Y-box-binding protein 1

Overview
NameY-box-binding protein 1
Smed IDSMED30012869
Length (bp)1496
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Y-box-binding protein 1 (SMED30012869) t-SNE clustered cells

Violin plots show distribution of expression levels for Y-box-binding protein 1 (SMED30012869) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Y-box-binding protein 1 (SMED30012869) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Y-box-binding protein 1 (SMED30012869) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012869

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30012869SMESG000032189.1 Contig3807GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30012869SMESG000032189.1 Contig3807GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30012869SMESG000032189.1 dd_Smed_v4_114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30012869SMESG000032189.1 dd_Smed_v4_114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012869SMESG000032189.1 dd_Smed_v4_114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012869SMESG000032189.1 dd_Smed_v4_114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012869SMESG000032189.1 dd_Smed_v4_114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30012869SMESG000032189.1 dd_Smed_v4_114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012869SMESG000032189.1 dd_Smed_v4_114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012869SMESG000032189.1 dd_Smed_v4_114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30012869SMESG000032189.1 dd_Smed_v4_114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30012869SMESG000032189.1 dd_Smed_v4_114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30012869SMESG000032189.1 dd_Smed_v4_114_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012869SMESG000036645.1 SMESG000032189.1 Contig7366uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012869SMESG000036645.1 SMESG000032189.1 Contig7366newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012869SMESG000032189.1 Contig51877uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012869SMESG000032189.1 Contig51877newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012869SMESG000062652.1 SMESG000036645.1 SMESG000032189.1 Contig37943uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30012869SMESG000062652.1 SMESG000036645.1 SMESG000032189.1 Contig37943newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30012869SMESG000032189.1 dd_Smed_v6_114_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012869SMESG000032189.1 dd_Smed_v6_114_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30012869SMESG000032189.1 dd_Smed_v6_114_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30012869SMESG000032189.1 dd_Smed_v6_114_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30012869SMESG000032189.1 dd_Smed_v6_114_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Y-box-binding protein 1 vs. Ensembl Human
Match: YBX3 (Y-box binding protein 3 [Source:HGNC Symbol;Acc:HGNC:2428])

HSP 1 Score: 111.694 bits (278), Expect = 6.519e-27
Identity = 51/94 (54.26%), Postives = 70/94 (74.47%), Query Frame = 2
Query:  623 SELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            SE  +K+V+ + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ PDG  V+GS YA 
Sbjct:   79 SEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172          

HSP 2 Score: 104.375 bits (259), Expect = 2.755e-24
Identity = 51/90 (56.67%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            EK VL   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G DG  V+GS YA 
Sbjct:   83 EKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172          
BLAST of Y-box-binding protein 1 vs. Ensembl Human
Match: YBX3 (Y-box binding protein 3 [Source:HGNC Symbol;Acc:HGNC:2428])

HSP 1 Score: 111.694 bits (278), Expect = 2.185e-26
Identity = 51/94 (54.26%), Postives = 70/94 (74.47%), Query Frame = 2
Query:  623 SELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            SE  +K+V+ + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ PDG  V+GS YA 
Sbjct:   79 SEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172          

HSP 2 Score: 105.145 bits (261), Expect = 4.885e-24
Identity = 51/90 (56.67%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            EK VL   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G DG  V+GS YA 
Sbjct:   83 EKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172          
BLAST of Y-box-binding protein 1 vs. Ensembl Human
Match: YBX1 (Y-box binding protein 1 [Source:HGNC Symbol;Acc:HGNC:8014])

HSP 1 Score: 109.383 bits (272), Expect = 7.522e-26
Identity = 49/89 (55.06%), Postives = 67/89 (75.28%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            K+VI + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ P G  V+GS+YA 
Sbjct:   52 KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140          

HSP 2 Score: 101.293 bits (251), Expect = 4.717e-23
Identity = 48/93 (51.61%), Postives = 63/93 (67.74%), Query Frame = 2
Query:  158 SSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            +  +K V+   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G  G  V+GS+YA 
Sbjct:   48 AGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 140          
BLAST of Y-box-binding protein 1 vs. Ensembl Human
Match: YBX2 (Y-box binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17948])

HSP 1 Score: 105.145 bits (261), Expect = 4.510e-24
Identity = 51/97 (52.58%), Postives = 63/97 (64.95%), Query Frame = 2
Query:  143 ANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            A    S  +KPVL   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI ++NP    +SV DGE + FDVV+G KG E  NV G  G  VKGS YA
Sbjct:   78 APPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYA 174          

HSP 2 Score: 104.375 bits (259), Expect = 7.480e-24
Identity = 47/88 (53.41%), Postives = 63/88 (71.59%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            K V+   VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI ++NP    +SV DGE + FD+V+G+ G EA NV+ P G  VKGS YA
Sbjct:   87 KPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYA 174          
BLAST of Y-box-binding protein 1 vs. Ensembl Human
Match: YBX2 (Y-box binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17948])

HSP 1 Score: 105.145 bits (261), Expect = 4.510e-24
Identity = 51/97 (52.58%), Postives = 63/97 (64.95%), Query Frame = 2
Query:  143 ANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            A    S  +KPVL   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI ++NP    +SV DGE + FDVV+G KG E  NV G  G  VKGS YA
Sbjct:   78 APPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYA 174          

HSP 2 Score: 104.375 bits (259), Expect = 7.480e-24
Identity = 47/88 (53.41%), Postives = 63/88 (71.59%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            K V+   VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI ++NP    +SV DGE + FD+V+G+ G EA NV+ P G  VKGS YA
Sbjct:   87 KPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYA 174          
BLAST of Y-box-binding protein 1 vs. Ensembl Celegans
Match: cey-1 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:O62213])

HSP 1 Score: 115.161 bits (287), Expect = 2.204e-29
Identity = 52/94 (55.32%), Postives = 69/94 (73.40%), Query Frame = 2
Query:  152 TESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
             E   +KPV    ++G VKWFNVK  YGF+NR D NEDIF+HQ+AI+ +NPN   +S+ D EE++FD+V+G KGLE A+V G DG  V+GS+YA
Sbjct:    8 AEQPADKPVKATKVKGTVKWFNVKNGYGFINRTDTNEDIFVHQTAIINNNPNKYLRSLGDNEEVMFDIVEGSKGLEAASVTGPDGGPVQGSKYA 101          

HSP 2 Score: 104.375 bits (259), Expect = 1.494e-25
Identity = 48/88 (54.55%), Postives = 63/88 (71.59%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            K V  + V G VKWFNVK GYGF+ R D  EDIF+H +AI+ +NP    +S+ D EE++FDIV+G  G EAA+V+ PDG  V+GS+YA
Sbjct:   14 KPVKATKVKGTVKWFNVKNGYGFINRTDTNEDIFVHQTAIINNNPNKYLRSLGDNEEVMFDIVEGSKGLEAASVTGPDGGPVQGSKYA 101          
BLAST of Y-box-binding protein 1 vs. Ensembl Celegans
Match: cey-2 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91306])

HSP 1 Score: 95.9005 bits (237), Expect = 5.611e-22
Identity = 46/94 (48.94%), Postives = 66/94 (70.21%), Query Frame = 2
Query:  620 ESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEH-PRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEY 898
            E E   K  I + + GKVKW++V R YGF+ R+D ++DIF+H +AI KS  E    +++ D EE+LFD+V+GK+G EAANV+ P+G+ V GS Y
Sbjct:   53 EEEQKSKTAITTGLQGKVKWYSVLRRYGFISRNDGEKDIFVHQTAIAKSATEKFYLRTLGDDEEVLFDLVEGKNGPEAANVTGPNGDNVIGSRY 146          

HSP 2 Score: 90.8929 bits (224), Expect = 2.933e-20
Identity = 44/93 (47.31%), Postives = 61/93 (65.59%), Query Frame = 2
Query:  155 ESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKS-NPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEY 430
            E    K  +  G+QGKVKW++V  RYGF++R D  +DIF+HQ+AI KS       +++ D EE+LFD+V+G  G E ANV G +G+ V GS Y
Sbjct:   54 EEQKSKTAITTGLQGKVKWYSVLRRYGFISRNDGEKDIFVHQTAIAKSATEKFYLRTLGDDEEVLFDLVEGKNGPEAANVTGPNGDNVIGSRY 146          
BLAST of Y-box-binding protein 1 vs. Ensembl Celegans
Match: cey-3 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91398])

HSP 1 Score: 92.8189 bits (229), Expect = 6.048e-21
Identity = 47/119 (39.50%), Postives = 77/119 (64.71%), Query Frame = 2
Query:  545 RNNQNRERIPSFTRKKNTSENKENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEH-PRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEY 898
            +++ ++ R+P+  R +   E ++        K V+ + + GKVKW++V R YGF+ R D ++D+F+H +AI KS+ E    +++ D EE+LFD+V GK+G EAANV+ P G  V GS+Y
Sbjct:   33 KDDTSKHRLPAAERIRIWEEEQK-------AKIVLTAGLQGKVKWYSVLRRYGFISRSDGEKDVFVHQTAISKSDTEKFYLRTLADEEEVLFDLVDGKNGPEAANVTGPAGVNVSGSKY 144          

HSP 2 Score: 89.7373 bits (221), Expect = 5.745e-20
Identity = 45/93 (48.39%), Postives = 61/93 (65.59%), Query Frame = 2
Query:  155 ESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNH-PRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEY 430
            E    K VL  G+QGKVKW++V  RYGF++R D  +D+F+HQ+AI KS+      +++ D EE+LFD+V G  G E ANV G  G  V GS+Y
Sbjct:   52 EEQKAKIVLTAGLQGKVKWYSVLRRYGFISRSDGEKDVFVHQTAISKSDTEKFYLRTLADEEEVLFDLVDGKNGPEAANVTGPAGVNVSGSKY 144          
BLAST of Y-box-binding protein 1 vs. Ensembl Celegans
Match: cey-3 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91398])

HSP 1 Score: 92.8189 bits (229), Expect = 6.048e-21
Identity = 47/119 (39.50%), Postives = 77/119 (64.71%), Query Frame = 2
Query:  545 RNNQNRERIPSFTRKKNTSENKENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEH-PRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEY 898
            +++ ++ R+P+  R +   E ++        K V+ + + GKVKW++V R YGF+ R D ++D+F+H +AI KS+ E    +++ D EE+LFD+V GK+G EAANV+ P G  V GS+Y
Sbjct:   33 KDDTSKHRLPAAERIRIWEEEQK-------AKIVLTAGLQGKVKWYSVLRRYGFISRSDGEKDVFVHQTAISKSDTEKFYLRTLADEEEVLFDLVDGKNGPEAANVTGPAGVNVSGSKY 144          

HSP 2 Score: 89.7373 bits (221), Expect = 5.745e-20
Identity = 45/93 (48.39%), Postives = 61/93 (65.59%), Query Frame = 2
Query:  155 ESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNH-PRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEY 430
            E    K VL  G+QGKVKW++V  RYGF++R D  +D+F+HQ+AI KS+      +++ D EE+LFD+V G  G E ANV G  G  V GS+Y
Sbjct:   52 EEQKAKIVLTAGLQGKVKWYSVLRRYGFISRSDGEKDVFVHQTAISKSDTEKFYLRTLADEEEVLFDLVDGKNGPEAANVTGPAGVNVSGSKY 144          
BLAST of Y-box-binding protein 1 vs. Ensembl Celegans
Match: cey-4 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5EDV3])

HSP 1 Score: 92.0485 bits (227), Expect = 1.831e-20
Identity = 45/92 (48.91%), Postives = 64/92 (69.57%), Query Frame = 2
Query:  170 KPVLCEGIQGKVKWFNVKLRYGFVNR---YDNNEDIFIHQSAIVKSNP-NHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            K V+  G++G VKWF+V+ RYGFV R    D NED F+HQ+AI KS+      ++++D E ++FD+V+G+KG E ANV G DG  V+GS +A
Sbjct:   82 KKVIETGVKGHVKWFSVRGRYGFVARDKPTDENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSRFA 173          

HSP 2 Score: 88.1965 bits (217), Expect = 3.065e-19
Identity = 46/98 (46.94%), Postives = 65/98 (66.33%), Query Frame = 2
Query:  620 ESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRH---DNQEDIFIHHSAIVKSNP-EHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            E +L  K+VI + V G VKWF+V+  YGFV R    D  ED F+H +AI KS+  +   ++++D E ++FDIV+G  G EAANV+ PDG  V+GS +A
Sbjct:   76 EEDLASKKVIETGVKGHVKWFSVRGRYGFVARDKPTDENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSRFA 173          
BLAST of Y-box-binding protein 1 vs. Ensembl Fly
Match: yps (gene:FBgn0022959 transcript:FBtr0076027)

HSP 1 Score: 108.612 bits (270), Expect = 9.430e-26
Identity = 49/89 (55.06%), Postives = 66/89 (74.16%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            KEVI + V G VKWFNVK GYGF+ R+D +ED+F+H SAI ++NP+   +SV DGE + FD+V G+ G EAANV+ P G  V+GS++A 
Sbjct:   55 KEVIATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAA 143          

HSP 2 Score: 100.523 bits (249), Expect = 5.878e-23
Identity = 54/111 (48.65%), Postives = 66/111 (59.46%), Query Frame = 2
Query:  104 EMADHQNGQNENDANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            E  D   GQ    A  T     K V+   + G VKWFNVK  YGF+NR D  ED+F+HQSAI ++NP    +SV DGE + FDVV G KG E ANV G  G  V+GS++A 
Sbjct:   38 EPLDELQGQQGQPAPPT-----KEVIATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAA 143          
BLAST of Y-box-binding protein 1 vs. Ensembl Fly
Match: yps (gene:FBgn0022959 transcript:FBtr0305992)

HSP 1 Score: 108.227 bits (269), Expect = 1.074e-25
Identity = 49/89 (55.06%), Postives = 66/89 (74.16%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            KEVI + V G VKWFNVK GYGF+ R+D +ED+F+H SAI ++NP+   +SV DGE + FD+V G+ G EAANV+ P G  V+GS++A 
Sbjct:   55 KEVIATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAA 143          

HSP 2 Score: 100.138 bits (248), Expect = 6.300e-23
Identity = 54/111 (48.65%), Postives = 66/111 (59.46%), Query Frame = 2
Query:  104 EMADHQNGQNENDANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            E  D   GQ    A  T     K V+   + G VKWFNVK  YGF+NR D  ED+F+HQSAI ++NP    +SV DGE + FDVV G KG E ANV G  G  V+GS++A 
Sbjct:   38 EPLDELQGQQGQPAPPT-----KEVIATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFAA 143          
BLAST of Y-box-binding protein 1 vs. Ensembl Fly
Match: lin-28 (gene:FBgn0035626 transcript:FBtr0077090)

HSP 1 Score: 59.3066 bits (142), Expect = 6.932e-10
Identity = 30/79 (37.97%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  662 LGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEY 898
            LGK KWFNV +G+GF+  +D  +++F+H S I  S      +S+ + EE+ F+  +   G EA  VS+  G   +GS Y
Sbjct:   40 LGKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSG----FRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTY 114          

HSP 2 Score: 53.5286 bits (127), Expect = 5.991e-8
Identity = 28/78 (35.90%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  197 GKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEY 430
            GK KWFNV   +GF+   D  +++F+HQS I  S      +S+ + EE+ F+  +  +GLE   V    G   +GS Y
Sbjct:   41 GKCKWFNVAKGWGFLTPNDGGQEVFVHQSVIQMSG----FRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTY 114          
BLAST of Y-box-binding protein 1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 108.997 bits (271), Expect = 4.710e-26
Identity = 49/89 (55.06%), Postives = 67/89 (75.28%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            K+VI + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ P G  V+GS+YA 
Sbjct:   32 KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 120          

HSP 2 Score: 101.293 bits (251), Expect = 2.437e-23
Identity = 48/90 (53.33%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            +K V+   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G  G  V+GS+YA 
Sbjct:   31 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 120          
BLAST of Y-box-binding protein 1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 108.997 bits (271), Expect = 4.710e-26
Identity = 49/89 (55.06%), Postives = 67/89 (75.28%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            K+VI + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ P G  V+GS+YA 
Sbjct:   32 KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 120          

HSP 2 Score: 101.293 bits (251), Expect = 2.437e-23
Identity = 48/90 (53.33%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            +K V+   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G  G  V+GS+YA 
Sbjct:   31 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 120          
BLAST of Y-box-binding protein 1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 108.997 bits (271), Expect = 4.904e-26
Identity = 49/89 (55.06%), Postives = 67/89 (75.28%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            K+VI + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ P G  V+GS+YA 
Sbjct:   32 KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 120          

HSP 2 Score: 101.293 bits (251), Expect = 2.613e-23
Identity = 48/90 (53.33%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            +K V+   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G  G  V+GS+YA 
Sbjct:   31 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 120          
BLAST of Y-box-binding protein 1 vs. Ensembl Zebrafish
Match: lin28a (lin-28 homolog A (C. elegans) [Source:NCBI gene;Acc:394066])

HSP 1 Score: 48.9062 bits (115), Expect = 3.648e-6
Identity = 28/84 (33.33%), Postives = 43/84 (51.19%), Query Frame = 2
Query:  197 GKVKWFNVKLRYGFVNR-------YDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSE 427
            G  KWFNV++ +GF++         D+  D+F+HQS +         +S+++GE + F   +  KGLE   V G  G    GSE
Sbjct:   36 GVCKWFNVRMGFGFLSMTHREGICLDSPVDVFVHQSKLHMEG----FRSLKEGEAVEFTFKRSSKGLESLQVTGPGGAPCVGSE 115          
BLAST of Y-box-binding protein 1 vs. Ensembl Zebrafish
Match: lin28a (lin-28 homolog A (C. elegans) [Source:NCBI gene;Acc:394066])

HSP 1 Score: 48.1358 bits (113), Expect = 4.943e-6
Identity = 28/84 (33.33%), Postives = 43/84 (51.19%), Query Frame = 2
Query:  197 GKVKWFNVKLRYGFVNR-------YDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSE 427
            G  KWFNV++ +GF++         D+  D+F+HQS +         +S+++GE + F   +  KGLE   V G  G    GSE
Sbjct:   28 GVCKWFNVRMGFGFLSMTHREGICLDSPVDVFVHQSKLHMEG----FRSLKEGEAVEFTFKRSSKGLESLQVTGPGGAPCVGSE 107          
BLAST of Y-box-binding protein 1 vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:Xenbase;Acc:XB-GENE-942074])

HSP 1 Score: 109.768 bits (273), Expect = 3.210e-26
Identity = 49/90 (54.44%), Postives = 68/90 (75.56%), Query Frame = 2
Query:  635 QKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            +K+VI + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ P G  V+GS+YA 
Sbjct:   29 EKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 118          

HSP 2 Score: 102.834 bits (255), Expect = 8.490e-24
Identity = 49/90 (54.44%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            EK V+   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G  G  V+GS+YA 
Sbjct:   29 EKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 118          
BLAST of Y-box-binding protein 1 vs. Ensembl Xenopus
Match: ybx3 (Y-box binding protein 3 [Source:NCBI gene;Acc:548572])

HSP 1 Score: 103.605 bits (257), Expect = 1.756e-24
Identity = 46/89 (51.69%), Postives = 64/89 (71.91%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            ++V+ + V G VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V G+ G EAANV+ P G  V+GS YA 
Sbjct:   29 RKVLATKVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGEVVEFDVVAGEKGAEAANVTGPKGAPVQGSRYAA 117          

HSP 2 Score: 103.219 bits (256), Expect = 2.402e-24
Identity = 49/87 (56.32%), Postives = 59/87 (67.82%), Query Frame = 2
Query:  176 VLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            VL   +QG VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV G KG E ANV G  G  V+GS YA 
Sbjct:   31 VLATKVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGEVVEFDVVAGEKGAEAANVTGPKGAPVQGSRYAA 117          
BLAST of Y-box-binding protein 1 vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:Xenbase;Acc:XB-GENE-942074])

HSP 1 Score: 104.375 bits (259), Expect = 2.912e-24
Identity = 46/87 (52.87%), Postives = 64/87 (73.56%), Query Frame = 2
Query:  644 VIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
             + + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ P G  V+GS+YA 
Sbjct:   40 CVTTKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 126          

HSP 2 Score: 96.6709 bits (239), Expect = 1.598e-21
Identity = 46/82 (56.10%), Postives = 58/82 (70.73%), Query Frame = 2
Query:  191 IQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G  G  V+GS+YA 
Sbjct:   45 VLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 126          
BLAST of Y-box-binding protein 1 vs. Ensembl Xenopus
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:100216028])

HSP 1 Score: 49.6766 bits (117), Expect = 3.894e-6
Identity = 27/84 (32.14%), Postives = 43/84 (51.19%), Query Frame = 2
Query:  197 GKVKWFNVKLRYGFVNR-------YDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSE 427
            G  KWFNV++ +GF++         +N  D+F+HQS +         +S+++GE + F   +  KG E   V G  GN   G+E
Sbjct:   35 GHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEG----FRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGNE 114          
BLAST of Y-box-binding protein 1 vs. Ensembl Xenopus
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:100216028])

HSP 1 Score: 49.6766 bits (117), Expect = 4.635e-6
Identity = 27/84 (32.14%), Postives = 43/84 (51.19%), Query Frame = 2
Query:  197 GKVKWFNVKLRYGFVNR-------YDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSE 427
            G  KWFNV++ +GF++         +N  D+F+HQS +         +S+++GE + F   +  KG E   V G  GN   G+E
Sbjct:   59 GHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYMEG----FRSLKEGEPVEFTFKKSSKGFESLRVTGPGGNPCLGNE 138          
BLAST of Y-box-binding protein 1 vs. Ensembl Mouse
Match: Ybx3 (Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670])

HSP 1 Score: 112.079 bits (279), Expect = 3.367e-27
Identity = 50/93 (53.76%), Postives = 69/93 (74.19%), Query Frame = 2
Query:  626 ELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            E  +K+V+ + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ PDG  V+GS YA 
Sbjct:   72 EDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 164          

HSP 2 Score: 105.916 bits (263), Expect = 4.041e-25
Identity = 51/90 (56.67%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            EK VL   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G DG  V+GS YA 
Sbjct:   75 EKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 164          
BLAST of Y-box-binding protein 1 vs. Ensembl Mouse
Match: Ybx3 (Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670])

HSP 1 Score: 111.309 bits (277), Expect = 1.699e-26
Identity = 50/93 (53.76%), Postives = 69/93 (74.19%), Query Frame = 2
Query:  626 ELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            E  +K+V+ + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ PDG  V+GS YA 
Sbjct:   72 EDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 164          

HSP 2 Score: 106.301 bits (264), Expect = 1.130e-24
Identity = 51/90 (56.67%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            EK VL   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G DG  V+GS YA 
Sbjct:   75 EKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 164          
BLAST of Y-box-binding protein 1 vs. Ensembl Mouse
Match: Ybx1 (Y box protein 1 [Source:MGI Symbol;Acc:MGI:99146])

HSP 1 Score: 109.383 bits (272), Expect = 5.496e-26
Identity = 49/89 (55.06%), Postives = 67/89 (75.28%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            K+VI + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ P G  V+GS+YA 
Sbjct:   50 KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 138          

HSP 2 Score: 101.293 bits (251), Expect = 3.554e-23
Identity = 48/93 (51.61%), Postives = 63/93 (67.74%), Query Frame = 2
Query:  158 SSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            +  +K V+   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G  G  V+GS+YA 
Sbjct:   46 AGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 138          
BLAST of Y-box-binding protein 1 vs. Ensembl Mouse
Match: Ybx2 (Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372])

HSP 1 Score: 106.686 bits (265), Expect = 7.338e-25
Identity = 52/97 (53.61%), Postives = 64/97 (65.98%), Query Frame = 2
Query:  143 ANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            A    S  +KPVL   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI ++NP    +SV DGE + FDVV+G KG E ANV G  G  VKGS YA
Sbjct:   79 APPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRYA 175          

HSP 2 Score: 106.301 bits (264), Expect = 9.238e-25
Identity = 48/88 (54.55%), Postives = 64/88 (72.73%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            K V+   VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI ++NP    +SV DGE + FD+V+G+ G EAANV+ P G  VKGS YA
Sbjct:   88 KPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRYA 175          
BLAST of Y-box-binding protein 1 vs. Ensembl Mouse
Match: Ybx2 (Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372])

HSP 1 Score: 103.605 bits (257), Expect = 2.273e-24
Identity = 47/95 (49.47%), Postives = 65/95 (68.42%), Query Frame = 2
Query:  617 RESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            R  +    + +   VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI ++NP    +SV DGE + FD+V+G+ G EAANV+ P G  VKGS YA
Sbjct:    4 RAGQAGSAKALAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRYA 98          

HSP 2 Score: 98.5969 bits (244), Expect = 1.423e-22
Identity = 47/86 (54.65%), Postives = 58/86 (67.44%), Query Frame = 2
Query:  176 VLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
             L   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI ++NP    +SV DGE + FDVV+G KG E ANV G  G  VKGS YA
Sbjct:   13 ALAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRYA 98          
BLAST of Y-box-binding protein 1 vs. UniProt/SwissProt
Match: sp|P41824|YBOXH_APLCA (Y-box factor homolog OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.119e-27
Identity = 55/102 (53.92%), Postives = 76/102 (74.51%), Query Frame = 2
Query:  602 ENKENRESELIQKE--VIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            EN+ ++E    QKE  +I S V G VKWFNVK GYGF+ R D +ED+F+H +AIVK+NP    +SV DGE++ FD+V+G+ G EAANV+ P+G+ V+GS+YA
Sbjct:   12 ENQPDQEQNEEQKEKKIIASQVSGTVKWFNVKSGYGFINRDDTKEDVFVHQTAIVKNNPRKYLRSVGDGEKVEFDVVEGEKGNEAANVTGPEGSNVQGSKYA 113          

HSP 2 Score: 113.235 bits (282), Expect = 3.846e-27
Identity = 53/102 (51.96%), Postives = 72/102 (70.59%), Query Frame = 2
Query:  128 QNENDANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            +N+ D  + E   EK ++   + G VKWFNVK  YGF+NR D  ED+F+HQ+AIVK+NP    +SV DGE++ FDVV+G KG E ANV G +G+ V+GS+YA
Sbjct:   12 ENQPDQEQNEEQKEKKIIASQVSGTVKWFNVKSGYGFINRDDTKEDVFVHQTAIVKNNPRKYLRSVGDGEKVEFDVVEGEKGNEAANVTGPEGSNVQGSKYA 113          
BLAST of Y-box-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q62764|YBOX3_RAT (Y-box-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ybx3 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 3.827e-26
Identity = 51/94 (54.26%), Postives = 70/94 (74.47%), Query Frame = 2
Query:  623 SELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            SE  +K+V+ + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ PDG  V+GS YA 
Sbjct:   71 SEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 164          

HSP 2 Score: 105.916 bits (263), Expect = 8.614e-24
Identity = 51/90 (56.67%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            EK VL   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G DG  V+GS YA 
Sbjct:   75 EKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 164          
BLAST of Y-box-binding protein 1 vs. UniProt/SwissProt
Match: sp|P16989|YBOX3_HUMAN (Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4)

HSP 1 Score: 111.694 bits (278), Expect = 1.049e-25
Identity = 51/94 (54.26%), Postives = 70/94 (74.47%), Query Frame = 2
Query:  623 SELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            SE  +K+V+ + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ PDG  V+GS YA 
Sbjct:   79 SEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172          

HSP 2 Score: 105.145 bits (261), Expect = 2.346e-23
Identity = 51/90 (56.67%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            EK VL   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G DG  V+GS YA 
Sbjct:   83 EKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 172          
BLAST of Y-box-binding protein 1 vs. UniProt/SwissProt
Match: sp|P21573|YBOX1_XENLA (Y-box-binding protein 1 OS=Xenopus laevis OX=8355 GN=ybx1 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.097e-25
Identity = 49/89 (55.06%), Postives = 68/89 (76.40%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            K+VI + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ P+G  V+GS+YA 
Sbjct:   30 KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPEGVPVQGSKYAA 118          

HSP 2 Score: 102.834 bits (255), Expect = 5.229e-23
Identity = 48/90 (53.33%), Postives = 63/90 (70.00%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            +K V+   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G +G  V+GS+YA 
Sbjct:   29 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPEGVPVQGSKYAA 118          
BLAST of Y-box-binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9JKB3|YBOX3_MOUSE (Y-box-binding protein 3 OS=Mus musculus OX=10090 GN=Ybx3 PE=1 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 1.188e-25
Identity = 50/93 (53.76%), Postives = 69/93 (74.19%), Query Frame = 2
Query:  626 ELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            E  +K+V+ + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ PDG  V+GS YA 
Sbjct:   72 EDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 164          

HSP 2 Score: 106.301 bits (264), Expect = 7.902e-24
Identity = 51/90 (56.67%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            EK VL   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G DG  V+GS YA 
Sbjct:   75 EKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAA 164          
BLAST of Y-box-binding protein 1 vs. TrEMBL
Match: A0A0H5RZM6 (Bm4155 OS=Brugia malayi OX=6279 GN=Bm4155 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.058e-39
Identity = 99/248 (39.92%), Postives = 147/248 (59.27%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNN-EDIFIHQSAIVKSNP-NHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYALRFPXXXXXXXXXXXXXTRTKSNSESGTRTHDYVRGGRNNQNRERIPSFTRKKNTSENKENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQ-EDIFIHHSAIVKSNP-EHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEY 898
            +KP+L +G++GKVKW++V+  YGF+ R DN   D+F+HQ+AI KS    +  +++ DGEE+LFD+VQG +G E ANV G +   V+GS+Y   F     R              SE   R +   +G + N+  E   +  +K NT         E  ++      V GKVKW++V+  YGF+ R DN+  D+F+H +AI KS   ++  +++ DGEE+LFDIVQGK G EAANV+ P+   V+GS+Y
Sbjct:   66 KKPILEKGVKGKVKWYSVRYHYGFIARDDNKGNDVFVHQTAIAKSRIIKYYLRTLGDGEEVLFDIVQGKQGPEAANVTGPNSTEVRGSKYH-NFQFYTFRRRMAYNRERVAHKESEKYRRNN---QGRKPNEKLETDNADIKKPNT---------EHRRRFRHFRGVKGKVKWYSVRYHYGFIARDDNKGNDVFVHQTAIAKSRIIKYYLRTLGDGEEVLFDIVQGKQGPEAANVTGPNSTEVRGSKY 300          

HSP 2 Score: 93.5893 bits (231), Expect = 1.270e-16
Identity = 46/95 (48.42%), Postives = 67/95 (70.53%), Query Frame = 2
Query:  620 ESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQ-EDIFIHHSAIVKSNP-EHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEY 898
            E E  +K ++   V GKVKW++V+  YGF+ R DN+  D+F+H +AI KS   ++  +++ DGEE+LFDIVQGK G EAANV+ P+   V+GS+Y
Sbjct:   61 EMEQAKKPILEKGVKGKVKWYSVRYHYGFIARDDNKGNDVFVHQTAIAKSRIIKYYLRTLGDGEEVLFDIVQGKQGPEAANVTGPNSTEVRGSKY 155          
BLAST of Y-box-binding protein 1 vs. TrEMBL
Match: Q23960 (Y-box protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 3.432e-38
Identity = 75/110 (68.18%), Postives = 86/110 (78.18%), Query Frame = 2
Query:  107 MADHQNGQNENDANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            MA++Q   +E + N  +SS +K +L  GI GKVKWFNVK  YGFV R DN EDIFIHQSAIVKSNP+HPRKSV +GEEILFD+V+G KG E ANV  IDG CVKGSEYAL
Sbjct:    1 MANNQEKTDEYEGNAADSSKQKQLLHTGITGKVKWFNVKRGYGFVCRNDNQEDIFIHQSAIVKSNPDHPRKSVGEGEEILFDIVKGAKGNEAANVSAIDGKCVKGSEYAL 110          

HSP 2 Score: 149.058 bits (375), Expect = 1.260e-37
Identity = 73/106 (68.87%), Postives = 85/106 (80.19%), Query Frame = 2
Query:  587 KKNTSENKENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            ++ T E + N      QK+++ + + GKVKWFNVKRGYGFVCR+DNQEDIFIH SAIVKSNP+HPRKSV +GEEILFDIV+G  G EAANVSA DG  VKGSEYAL
Sbjct:    5 QEKTDEYEGNAADSSKQKQLLHTGITGKVKWFNVKRGYGFVCRNDNQEDIFIHQSAIVKSNPDHPRKSVGEGEEILFDIVKGAKGNEAANVSAIDGKCVKGSEYAL 110          
BLAST of Y-box-binding protein 1 vs. TrEMBL
Match: A0A3M7SJ45 (Nuclease-sensitive element-binding 1 isoform X4 OS=Brachionus plicatilis OX=10195 GN=BpHYR1_042057 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 4.146e-38
Identity = 92/244 (37.70%), Postives = 132/244 (54.10%), Query Frame = 2
Query:  176 VLCEG-IQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKG-LEVANVCGIDGNCVKGSEYALRFPXXXXXXXXXXXXXTRTKSNSESGTRTHDYVRGGRNNQNRERIPSFTRKKNTSENKENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            ++ EG + GKVKWFNVK++YGF++   NNED+F+H SAI+K+NPN  + S+ +GE + FD+++   G LE  NV G DG                                         YV G R                 S +K NR SE   K+ +   V GKVKWFNVK G+GF+ R DN +D++ H++AI   NP+H  +S+ DGE + F+IV+G  G EA++++  +G  V+GSEYA
Sbjct:  121 IINEGRVTGKVKWFNVKIKYGFIHCDYNNEDVFVHSSAIIKNNPNKYKASLSEGEPVEFDILKRADGKLEAVNVSGPDG----------------------------------------AYVVGSR----------------YSPDKINR-SEQSDKKYVEENVAGKVKWFNVKAGFGFISRSDNDQDVYAHYTAIANKNPDHRVRSLADGEAVQFNIVEGSKGAEASDITGVNGEAVQGSEYA 307          

HSP 2 Score: 100.908 bits (250), Expect = 7.242e-19
Identity = 44/96 (45.83%), Postives = 71/96 (73.96%), Query Frame = 2
Query:  146 NKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            N++E S++K  + E + GKVKWFNVK  +GF++R DN++D++ H +AI   NP+H  +S+ DGE + F++V+G KG E +++ G++G  V+GSEYA
Sbjct:  213 NRSEQSDKK-YVEENVAGKVKWFNVKAGFGFISRSDNDQDVYAHYTAIANKNPDHRVRSLADGEAVQFNIVEGSKGAEASDITGVNGEAVQGSEYA 307          

HSP 3 Score: 73.559 bits (179), Expect = 5.088e-10
Identity = 35/81 (43.21%), Postives = 52/81 (64.20%), Query Frame = 2
Query:  659 VLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            V G  KW+N K G+GFV R D+  DIF+H S I  ++   P  S++DGE + FD++Q  +   A NV+ P+G  ++GS+YA
Sbjct:  478 VHGVAKWYNYKNGFGFVTRTDSNLDIFVHKSGIQATDKAVP--SLDDGESVEFDVIQDGNKLLAINVTGPNGIVLRGSKYA 556          

HSP 4 Score: 70.4774 bits (171), Expect = 4.776e-9
Identity = 35/81 (43.21%), Postives = 51/81 (62.96%), Query Frame = 2
Query:  191 IQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            + G  KW+N K  +GFV R D+N DIF+H+S I  ++   P  S++DGE + FDV+Q    L   NV G +G  ++GS+YA
Sbjct:  478 VHGVAKWYNYKNGFGFVTRTDSNLDIFVHKSGIQATDKAVP--SLDDGESVEFDVIQDGNKLLAINVTGPNGIVLRGSKYA 556          

HSP 5 Score: 69.3218 bits (168), Expect = 9.139e-9
Identity = 34/87 (39.08%), Postives = 51/87 (58.62%), Query Frame = 2
Query:  635 QKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAI----VKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFV 883
            QKE I + + G VKWFN  +G+GF+ R D +ED+F HHS+I    +       R  + + E + FD+V+  +G EA N++  DG  V
Sbjct:   18 QKEPIATNIKGAVKWFNRLKGFGFITRDDTKEDVFAHHSSIKPFSINLRRLKRRLFLIEQERVEFDVVKAPNGLEAVNIAGKDGYLV 104          
BLAST of Y-box-binding protein 1 vs. TrEMBL
Match: A0A0K0FCY1 (Ypsilon schachtel (inferred by orthology to a D. melanogaster protein) OS=Strongyloides venezuelensis OX=75913 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 9.623e-35
Identity = 96/263 (36.50%), Postives = 139/263 (52.85%), Query Frame = 2
Query:  107 MADHQNGQNENDANKTESSN--EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYALRFPXXXXXXXXXXXXXTRTKSNSESGTRTHDYVRGGRNNQNRERIPSFTRKKNTSENKENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKG 889
            +++ QN + +++ N   SSN  EK VL  G+ G VKW+NVKL YGF+ R+D ++ +F++  +I K NPN   +S+   EE++FDVV+G+KGLE  NV G +G  VKGS    R+                                  R  +N  R   F RK N     EN+E +  QK  +   V GKV +FN  +GYGF+ R+D  E++F H   +VK NP+     +  G  +LFDIV+G  G EAA V+  +G  + G
Sbjct:   44 ISNKQNKEAKDNGNTISSSNKEEKKVLETGVTGTVKWYNVKLGYGFIRRHDTSDCVFVYHQSIAKKNPNKRLRSLGTDEEVVFDVVEGMKGLEAGNVTGPNGEPVKGSHIDKRYK---------------------------------RKYRNGRRFQRFYRKFNM----ENKERDPNQK-YVEEKVQGKVLFFNSFKGYGFIKRNDKDENVFCHVVDVVKKNPKK-FYYLPTGTPVLFDIVEGLKGPEAAFVTDGEGKPLPG 267          

HSP 2 Score: 93.2041 bits (230), Expect = 7.363e-17
Identity = 45/99 (45.45%), Postives = 65/99 (65.66%), Query Frame = 2
Query:  596 TSENKENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGS 892
            +S NKE       +K+V+ + V G VKW+NVK GYGF+ RHD  + +F++H +I K NP    +S+   EE++FD+V+G  G EA NV+ P+G  VKGS
Sbjct:   60 SSSNKE-------EKKVLETGVTGTVKWYNVKLGYGFIRRHDTSDCVFVYHQSIAKKNPNKRLRSLGTDEEVVFDVVEGMKGLEAGNVTGPNGEPVKGS 151          
BLAST of Y-box-binding protein 1 vs. TrEMBL
Match: A0A0N5B1V5 (Uncharacterized protein OS=Strongyloides papillosus OX=174720 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.054e-34
Identity = 96/262 (36.64%), Postives = 137/262 (52.29%), Query Frame = 2
Query:  107 MADHQNGQNENDANKTESSNE-KPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYALRFPXXXXXXXXXXXXXTRTKSNSESGTRTHDYVRGGRNNQNRERIPSFTRKKNTSENKENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKG 889
            +++ QN + +++ N   S+ E K VL  G+ G VKW+NVKL YGF+ R D N+ +F++  +I K NPN   +S+   EE++FDV++G KGLE  NV G +G  VKGS    R+                                  +N +N  R   F RK N     EN+E +  QK  +   V GKV +FN  +GYGF+ R+D  E++F H   IVK NP+     +  G  +LFDIV+G  G EAA V   +GN + G
Sbjct:   45 VSNEQNEETKDNGNSGSSNKEEKKVLESGVAGTVKWYNVKLGYGFIRRNDTNDCVFVYHQSIAKKNPNKRLRSLATDEEVVFDVIEGKKGLEAGNVTGPNGEPVKGSHIDKRYK---------------------------------KNYRNGRRFQRFYRKFNM----ENKERDPNQK-YVEEKVEGKVLFFNSFKGYGFIKRNDKDENVFCHVVDIVKKNPKRFY-YLPTGTPVLFDIVEGLKGTEAAFVRDEEGNPLSG 267          

HSP 2 Score: 94.7449 bits (234), Expect = 2.537e-17
Identity = 44/99 (44.44%), Postives = 66/99 (66.67%), Query Frame = 2
Query:  596 TSENKENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGS 892
            T +N  +  S   +K+V+ S V G VKW+NVK GYGF+ R+D  + +F++H +I K NP    +S+   EE++FD+++GK G EA NV+ P+G  VKGS
Sbjct:   53 TKDNGNSGSSNKEEKKVLESGVAGTVKWYNVKLGYGFIRRNDTNDCVFVYHQSIAKKNPNKRLRSLATDEEVVFDVIEGKKGLEAGNVTGPNGEPVKGS 151          
BLAST of Y-box-binding protein 1 vs. Ensembl Cavefish
Match: ybx1 (Y-box binding protein 1 [Source:NCBI gene;Acc:103040011])

HSP 1 Score: 108.612 bits (270), Expect = 5.282e-26
Identity = 49/89 (55.06%), Postives = 67/89 (75.28%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            K+VI + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ P G  V+GS+YA 
Sbjct:   33 KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 121          

HSP 2 Score: 100.908 bits (250), Expect = 2.588e-23
Identity = 48/90 (53.33%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            +K V+   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G  G  V+GS+YA 
Sbjct:   32 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA 121          
BLAST of Y-box-binding protein 1 vs. Ensembl Cavefish
Match: YBX2 (Y-box-binding protein 2-A-like [Source:NCBI gene;Acc:103036193])

HSP 1 Score: 103.219 bits (256), Expect = 3.954e-24
Identity = 49/97 (50.52%), Postives = 67/97 (69.07%), Query Frame = 2
Query:  611 ENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            E +E    +++VI + V G VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+   G EAANV+ P G  VKGS YA
Sbjct:   15 ETQEDLPPERKVIATLVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEIVEFDVVEATKGSEAANVTGPGGVPVKGSRYA 111          

HSP 2 Score: 101.679 bits (252), Expect = 1.495e-23
Identity = 49/89 (55.06%), Postives = 61/89 (68.54%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            E+ V+   +QG VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+  KG E ANV G  G  VKGS YA
Sbjct:   23 ERKVIATLVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEIVEFDVVEATKGSEAANVTGPGGVPVKGSRYA 111          
BLAST of Y-box-binding protein 1 vs. Ensembl Cavefish
Match: YBX2 (Y-box-binding protein 2-A-like [Source:NCBI gene;Acc:103036193])

HSP 1 Score: 100.523 bits (249), Expect = 3.505e-23
Identity = 46/91 (50.55%), Postives = 62/91 (68.13%), Query Frame = 2
Query:  629 LIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            L    ++ + V G VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+   G EAANV+ P G  VKGS YA
Sbjct:   14 LTSVSIVATLVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEIVEFDVVEATKGSEAANVTGPGGVPVKGSRYA 104          

HSP 2 Score: 98.9821 bits (245), Expect = 1.409e-22
Identity = 47/86 (54.65%), Postives = 59/86 (68.60%), Query Frame = 2
Query:  176 VLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            ++   +QG VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+  KG E ANV G  G  VKGS YA
Sbjct:   19 IVATLVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEIVEFDVVEATKGSEAANVTGPGGVPVKGSRYA 104          
BLAST of Y-box-binding protein 1 vs. Ensembl Cavefish
Match: LIN28B (protein lin-28 homolog A [Source:NCBI gene;Acc:103022253])

HSP 1 Score: 51.2174 bits (121), Expect = 6.779e-7
Identity = 29/84 (34.52%), Postives = 42/84 (50.00%), Query Frame = 2
Query:  197 GKVKWFNVKLRYGFV-------NRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSE 427
            G  KWFNV++ +GF+       N  D   D+F+HQS +         +S+++GE + F   +  KGLE   V G  G    GSE
Sbjct:   31 GHCKWFNVRMGFGFISMTSRGGNPIDPPLDVFVHQSKLHMEG----FRSLKEGEAVEFTFKKSSKGLECVRVTGPGGAHCVGSE 110          
BLAST of Y-box-binding protein 1 vs. Ensembl Cavefish
Match: LIN28B (protein lin-28 homolog A [Source:NCBI gene;Acc:103022253])

HSP 1 Score: 50.8322 bits (120), Expect = 8.610e-7
Identity = 29/84 (34.52%), Postives = 42/84 (50.00%), Query Frame = 2
Query:  197 GKVKWFNVKLRYGFV-------NRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSE 427
            G  KWFNV++ +GF+       N  D   D+F+HQS +         +S+++GE + F   +  KGLE   V G  G    GSE
Sbjct:   39 GHCKWFNVRMGFGFISMTSRGGNPIDPPLDVFVHQSKLHMEG----FRSLKEGEAVEFTFKKSSKGLECVRVTGPGGAHCVGSE 118          
BLAST of Y-box-binding protein 1 vs. Ensembl Nematostella
Match: EDO41469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S475])

HSP 1 Score: 103.605 bits (257), Expect = 6.883e-27
Identity = 47/86 (54.65%), Postives = 63/86 (73.26%), Query Frame = 2
Query:  644 VIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            +  + V G VKWFNVK GYGF+ R DN+EDIF+H +AI K+NP+   +SV DGE + F++V G  G EA+NV+ PDG  V+GS+YA
Sbjct:    3 IAATKVTGTVKWFNVKNGYGFINRDDNKEDIFVHQTAIAKNNPKKYLRSVGDGEVVEFNVVSGTKGLEASNVTGPDGEPVQGSKYA 88          

HSP 2 Score: 102.449 bits (254), Expect = 2.108e-26
Identity = 49/86 (56.98%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  176 VLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            +    + G VKWFNVK  YGF+NR DN EDIF+HQ+AI K+NP    +SV DGE + F+VV G KGLE +NV G DG  V+GS+YA
Sbjct:    3 IAATKVTGTVKWFNVKNGYGFINRDDNKEDIFVHQTAIAKNNPKKYLRSVGDGEVVEFNVVSGTKGLEASNVTGPDGEPVQGSKYA 88          
BLAST of Y-box-binding protein 1 vs. Ensembl Nematostella
Match: EDO44703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV03])

HSP 1 Score: 67.3958 bits (163), Expect = 6.973e-12
Identity = 38/98 (38.78%), Postives = 55/98 (56.12%), Query Frame = 2
Query:  599 SENKENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGS 892
            SE      +E+  K+ I  T  G VKWFN+ +G+GF+ R D  ED+F+H SAI  S      +S+E+GE +   I     G+ A  V++P G  VKG+
Sbjct:  465 SEEAREVTTEVGGKDTITCT--GSVKWFNLIKGFGFITRDDGGEDVFVHQSAIKASG----YRSLEEGEHVQLTISNSDKGKVAICVTSPGGGNVKGA 556          

HSP 2 Score: 53.9138 bits (128), Expect = 1.018e-7
Identity = 33/91 (36.26%), Postives = 46/91 (50.55%), Query Frame = 2
Query:  152 TESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGS 424
            TE   +  + C    G VKWFN+   +GF+ R D  ED+F+HQSAI  S      +S+E+GE +   +    KG     V    G  VKG+
Sbjct:  473 TEVGGKDTITC---TGSVKWFNLIKGFGFITRDDGGEDVFVHQSAIKASG----YRSLEEGEHVQLTISNSDKGKVAICVTSPGGGNVKGA 556          
BLAST of Y-box-binding protein 1 vs. Ensembl Medaka
Match: ybx1 (Y-box binding protein 1 [Source:NCBI gene;Acc:100049221])

HSP 1 Score: 109.383 bits (272), Expect = 2.945e-26
Identity = 49/89 (55.06%), Postives = 67/89 (75.28%), Query Frame = 2
Query:  638 KEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            K+VI + VLG VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+V+G+ G EAANV+ P G  V+GS+YA 
Sbjct:   34 KKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVAVQGSKYAA 122          

HSP 2 Score: 101.679 bits (252), Expect = 1.437e-23
Identity = 48/90 (53.33%), Postives = 62/90 (68.89%), Query Frame = 2
Query:  167 EKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYAL 436
            +K V+   + G VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDVV+G KG E ANV G  G  V+GS+YA 
Sbjct:   33 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVAVQGSKYAA 122          
BLAST of Y-box-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000007880.2 (Y-box binding protein 2 [Source:NCBI gene;Acc:100049372])

HSP 1 Score: 103.219 bits (256), Expect = 1.549e-23
Identity = 49/93 (52.69%), Postives = 63/93 (67.74%), Query Frame = 2
Query:  155 ESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            E  +E+ V+   +QG VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDV++  KG E ANV G  G  VKGS YA
Sbjct:  100 EKQSERKVIATAVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVTGPGGIPVKGSRYA 192          

HSP 2 Score: 102.834 bits (255), Expect = 2.573e-23
Identity = 49/97 (50.52%), Postives = 68/97 (70.10%), Query Frame = 2
Query:  611 ENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            E ++SE   ++VI + V G VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+++   G EAANV+ P G  VKGS YA
Sbjct:   99 EEKQSE---RKVIATAVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVTGPGGIPVKGSRYA 192          
BLAST of Y-box-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000007875.2 (Y-box binding protein 2 [Source:NCBI gene;Acc:100049372])

HSP 1 Score: 103.219 bits (256), Expect = 1.789e-23
Identity = 49/93 (52.69%), Postives = 63/93 (67.74%), Query Frame = 2
Query:  155 ESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            E  +E+ V+   +QG VKWFNV+  YGF+NR D  ED+F+HQ+AI K+NP    +SV DGE + FDV++  KG E ANV G  G  VKGS YA
Sbjct:  100 EKQSERKVIATAVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVTGPGGIPVKGSRYA 192          

HSP 2 Score: 102.449 bits (254), Expect = 2.582e-23
Identity = 49/97 (50.52%), Postives = 68/97 (70.10%), Query Frame = 2
Query:  611 ENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
            E ++SE   ++VI + V G VKWFNV+ GYGF+ R+D +ED+F+H +AI K+NP    +SV DGE + FD+++   G EAANV+ P G  VKGS YA
Sbjct:   99 EEKQSE---RKVIATAVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVTGPGGIPVKGSRYA 192          
BLAST of Y-box-binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000029434.1 (pep primary_assembly:ASM223467v1:3:36782961:36787024:1 gene:ENSORLG00000026367.1 transcript:ENSORLT00000029434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 2.740e-8
Identity = 24/62 (38.71%), Postives = 41/62 (66.13%), Query Frame = 2
Query:  152 TESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGE 337
            T + +++ V+  G+Q  VKWF+V   YG +NR +  ED+F+ Q+AI  +NP +  +S+ DG+
Sbjct:   24 TWNQSKRKVITTGVQDTVKWFHVCNGYGLINRNNTKEDVFVPQTAIKNNNPRNFLRSIGDGK 85          

HSP 2 Score: 51.2174 bits (121), Expect = 9.396e-8
Identity = 22/57 (38.60%), Postives = 39/57 (68.42%), Query Frame = 2
Query:  635 QKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGE 805
            +++VI + V   VKWF+V  GYG + R++ +ED+F+  +AI  +NP +  +S+ DG+
Sbjct:   29 KRKVITTGVQDTVKWFHVCNGYGLINRNNTKEDVFVPQTAIKNNNPRNFLRSIGDGK 85          
BLAST of Y-box-binding protein 1 vs. Ensembl Medaka
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:101160951])

HSP 1 Score: 51.6026 bits (122), Expect = 5.117e-7
Identity = 30/85 (35.29%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  197 GKVKWFNVKLRYGFVNRYDNNE--------DIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSE 427
            G  KWFNV++ +GF++   N+E        D+F+HQS +V        +S+++GE++ F   +  KGLE   V G  G    GSE
Sbjct:   42 GFCKWFNVRMGFGFIS-MTNSEGSPVEPPLDVFVHQSKLVMEG----FRSLKEGEQVEFTYKKSSKGLESLRVTGPGGGPCVGSE 121          

HSP 2 Score: 48.521 bits (114), Expect = 5.654e-6
Identity = 26/84 (30.95%), Postives = 44/84 (52.38%), Query Frame = 2
Query:  665 GKVKWFNVKRGYGFVCRHDNQE-------DIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSE 895
            G  KWFNV+ G+GF+   +++        D+F+H S +V        +S+++GE++ F   +   G E+  V+ P G    GSE
Sbjct:   42 GFCKWFNVRMGFGFISMTNSEGSPVEPPLDVFVHQSKLVMEG----FRSLKEGEQVEFTYKKSSKGLESLRVTGPGGGPCVGSE 121          
BLAST of Y-box-binding protein 1 vs. Planmine SMEST
Match: SMESG000032189.1 (SMESG000032189.1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 435/437 (99.54%), Postives = 436/437 (99.77%), Query Frame = 2
Query:  107 MADHQNGQNENDANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYALRFPXXXXXXXXXXXXXTRTKSNSESGTRTHDYVRGGRNNQNRERIPSFTRKKNTSENKENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYALXXXXXXXXXXXXXXXXXXXXXDKGRTREVSENEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQYVVQYRGQYNXXXXXXXXXXXXXXXMRFPPGDGFNGRMFRGGPPREIPMKHEPYDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENAEEVEQSQ 1417
            MADHQNGQNENDANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYALRFPRIRGRGIGRGIGRTRTKSNSESGTRTHDYVRGGRNNQNRERIPSFTRKKNTSENKENRESE IQKEVI+STVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYALRYMRGRGRGRGRGRGMRNERGDKGRTREVSENEEMRGGGGPFRGNMGGRPFRGIRPFRGGGRPFRARPFRGGSQYVVQYRGQYNYERPPDYFYDYYPEPMRFPPGDGFNGRMFRGGPPREIPMKHEPYDNEYYEPRRGRGRPRGRGRTRGRGGYGNNTNPNENAEEVEQSQ
Sbjct:    1 MADHQNGQNENDANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYALRFPRIRGRGIGRGIGRTRTKSNSESGTRTHDYVRGGRNNQNRERIPSFTRKKNTSENKENRESESIQKEVIISTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYALRYMRGRGRGRGRGRGMRNERGDKGRTREVSENEEMRGGGGPFRGNMGGRPFRGIRPFRGGGRPFRARPFRGGSQYVVQYRGQYNYERPPDYFYDYYPEPMRFPPGDGFNGRMFRGGPPREIPMKHEPYDNEYYEPRRGRGRPRGRGRTRGRGGYGNNTNPNENAEEVEQSQ 437          
BLAST of Y-box-binding protein 1 vs. Planmine SMEST
Match: SMESG000032180.1 (SMESG000032180.1)

HSP 1 Score: 147.902 bits (372), Expect = 1.613e-41
Identity = 93/152 (61.18%), Postives = 110/152 (72.37%), Query Frame = 2
Query:  107 MADHQNGQNENDANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYALRFPXXXXXXXXXXXXXTRTKSNSESG-TRTHDYVRGGRNNQN 559
            MA++Q      + N TE+S +K VL   I GKVKWFNVK  YGFV R DN EDIFIHQSAIVKSNP+HPRKSV +GEEI FD+V+G KG E ANV  IDG+CVKGSEYALR+ R RGRG G   GR R++  SE G  R+ D++RGG   +N
Sbjct:    1 MANNQEKIEGYEENATEASKQKQVLFTEITGKVKWFNVKRGYGFVCRDDNCEDIFIHQSAIVKSNPDHPRKSVGEGEEIKFDIVKGAKGNEAANVSAIDGSCVKGSEYALRYQRGRGRGRGVFRGRGRSRVVSEEGDMRSQDFLRGGLRGRN 152          

HSP 2 Score: 144.821 bits (364), Expect = 2.811e-40
Identity = 71/99 (71.72%), Postives = 80/99 (80.81%), Query Frame = 2
Query:  608 KENRESELIQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYAL 904
            +EN      QK+V+ + + GKVKWFNVKRGYGFVCR DN EDIFIH SAIVKSNP+HPRKSV +GEEI FDIV+G  G EAANVSA DG+ VKGSEYAL
Sbjct:   12 EENATEASKQKQVLFTEITGKVKWFNVKRGYGFVCRDDNCEDIFIHQSAIVKSNPDHPRKSVGEGEEIKFDIVKGAKGNEAANVSAIDGSCVKGSEYAL 110          
BLAST of Y-box-binding protein 1 vs. Planmine SMEST
Match: SMESG000076962.1 (SMESG000076962.1)

HSP 1 Score: 121.709 bits (304), Expect = 2.455e-30
Identity = 63/109 (57.80%), Postives = 76/109 (69.72%), Query Frame = 2
Query:  107 MADHQNGQNENDANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            MAD Q    E   + TE    K +L   I GKVKWFNVK  YGF+NR DN EDIF+HQ+AI+K+NP   ++SV DGEE+ FDVV+G KGLE ANV G DG  V+GS+YA
Sbjct:    1 MADIQTSPAERSIHPTE----KKILATKINGKVKWFNVKSGYGFINRNDNQEDIFVHQTAILKNNPRKWQRSVGDGEEVEFDVVEGEKGLEAANVTGPDGIPVQGSKYA 105          

HSP 2 Score: 117.472 bits (293), Expect = 7.342e-29
Identity = 52/90 (57.78%), Postives = 73/90 (81.11%), Query Frame = 2
Query:  632 IQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
             +K+++ + + GKVKWFNVK GYGF+ R+DNQEDIF+H +AI+K+NP   ++SV DGEE+ FD+V+G+ G EAANV+ PDG  V+GS+YA
Sbjct:   16 TEKKILATKINGKVKWFNVKSGYGFINRNDNQEDIFVHQTAILKNNPRKWQRSVGDGEEVEFDVVEGEKGLEAANVTGPDGIPVQGSKYA 105          
BLAST of Y-box-binding protein 1 vs. Planmine SMEST
Match: SMESG000076962.1 (SMESG000076962.1)

HSP 1 Score: 121.709 bits (304), Expect = 3.469e-30
Identity = 63/109 (57.80%), Postives = 76/109 (69.72%), Query Frame = 2
Query:  107 MADHQNGQNENDANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            MAD Q    E   + TE    K +L   I GKVKWFNVK  YGF+NR DN EDIF+HQ+AI+K+NP   ++SV DGEE+ FDVV+G KGLE ANV G DG  V+GS+YA
Sbjct:    1 MADIQTSPAERSIHPTE----KKILATKINGKVKWFNVKSGYGFINRNDNQEDIFVHQTAILKNNPRKWQRSVGDGEEVEFDVVEGEKGLEAANVTGPDGIPVQGSKYA 105          

HSP 2 Score: 117.857 bits (294), Expect = 6.572e-29
Identity = 52/90 (57.78%), Postives = 73/90 (81.11%), Query Frame = 2
Query:  632 IQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
             +K+++ + + GKVKWFNVK GYGF+ R+DNQEDIF+H +AI+K+NP   ++SV DGEE+ FD+V+G+ G EAANV+ PDG  V+GS+YA
Sbjct:   16 TEKKILATKINGKVKWFNVKSGYGFINRNDNQEDIFVHQTAILKNNPRKWQRSVGDGEEVEFDVVEGEKGLEAANVTGPDGIPVQGSKYA 105          
BLAST of Y-box-binding protein 1 vs. Planmine SMEST
Match: SMESG000076962.1 (SMESG000076962.1)

HSP 1 Score: 121.324 bits (303), Expect = 3.776e-30
Identity = 63/109 (57.80%), Postives = 76/109 (69.72%), Query Frame = 2
Query:  107 MADHQNGQNENDANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDNNEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDGNCVKGSEYA 433
            MAD Q    E   + TE    K +L   I GKVKWFNVK  YGF+NR DN EDIF+HQ+AI+K+NP   ++SV DGEE+ FDVV+G KGLE ANV G DG  V+GS+YA
Sbjct:    1 MADIQTSPAERSIHPTE----KKILATKINGKVKWFNVKSGYGFINRNDNQEDIFVHQTAILKNNPRKWQRSVGDGEEVEFDVVEGEKGLEAANVTGPDGIPVQGSKYA 105          

HSP 2 Score: 117.857 bits (294), Expect = 7.146e-29
Identity = 52/90 (57.78%), Postives = 73/90 (81.11%), Query Frame = 2
Query:  632 IQKEVIMSTVLGKVKWFNVKRGYGFVCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAANVSAPDGNFVKGSEYA 901
             +K+++ + + GKVKWFNVK GYGF+ R+DNQEDIF+H +AI+K+NP   ++SV DGEE+ FD+V+G+ G EAANV+ PDG  V+GS+YA
Sbjct:   16 TEKKILATKINGKVKWFNVKSGYGFINRNDNQEDIFVHQTAILKNNPRKWQRSVGDGEEVEFDVVEGEKGLEAANVTGPDGIPVQGSKYA 105          
The following BLAST results are available for this feature:
BLAST of Y-box-binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YBX36.519e-2754.26Y-box binding protein 3 [Source:HGNC Symbol;Acc:HG... [more]
YBX32.185e-2654.26Y-box binding protein 3 [Source:HGNC Symbol;Acc:HG... [more]
YBX17.522e-2655.06Y-box binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
YBX24.510e-2452.58Y-box binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
YBX24.510e-2452.58Y-box binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Y-box-binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cey-12.204e-2955.32C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:O62... [more]
cey-25.611e-2248.94C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91... [more]
cey-36.048e-2139.50C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91... [more]
cey-36.048e-2139.50C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91... [more]
cey-41.831e-2048.91C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
back to top
BLAST of Y-box-binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
yps9.430e-2655.06gene:FBgn0022959 transcript:FBtr0076027[more]
yps1.074e-2555.06gene:FBgn0022959 transcript:FBtr0305992[more]
lin-286.932e-1037.97gene:FBgn0035626 transcript:FBtr0077090[more]
back to top
BLAST of Y-box-binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx14.710e-2655.06Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ybx14.710e-2655.06Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ybx14.904e-2655.06Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
lin28a3.648e-633.33lin-28 homolog A (C. elegans) [Source:NCBI gene;Ac... [more]
lin28a4.943e-633.33lin-28 homolog A (C. elegans) [Source:NCBI gene;Ac... [more]
back to top
BLAST of Y-box-binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgcs13.210e-2654.443-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
ybx31.756e-2451.69Y-box binding protein 3 [Source:NCBI gene;Acc:5485... [more]
hmgcs12.912e-2452.873-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
lin28b3.894e-632.14lin-28 homolog B [Source:NCBI gene;Acc:100216028][more]
lin28b4.635e-632.14lin-28 homolog B [Source:NCBI gene;Acc:100216028][more]
back to top
BLAST of Y-box-binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ybx33.367e-2753.76Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670... [more]
Ybx31.699e-2653.76Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670... [more]
Ybx15.496e-2655.06Y box protein 1 [Source:MGI Symbol;Acc:MGI:99146][more]
Ybx27.338e-2553.61Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372... [more]
Ybx22.273e-2449.47Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372... [more]
back to top
BLAST of Y-box-binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41824|YBOXH_APLCA2.119e-2753.92Y-box factor homolog OS=Aplysia californica OX=650... [more]
sp|Q62764|YBOX3_RAT3.827e-2654.26Y-box-binding protein 3 OS=Rattus norvegicus OX=10... [more]
sp|P16989|YBOX3_HUMAN1.049e-2554.26Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN... [more]
sp|P21573|YBOX1_XENLA1.097e-2555.06Y-box-binding protein 1 OS=Xenopus laevis OX=8355 ... [more]
sp|Q9JKB3|YBOX3_MOUSE1.188e-2553.76Y-box-binding protein 3 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of Y-box-binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H5RZM64.058e-3939.92Bm4155 OS=Brugia malayi OX=6279 GN=Bm4155 PE=4 SV=... [more]
Q239603.432e-3868.18Y-box protein OS=Dugesia japonica OX=6161 PE=2 SV=... [more]
A0A3M7SJ454.146e-3837.70Nuclease-sensitive element-binding 1 isoform X4 OS... [more]
A0A0K0FCY19.623e-3536.50Ypsilon schachtel (inferred by orthology to a D. m... [more]
A0A0N5B1V52.054e-3436.64Uncharacterized protein OS=Strongyloides papillosu... [more]
back to top
BLAST of Y-box-binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx15.282e-2655.06Y-box binding protein 1 [Source:NCBI gene;Acc:1030... [more]
YBX23.954e-2450.52Y-box-binding protein 2-A-like [Source:NCBI gene;A... [more]
YBX23.505e-2350.55Y-box-binding protein 2-A-like [Source:NCBI gene;A... [more]
LIN28B6.779e-734.52protein lin-28 homolog A [Source:NCBI gene;Acc:103... [more]
LIN28B8.610e-734.52protein lin-28 homolog A [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Y-box-binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Y-box-binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Y-box-binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO414696.883e-2754.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447036.973e-1238.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Y-box-binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx12.945e-2655.06Y-box binding protein 1 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000007880.21.549e-2352.69Y-box binding protein 2 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000007875.21.789e-2352.69Y-box binding protein 2 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000029434.12.740e-838.71pep primary_assembly:ASM223467v1:3:36782961:367870... [more]
lin28b5.117e-735.29lin-28 homolog B [Source:NCBI gene;Acc:101160951][more]
back to top
BLAST of Y-box-binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032189.10.000e+099.54SMESG000032189.1[more]
SMESG000032180.11.613e-4161.18SMESG000032180.1[more]
SMESG000076962.12.455e-3057.80SMESG000076962.1[more]
SMESG000076962.13.469e-3057.80SMESG000076962.1[more]
SMESG000076962.13.776e-3057.80SMESG000076962.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012869 ID=SMED30012869|Name=Y-box-binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1496bp
CTCTTGTTTAAGCGCGTCTCCGAATGACGCCGTTATAAAGTACAAAGATC
AAGATAATAAAGATTTGAAAATTTTAACATCCTATTAAGATCAATTTTTA
CCAGAGATGGCTGATCATCAAAACGGTCAAAATGAAAATGATGCAAATAA
AACAGAAAGCTCAAATGAAAAACCAGTTTTATGTGAAGGAATTCAGGGAA
AAGTAAAATGGTTCAATGTTAAATTAAGATACGGATTTGTTAATCGATAT
GATAATAATGAAGACATATTCATTCATCAATCGGCCATTGTTAAAAGTAA
CCCTAACCATCCTCGAAAATCTGTAGAAGATGGTGAAGAAATTTTATTTG
ACGTAGTACAGGGAATAAAAGGATTAGAAGTAGCTAATGTATGTGGAATT
GATGGAAATTGTGTCAAAGGAAGTGAGTACGCTCTTCGATTTCCAAGAAT
CCGTGGTAGAGGTATTGGACGTGGAATTGGTCGAACGCGAACCAAATCGA
ATTCTGAAAGTGGTACACGTACGCATGACTATGTTAGAGGTGGTCGAAAT
AATCAAAATAGAGAAAGAATTCCAAGCTTTACAAGAAAAAAAAATACAAG
CGAAAATAAAGAAAATCGTGAATCTGAGTTGATACAAAAAGAAGTTATAA
TGTCAACGGTTTTGGGGAAAGTAAAATGGTTCAATGTTAAGCGTGGATAT
GGTTTTGTTTGTCGACATGACAACCAGGAGGACATTTTTATTCATCATTC
TGCGATTGTTAAGAGTAATCCAGAACATCCAAGAAAATCTGTAGAAGATG
GAGAAGAAATTTTGTTTGACATTGTCCAAGGAAAGCATGGTCAGGAAGCT
GCCAATGTGTCTGCACCTGATGGTAATTTTGTGAAAGGTAGTGAATATGC
ACTAAGATATATGCGTGGACGAGGTCGAGGTAGAGGTCGTGGAAGAGGAA
TGAGAAATGAGAGAGGAGATAAAGGTAGGACAAGAGAAGTGTCGGAGAAC
GAAGAAATGCGTGGAGGTGGTGGTCCATTCAGGGGTAACATGGGTGGTAG
ACCATTTCGTGGAATAAGACCATTCAGGGGAGGTGGAAGGCCTTTTAGAG
CAAGGCCATTTAGAGGAGGATCGCAATATGTAGTGCAATATCGCGGCCAA
TACAATTATGAGAGACCTCCTGACTATTTTTATGATTATTATCCGGAACC
AATGCGTTTTCCACCAGGAGATGGTTTTAACGGCCGAATGTTCAGAGGTG
GTCCTCCTAGAGAAATTCCCATGAAACATGAGCCTTATGATAACGAATAT
TACGAACCAAGAAGAGGAAGAGGTAGACCAAGAGGGCGAGGAAGAACTCG
GGGTCGTGGAGGATATGGAAATAATACAAATCCCAATGAAAACGCCGAAG
AAGTAGAACAGTCTCAATAGGATTAAATTTTGTAATTCGTGCGTAAATTA
ACATTGGATTTCATTGGGAAAGTGTTACAAAAATTATCAATTTGGG
back to top

protein sequence of SMED30012869-orf-1

>SMED30012869-orf-1 ID=SMED30012869-orf-1|Name=SMED30012869-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=438bp
MADHQNGQNENDANKTESSNEKPVLCEGIQGKVKWFNVKLRYGFVNRYDN
NEDIFIHQSAIVKSNPNHPRKSVEDGEEILFDVVQGIKGLEVANVCGIDG
NCVKGSEYALRFPRIRGRGIGRGIGRTRTKSNSESGTRTHDYVRGGRNNQ
NRERIPSFTRKKNTSENKENRESELIQKEVIMSTVLGKVKWFNVKRGYGF
VCRHDNQEDIFIHHSAIVKSNPEHPRKSVEDGEEILFDIVQGKHGQEAAN
VSAPDGNFVKGSEYALRYMRGRGRGRGRGRGMRNERGDKGRTREVSENEE
MRGGGGPFRGNMGGRPFRGIRPFRGGGRPFRARPFRGGSQYVVQYRGQYN
YERPPDYFYDYYPEPMRFPPGDGFNGRMFRGGPPREIPMKHEPYDNEYYE
PRRGRGRPRGRGRTRGRGGYGNNTNPNENAEEVEQSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0035198miRNA binding
GO:0003677DNA binding
GO:0003676nucleic acid binding
GO:0003697single-stranded DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005921gap junction
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
GO:0008380RNA splicing
GO:0008544epidermis development
GO:0017148negative regulation of translation
GO:0048255mRNA stabilization
GO:0048598embryonic morphogenesis
GO:0050658RNA transport
GO:0051031tRNA transport
GO:0006355regulation of transcription, DNA-templated
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006351transcription, DNA-templated
GO:0007283spermatogenesis
GO:0031100animal organ regeneration
Vocabulary: INTERPRO
TermDefinition
IPR002059CSP_DNA-bd
IPR011129CSD
IPR012340NA-bd_OB-fold
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002059Cold-shock protein, DNA-bindingPRINTSPR00050COLDSHOCKcoord: 187..202
score: 62.22
coord: 208..217
score: 56.85
coord: 227..245
score: 40.15
IPR002059Cold-shock protein, DNA-bindingPFAMPF00313CSDcoord: 30..97
e-value: 5.3E-18
score: 64.6
coord: 187..253
e-value: 1.8E-20
score: 72.6
IPR002059Cold-shock protein, DNA-bindingCDDcd04458CSP_CDScoord: 187..251
e-value: 3.77037E-16
score: 70.6854
IPR002059Cold-shock protein, DNA-bindingCDDcd04458CSP_CDScoord: 29..95
e-value: 3.198E-15
score: 67.989
IPR011129Cold shock domainSMARTSM00357csp_8coord: 30..98
e-value: 2.3E-16
score: 70.4
coord: 186..254
e-value: 8.1E-22
score: 88.5
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 26..109
e-value: 1.6E-19
score: 71.8
coord: 177..265
e-value: 2.1E-23
score: 84.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 385..437
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 385..405
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 274..301
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 278..300
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 121..175
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 133..175
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 418..437
NoneNo IPR availablePANTHERPTHR11544COLD SHOCK DOMAIN CONTAINING PROTEINScoord: 168..424
coord: 10..174
NoneNo IPR availablePROSITEPS51857CSD_2coord: 184..253
score: 24.053
NoneNo IPR availablePROSITEPS51857CSD_2coord: 28..97
score: 20.232
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 29..97
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 183..253