++I I++I  RQY+GKPIQCWVPQEFTH+WE+Y E++CWVQNTYFL PS  VP +D E    KH+ YYQW+ I L  Q +LS++P+L W++GS R P+LLRSA+EA++PD++LR+KAIS L A++EEQAE +AR++R  S + RF+C   PN+R T +F + R   +GNS+GQIYLM+ ++G     FGI +L  + +G DW+ SG FPRVT+C V +R+ G +K ASYT+QCVL +NYF+EKVYVFLWFWF  L CVT  +T+ WA N  +P RR  +I QY+RA++Q+S+ +ERDC RFV N LG DGVL+L+ VS  +SDLIALDV+A LW+ Y+ ++ T T++D++RFLEN+++ S
Sbjct:    1 MNPDAVLRIGKVFYTPYGGEGVDFVDQLNYQFTGGLLIIFIAVIGIRQYVGKPIQCWVPQEFTHSWEEYAENLCWVQNTYFLHPSDQVPEDDYELTHVKHIGYYQWIAIVLAGQVMLSWIPYLLWRVGSKRLPVLLRSAKEASVPDRELRQKAISCLVATLEEQAESTARYRRMTSNLKRFLCQLRPNTRITFLFFIVRFCFLGNSIGQIYLMKNFIGTNSTMFGIDVLNDLITGKDWETSGKFPRVTFCTVRVRKMGQIKPASYTLQCVLPINYFVEKVYVFLWFWFVILTCVTILSTIHWAFNTLLPVRRVAYIKQYIRAIRQLSNTEERDCTRFVNNNLGPDGVLILQVVSRVSSDLIALDVTATLWSNYRHAKITGTEEDINRFLENVNRGS 396          
BLAST of Innexin vs. TrEMBL
Match: A0A4E0RMZ1 (Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 6.096e-163
Identity = 219/396 (55.30%), Postives = 303/396 (76.52%), Query Frame = 2
Query:  224 MDSGSILRFGNLFHLNYGG-GVDFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSS 1405
            M+  ++LR G +F+  YGG GVDFVD+LN+QFTG +++I I++I  RQY+GKPIQCWVPQEFTH+WE+Y E++CWVQNTYFL PS  VP +D E    KH+ YYQW+ I L  Q +LS++P+L W++GS R P+LLRSA+EA++PD++LR+KAIS L A++EEQAE +AR++R  S + RF+C   PN+R T +F + R   +GNS+GQIYLM+ ++G     FGI +L  + +G DW+ SG FPRVT+C V +R+ G +K ASYT+QCVL +NYF+EKVYVFLWFWF  L CVT  +T+ WA N  +P RR  +I QY+RA++Q+S+ +ERDC RFV N LG DGVL+L+ VS  +SDLIALDV+A LW+ Y+ ++ T T++D++RFLEN+++ S
Sbjct:    1 MNPDAVLRIGKVFYTPYGGEGVDFVDQLNYQFTGGLLIIFIAVIGIRQYVGKPIQCWVPQEFTHSWEEYAENLCWVQNTYFLHPSDQVPEDDYELTHVKHIGYYQWIAIVLAGQVMLSWIPYLLWRVGSKRLPVLLRSAKEASVPDRELRQKAISCLVATLEEQAESTARYRRMTSNLKRFLCQLRPNTRITFLFFIVRFCFLGNSIGQIYLMKNFIGTNSTMFGIDVLNDLITGKDWETSGKFPRVTFCTVRVRKMGQIKPASYTLQCVLPINYFVEKVYVFLWFWFVILTCVTILSTIHWAFNTLLPVRRVAYIKQYIRAIRQLSNTEERDCTRFVNNNLGPDGVLILQVVSRVSSDLIALDVTATLWSNYRHAKITGTEEDINRFLENVNRGS 396          
BLAST of Innexin vs. TrEMBL
Match: A0A3Q0KNG6 (Innexin OS=Schistosoma mansoni OX=6183 GN=inx PE=3 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 1.096e-159
Identity = 216/396 (54.55%), Postives = 301/396 (76.01%), Query Frame = 2
Query:  224 MDSGSILRFGNLFHLNYGG-GVDFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSS 1405
            M+  ++LR G +F   YGG GVDFVD+LN+QFTG +++I I++I  RQY+GKPIQCWVPQEFTH+WE+Y E++CWVQNTYFL PS  VP +D E    +++ YYQW+ I L  QA+L ++P + W++GS R P+LLRSA+EA++PD++LR+KAIS L A++EEQAE +AR +R  S I R +CSF PN+R T +F + R+  IGNSVGQIYLM+ ++G     FG+ +L  + +G +W+ SG FPRVT+C V +R+ G +K ASYT+QCVL +NYF+EKVYVFLWFWF  L+ VT  +TL WA N  +P RR  +I QY+RA++Q+S+ +ERDC RFV   LG DGVL+L+ VS  +SDLIALDV+A LW+ Y+ ++ T T++D++RFLEN+++ +
Sbjct:    1 MNPDTVLRIGKVFETPYGGDGVDFVDQLNYQFTGGLLIIFIAVIGVRQYVGKPIQCWVPQEFTHSWEEYAENLCWVQNTYFLHPSDQVPEDDYELTKVRYIGYYQWIAIVLAGQAMLCWVPQILWRVGSKRLPVLLRSAKEASVPDRELRQKAISCLVATLEEQAESTARHRRATSTIKRILCSFRPNTRITFLFFIVRICFIGNSVGQIYLMKKFIGTNSTMFGMDVLNDLITGQEWETSGKFPRVTFCTVRVRKMGQIKPASYTLQCVLPINYFVEKVYVFLWFWFVILSIVTILSTLQWAFNTLVPVRRIAYIKQYIRAIRQLSNTEERDCTRFVNYNLGPDGVLILQVVSRVSSDLIALDVTATLWSNYRHAKITGTEEDINRFLENVNRGT 396          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000016539.1 (SMESG000016539.1)

HSP 1 Score: 801.586 bits (2069), Expect = 0.000e+0
Identity = 399/399 (100.00%), Postives = 399/399 (100.00%), Query Frame = 2
Query:  224 MDSGSILRFGNLFHLNYGGGVDFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAIV 1420
            MDSGSILRFGNLFHLNYGGGVDFVDKLNHQFTGAIILIIISLISARQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAIV
Sbjct:    1 MDSGSILRFGNLFHLNYGGGVDFVDKLNHQFTGAIILIIISLISARQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAIV 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000068735.1 (SMESG000068735.1)

HSP 1 Score: 452.981 bits (1164), Expect = 2.857e-157
Identity = 214/401 (53.37%), Postives = 297/401 (74.06%), Query Frame = 2
Query:  224 MDSGSILRFGNLFHLNYGG-GVDFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAIV 1420
            M+SG + + G LF   YGG GVDF D+LN+QFT  +I+I I+++S RQY+GKPIQCWVPQEFT AWE+Y E++CWV NTYFLL  Q +P++D E  + K+++YYQW+ I L  QA+LS++PHL W++ S R P+LLRSAREA LPD+DLR KA+S + AS+EEQA+ + R +R      R +    PN+R T +F+V R++ IGN+VGQIYLMQ ++G  +  FG  +L+ + +G DW+ +G FPRVTYC +L+RR G VK ASYT+QCVL +N+F+EKVYVFLWFWF  +A +T  +TL W  N  +P +R  ++ QYL+A++ ++S +ERDC RFV N LG DGV LL  VSS ASDLI+LDV+A LW  +++++ T T++DLSR LE  ++ +G +IV
Sbjct:   12 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNR-AGSSIV 411          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000033444.1 (SMESG000033444.1)

HSP 1 Score: 444.506 bits (1142), Expect = 4.470e-154
Identity = 207/399 (51.88%), Postives = 291/399 (72.93%), Query Frame = 2
Query:  224 MDSGSILRFGNLFHLNYGG-GVDFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVA 1414
            M+SG   R G LF + YGG GVDFVD+LN+QFT  ++++ I +I  RQY+GKPIQCWVPQEFT +WE+Y E++CWVQNTYFLLP + VP ND E    ++++YYQWV I L  QAV+S++PHL W++ S R P+LLRSAREA+ PD+++R+KAIS L A++EEQ E  ARF++      + +    P +R T +F+  R+L I N+VGQI++M+ ++G     FGI + R + +GN+ + S  FPRVTYC + +R+ G +K  SYT+QCVL +NYF+EKVYVFLWFWF  L+ +T  NT+ W +N+C+P RR QF+ QYL+ALK ++S DERDC RFV+  LG DG+ LL++VS  +SDLIALDV+  LW  YKR++    +DD+ R ++++++SS V 
Sbjct:    1 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000032206.1 (SMESG000032206.1)

HSP 1 Score: 426.402 bits (1095), Expect = 3.213e-147
Identity = 207/400 (51.75%), Postives = 288/400 (72.00%), Query Frame = 2
Query:  224 MDSGSILRFGNLFHLNYGG-GVDFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLS-RFLE---NIHKSS 1405
            MDS SIL+ G +F    GG GV F+D LN+Q++ A++++ I++I  RQYIGKPIQCWVPQEFT AWEDY E++CWVQNTYFL P + VP +D+E    + ++YYQW+ I +G QAVL YLP + W++GS RFP+LLR+++EA LPD++LR+KA++ L A++EEQA  + RF++NNS IY+ +C   P                G  + Q+YLM+ +LG  H  FG+ I + + +G+DWK SG+FPRVT+C V IR+ G +K A YT+QCVL +NYF+EK+Y FLWFWF SLAC T  NTL W I+L +  R+  F++ YL+ALKQ+SS +ERDC RFV+ +LG DG+ LLRAV++ ASDL+ALDV+  +W  YK ++ T T++D++  +LE    IHK S
Sbjct:    1 MDSDSILKLGRIFRSPLGGDGVSFIDVLNYQYSSAVLVVFIAIIGTRQYIGKPIQCWVPQEFTRAWEDYAENICWVQNTYFLPPEKAVPDSDVELHSAEFISYYQWIVIVMGAQAVLCYLPQIIWRVGSRRFPVLLRNSKEAILPDRELRRKAVACLVAALEEQAIRNCRFRKNNSTIYKLLCGLGP----------------GAELRQLYLMRDFLGTNHTTFGVMIFQDILAGHDWKVSGHFPRVTFCPVEIRKMGQIKPAIYTLQCVLPINYFVEKIYAFLWFWFVSLACATSFNTLQWFIDLFVKNRQVVFVSNYLKALKQLSSTEERDCGRFVEVVLGNDGIFLLRAVANVASDLMALDVTGIMWRNYKHAKVTGTEEDMAIVWLEAHTKIHKPS 384          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000051126.1 (SMESG000051126.1)

HSP 1 Score: 406.371 bits (1043), Expect = 3.645e-139
Identity = 188/399 (47.12%), Postives = 287/399 (71.93%), Query Frame = 2
Query:  224 MDSGSILRFGNLFHLNYGGG-VDFVDKLNHQFTGXXXXXXXXXXXXRQYIGKPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHVTYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRKKAISILTASIEEQAEFSARFQRNNSPI---YRFICSFAPNSRNTTIFLVSRVLSIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCRVLIRRWG-VKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMWAINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRAVSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSS 1405
            M++ + L+ G  FH  YGG  +DFVD+LN+Q++  ++ I IS+I  RQY+GKPIQCWVPQ+FT +WE+Y E++CW+Q+TY LL ++ +P +D E    K+++YYQWV I +G QA++SYLPHL W+L S R P+LL++AREA++PD+++R KAI  +   +EE  E   R++R    I   Y F C F P++R T +FL  R L I N++GQIYLM+ ++   + +FGI+++  +  G +WK  G FPR+TYC + +R++G +K AS+T QCVL +N+F+EK+YVFLW WF  LA +T  NTL W + +C+P+++ QFI +YL+ALK +S+++ R+C RFV   LG DG+ +L+AVS  +SDLIALDV+A LW  Y++++    +DD++R++E   K++
Sbjct:    1 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTGLLFIFISIIGFRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFC-FNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFTLLAVLTTLNTLQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMETSLKTN 398          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-91.434e-7437.36Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
inx-19.767e-7135.68Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-19.767e-7135.68Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-18.195e-7036.31Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-131.893e-6834.92Innexin [Source:UniProtKB/TrEMBL;Acc:O44887][more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx25.007e-1827.63gene:FBgn0027108 transcript:FBtr0301860[more]
Inx25.007e-1827.63gene:FBgn0027108 transcript:FBtr0071005[more]
Inx25.007e-1827.63gene:FBgn0027108 transcript:FBtr0332314[more]
Inx25.007e-1827.63gene:FBgn0027108 transcript:FBtr0071006[more]
shakB2.270e-1725.26gene:FBgn0085387 transcript:FBtr0112571[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL1.824e-7337.36Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL4.981e-5932.33Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q27295|EAT5_CAEEL7.970e-5729.62Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q23157|INX11_CAEEL5.291e-5533.79Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|Q19746|INX3_CAEEL1.838e-5230.45Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LVS81.091e-16455.25Innexin OS=Opisthorchis felineus OX=147828 GN=inx ... [more]
A0A074ZMI31.091e-16455.25Innexin OS=Opisthorchis viverrini OX=6198 GN=inx P... [more]
A0A504YQY56.096e-16355.30Innexin OS=Fasciola gigantica OX=46835 GN=inx PE=3... [more]
A0A4E0RMZ16.096e-16355.30Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 S... [more]
A0A3Q0KNG61.096e-15954.55Innexin OS=Schistosoma mansoni OX=6183 GN=inx PE=3... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016539.10.000e+0100.00SMESG000016539.1[more]
SMESG000068735.12.857e-15753.37SMESG000068735.1[more]
SMESG000033444.14.470e-15451.88SMESG000033444.1[more]
SMESG000032206.13.213e-14751.75SMESG000032206.1[more]
SMESG000051126.13.645e-13947.12SMESG000051126.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012872 ID=SMED30012872|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1451bp
CAACAATTTTAGCCAGTCAGTTGATTTTTCGATATCTCGATTTTTCCTCC
AATCAAATCACTCAAAGAAAATCTTATTAATCCACCCAATTCTTATTGTC
TCTAGAACCGCGGTTTTACTTTTATAGAAAGAGGATTTATCAAATTTGAC
CTGATCAACTTATTGAAATTATGATTATAGATTTGTGAAATTTATAAATC
AATTGAAAATAAGAAAAAATAAAATGGACAGCGGAAGCATTTTGAGATTT
GGGAATTTGTTTCATTTGAATTACGGAGGAGGAGTTGATTTCGTTGACAA
ATTGAATCATCAATTTACAGGAGCAATTATTCTCATTATCATTAGCCTAA
TCAGTGCTAGACAATACATCGGAAAACCAATTCAATGTTGGGTTCCACAG
GAGTTCACTCATGCTTGGGAAGATTATTTAGAACACATGTGTTGGGTCCA
AAACACTTACTTCCTCTTACCTTCGCAACCGGTGCCAATAAATGATTTAG
AAACATTTGATCAAAAGCATGTTACATATTATCAATGGGTGACCATATTT
CTTGGCCTTCAGGCAGTTTTATCTTATTTGCCTCATTTATTTTGGCAACT
AGGATCTCATAGGTTTCCTTTGTTGCTTCGAAGCGCAAGAGAAGCTGCGC
TACCGGACAAAGATTTAAGAAAAAAAGCAATATCGATATTAACAGCATCT
ATTGAAGAACAAGCTGAATTTTCCGCTAGATTTCAACGAAATAATTCTCC
AATTTATAGATTTATTTGTAGTTTTGCACCGAATTCTCGAAATACAACCA
TTTTTCTCGTCAGTCGTGTTTTAAGCATTGGGAATTCTGTCGGCCAAATT
TATCTTATGCAAACTTATCTCGGTTATCGACATCCATTTTTTGGCATTCA
AATTCTCAGAAGTGTTACATCAGGAAATGACTGGAAACAATCTGGCTATT
TTCCCAGAGTGACATATTGCCGAGTTCTAATAAGACGCTGGGGAGTAAAA
GATGCAAGCTATACAGTACAGTGTGTTCTCTCCTTAAATTATTTTCTGGA
AAAGGTATATGTCTTCCTCTGGTTTTGGTTTTTCAGTTTAGCCTGTGTGA
CCTTTTGCAATACTCTCATGTGGGCAATCAATTTGTGTATTCCTTTTCGA
AGAAATCAATTCATTACTCAATATTTGAGAGCACTCAAACAAGTTTCGTC
TAACGACGAACGGGACTGTGACAGATTTGTAAAAAATATTCTTGGAGCAG
ATGGCGTCCTTCTCTTGAGAGCAGTTTCCTCTGCAGCTAGCGATCTCATT
GCGTTAGATGTATCTGCAAAGCTTTGGGCAAAATATAAACGCTCACGGTT
CACTTGTACAGATGATGATTTATCTAGGTTCTTAGAAAATATTCATAAGT
CTTCTGGAGTTGCTATTGTTTAATCGTATTGATAAGATTGTTTTATTTTA
A
back to top

protein sequence of SMED30012872-orf-1

>SMED30012872-orf-1 ID=SMED30012872-orf-1|Name=SMED30012872-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=400bp
MDSGSILRFGNLFHLNYGGGVDFVDKLNHQFTGAIILIIISLISARQYIG
KPIQCWVPQEFTHAWEDYLEHMCWVQNTYFLLPSQPVPINDLETFDQKHV
TYYQWVTIFLGLQAVLSYLPHLFWQLGSHRFPLLLRSAREAALPDKDLRK
KAISILTASIEEQAEFSARFQRNNSPIYRFICSFAPNSRNTTIFLVSRVL
SIGNSVGQIYLMQTYLGYRHPFFGIQILRSVTSGNDWKQSGYFPRVTYCR
VLIRRWGVKDASYTVQCVLSLNYFLEKVYVFLWFWFFSLACVTFCNTLMW
AINLCIPFRRNQFITQYLRALKQVSSNDERDCDRFVKNILGADGVLLLRA
VSSAASDLIALDVSAKLWAKYKRSRFTCTDDDLSRFLENIHKSSGVAIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002142parenchyma
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 44..55
score: 57.0
coord: 242..251
score: 54.8
coord: 267..283
score: 55.29
coord: 72..81
score: 54.0
coord: 102..124
score: 49.91
coord: 194..208
score: 26.4
IPR000990InnexinPFAMPF00876Innexincoord: 22..371
e-value: 1.9E-98
score: 330.0
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 21..380
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 16..377
score: 29.856
NoneNo IPR availableTMHMMTMhelixcoord: 102..124
NoneNo IPR availableTMHMMTMhelixcoord: 27..45
NoneNo IPR availableTMHMMTMhelixcoord: 282..304