NEPH-2

Overview
NameNEPH-2 (AKN21715.1)
Smed IDSMED30012867
Length (bp)3052
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NEPH-2 (SMED30012867) t-SNE clustered cells

Violin plots show distribution of expression levels for NEPH-2 (SMED30012867) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NEPH-2 (SMED30012867) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NEPH-2 (SMED30012867) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012867

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30012867h1SMcG0007717 dd_Smed_v4_12118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012867h1SMcG0007717 dd_Smed_v4_12118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012867h1SMcG0007717 dd_Smed_v4_12118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012867h1SMcG0007717 dd_Smed_v4_12118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30012867h1SMcG0007717 dd_Smed_v4_12118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30012867h1SMcG0007717 dd_Smed_v4_12118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012867h1SMcG0007717 dd_Smed_v4_12118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30012867h1SMcG0007717 dd_Smed_v4_12118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30012867h1SMcG0007717 dd_Smed_v4_12118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30012867h1SMcG0007717 dd_Smed_v4_12118_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NEPH-2 vs. Ensembl Human
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 162.54 bits (410), Expect = 1.759e-40
Identity = 135/522 (25.86%), Postives = 226/522 (43.30%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P++Q V     VT+ C + P  +  V W+K G  LG  R D+ S+       +Y +  +  +G + L+I    L+D+  + CQ      AI S+ A+L VLV    P I+       GP         I +  GD + L C A+  +P A + W+   E+I        NG         SK ++ + K     STL      + NG+SI C ATN+        E    I+I   P V + +  Q +     E++ +T  CSA   P    ++W      +   +   Y+     T     V C   N     +L R ++V +GP+   +   L   ++G D   +C    NP   I W +  +  ++ +   L  K++++ D G Y+C A V       +++ L     P+I       A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+I+NI  +DF   YNC+     GS ++++ L +   +P+ +I+G
Sbjct:   53 QPQDQVVVSGQPVTLLCAI-PEYDGFVLWIKDGLALGVGR-DLSSYP------QYLVVGNHLSGEHHLKILRAELQDDAVYECQA--IQAAIRSRPARLTVLVPPDDPVILG------GPV--------ISLRAGDPLNLTCHADNAKPAASIIWLRKGEVI--------NG------ATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK--ETSVTIDIQHPPLVNLSVEPQPV----LEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLL-VDLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTP--PPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIG 527          
BLAST of NEPH-2 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 156.377 bits (394), Expect = 1.447e-38
Identity = 126/532 (23.68%), Postives = 222/532 (41.73%), Query Frame = 3
Query:  432 GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVV-DNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRML-NVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRL-INDNTKYSISTEKYVDHSISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGG 2015
            G +   +  P +Q V       + C +     + V W K G  LG  +  ++++       RY +     AG Y+L+ITD  L D+  + CQ      A+ S+RA+L VL+                PE  R +  P+++   G    L C+A   +P A + W  D    E        G ++ T      +++ + K   + S L      L  G+   C + N         E   ++++H  PTVT+ I  Q +     E + +  +C A   P+   ++W      + + + S Y+     +     V C  +N     ++  L NV + P+   D  P    +IG DVTLTC    NP   + W ++ +N ++ +   L  K++ + D GTY C A V    +  +++ L     P+I       A  G   + +C I S P    ++I W ++   L +    +Y++         +S L+INN+  +DF   YNC+     G  + ++ L +   +P+ +I G 
Sbjct:   18 GTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGI-VQWTKDGLALGMGQG-LKAWP------RYRVVGSADAGQYNLEITDAELSDDASYECQAT--EAALRSRRAKLTVLIP---------------PEDTRIDGGPVILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQQE--------GAVAST------ELLKDGKRETTVSQLLINPTDLDIGRVFTCRSMNEAIPSGK--ETSIELDVHHPPTVTLSIEPQTV----QEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPT-TTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGA 501          
BLAST of NEPH-2 vs. Ensembl Human
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 153.295 bits (386), Expect = 4.487e-38
Identity = 135/534 (25.28%), Postives = 226/534 (42.32%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLS------------KTSPIPLILIVG 2012
             P++Q V     VT+ C + P  +  V W+K G  LG  R D+ S+       +Y +  +  +G + L+I    L+D+  + CQ      AI S+ A+L VLV    P I+       GP         I +  GD + L C A+  +P A + W+   E+I        NG         SK ++ + K     STL      + NG+SI C ATN+        E    I+I   P V + +  Q +     E++ +T  CSA   P    ++W      +   +   Y+     T     V C   N     +L R ++V +GP+   +   L   ++G D   +C    NP   I W +  +  ++ +   L  K++++ D G Y+C A V       +++ L     P+I       A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+I+NI  +DF   YNC+     GS ++++ L             +   +P+ +I+G
Sbjct:   53 QPQDQVVVSGQPVTLLCAI-PEYDGFVLWIKDGLALGVGR-DLSSYP------QYLVVGNHLSGEHHLKILRAELQDDAVYECQA--IQAAIRSRPARLTVLVPPDDPVILG------GPV--------ISLRAGDPLNLTCHADNAKPAASIIWLRKGEVI--------NG------ATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK--ETSVTIDIQHPPLVNLSVEPQPV----LEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLL-VDLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTP--PPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIG 539          
BLAST of NEPH-2 vs. Ensembl Human
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 154.451 bits (389), Expect = 7.649e-38
Identity = 135/534 (25.28%), Postives = 226/534 (42.32%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLS------------KTSPIPLILIVG 2012
             P++Q V     VT+ C + P  +  V W+K G  LG  R D+ S+       +Y +  +  +G + L+I    L+D+  + CQ      AI S+ A+L VLV    P I+       GP         I +  GD + L C A+  +P A + W+   E+I        NG         SK ++ + K     STL      + NG+SI C ATN+        E    I+I   P V + +  Q +     E++ +T  CSA   P    ++W      +   +   Y+     T     V C   N     +L R ++V +GP+   +   L   ++G D   +C    NP   I W +  +  ++ +   L  K++++ D G Y+C A V       +++ L     P+I       A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+I+NI  +DF   YNC+     GS ++++ L             +   +P+ +I+G
Sbjct:   53 QPQDQVVVSGQPVTLLCAI-PEYDGFVLWIKDGLALGVGR-DLSSYP------QYLVVGNHLSGEHHLKILRAELQDDAVYECQA--IQAAIRSRPARLTVLVPPDDPVILG------GPV--------ISLRAGDPLNLTCHADNAKPAASIIWLRKGEVI--------NG------ATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK--ETSVTIDIQHPPLVNLSVEPQPV----LEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLL-VDLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTP--PPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIG 539          
BLAST of NEPH-2 vs. Ensembl Human
Match: KIRREL1 (kirre like nephrin family adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:15734])

HSP 1 Score: 123.25 bits (308), Expect = 3.170e-28
Identity = 95/405 (23.46%), Postives = 171/405 (42.22%), Query Frame = 3
Query:  813 PEKLRNENSPIVV-DNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRML-NVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRL-INDNTKYSISTEKYVDHSISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGG 2015
            PE  R +  P+++   G    L C+A   +P A + W  D    E        G ++ T      +++ + K   + S L      L  G+   C + N         E   ++++H  PTVT+ I  Q +     E + +  +C A   P+   ++W      + + + S Y+     +     V C  +N     ++  L NV + P+   D  P    +IG DVTLTC    NP   + W ++ +N ++ +   L  K++ + D GTY C A V    +  +++ L     P+I       A  G   + +C I S P    ++I W ++   L +    +Y++         +S L+INN+  +DF   YNC+     G  + ++ L +   +P+ +I G 
Sbjct:   20 PEDTRIDGGPVILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQQE--------GAVAST------ELLKDGKRETTVSQLLINPTDLDIGRVFTCRSMNEAIPSGK--ETSIELDVHHPPTVTLSIEPQTV----QEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPT-TTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGA 401          
BLAST of NEPH-2 vs. Ensembl Celegans
Match: syg-1 (Synaptogenesis protein syg-1 [Source:UniProtKB/Swiss-Prot;Acc:B1Q236])

HSP 1 Score: 142.124 bits (357), Expect = 1.736e-34
Identity = 143/553 (25.86%), Postives = 236/553 (42.68%), Query Frame = 3
Query:  459 PENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNA--ITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVN---QLLNG-------KSIKCSATNRGF---------------EKFNFPEA----KAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRP-DKFLWKWYINDNEVMNDNRS-SYKIKATRTMNKAVVKCIANN--GKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
            P++    +  T  + CRV+  +   V W+K  FGLG  R       + GNK RY +    + G Y+L+I++V L D+ DF CQ++  ++A  + S +A+L VLV   PPKI++              +  +    GD +   C + +G+P   + W I +     D  G    I+S    + SK    + K   S  T+ A VN   Q+  G        SI    +N  F               +   FP        K+ +  AP + + + S+       EN    ++C+   +P D     WY  + ++     + +++       N+ +  C A N  G     ++ LNV +G +    S      N GD+    C T +NP   I+W R  +++IIGHG  L  +N++    G Y CTA VE F  +     L  R  P +    +  ASL  + +  C I   P  N+  + W   G+ +  +N + ++          SIL I +++  DFG YNCS    LG  ++  +L K + +  I+I  
Sbjct:   29 PKDTLAAVGETAILTCRVEH-QQGPVQWMKDDFGLGTDRDK----PLPGNK-RYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKAKLTVLVRPTPPKIVK-------------SHHSLKAIAGDPITQSCLSRKGKPPPTIGWAIAS-----DEHGKH--IVSWLGESRSKFGGIHAKPEISQETVIAHVNETTQVEEGGNNSREDSSIYSIMSNLSFIPRPEDDHKYLICISQHMTFPNKIEVDSVKLSLRYAPQINLTVASKL---PLRENGSALLACNVNAKPLDNVKISWYKGNQKLRETGDTLTFETLKMEDHNRDIF-CEATNEIGTTRGSIK-LNVAFGARIMSTSQD-KEVNEGDNAFFHCATLANPAPAIFWTRGDSDEIIGHGENLTLENVRTWQQGNYNCTATVEGFRKQILSHYLHIRGPPTVSMKDEVSASLDEATEIICEISGRPKTNN--VRWTVNGKEINFNNGRITVHQYPKPYGKESILKIKDLKEEDFGVYNCSANNGLGFDNRGTLLKKRNILDWIVITA 547          
BLAST of NEPH-2 vs. Ensembl Celegans
Match: syg-1 (Synaptogenesis protein syg-1 [Source:UniProtKB/Swiss-Prot;Acc:B1Q236])

HSP 1 Score: 141.739 bits (356), Expect = 2.154e-34
Identity = 143/553 (25.86%), Postives = 236/553 (42.68%), Query Frame = 3
Query:  459 PENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNA--ITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVN---QLLNG-------KSIKCSATNRGF---------------EKFNFPEA----KAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRP-DKFLWKWYINDNEVMNDNRS-SYKIKATRTMNKAVVKCIANN--GKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
            P++    +  T  + CRV+  +   V W+K  FGLG  R       + GNK RY +    + G Y+L+I++V L D+ DF CQ++  ++A  + S +A+L VLV   PPKI++              +  +    GD +   C + +G+P   + W I +     D  G    I+S    + SK    + K   S  T+ A VN   Q+  G        SI    +N  F               +   FP        K+ +  AP + + + S+       EN    ++C+   +P D     WY  + ++     + +++       N+ +  C A N  G     ++ LNV +G +    S      N GD+    C T +NP   I+W R  +++IIGHG  L  +N++    G Y CTA VE F  +     L  R  P +    +  ASL  + +  C I   P  N+  + W   G+ +  +N + ++          SIL I +++  DFG YNCS    LG  ++  +L K + +  I+I  
Sbjct:   29 PKDTLAAVGETAILTCRVEH-QQGPVQWMKDDFGLGTDRDK----PLPGNK-RYRMVGSAANGEYNLEISNVTLFDDDDFACQISESDHAKAVVSSKAKLTVLVRPTPPKIVK-------------SHHSLKAIAGDPITQSCLSRKGKPPPTIGWAIAS-----DEHGKH--IVSWLGESRSKFGGIHAKPEISQETVIAHVNETTQVEEGGNNSREDSSIYSIMSNLSFIPRPEDDHKYLICISQHMTFPNKIEVDSVKLSLRYAPQINLTVASKL---PLRENGSALLACNVNAKPLDNVKISWYKGNQKLRETGDTLTFETLKMEDHNRDIF-CEATNEIGTTRGSIK-LNVAFGARIMSTSQD-KEVNEGDNAFFHCATLANPAPAIFWTRGDSDEIIGHGENLTLENVRTWQQGNYNCTATVEGFRKQILSHYLHIRGPPTVSMKDEVSASLDEATEIICEISGRPKTNN--VRWTVNGKEINFNNGRITVHQYPKPYGKESILKIKDLKEEDFGVYNCSANNGLGFDNRGTLLKKRNILDWIVITA 547          
BLAST of NEPH-2 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 77.411 bits (189), Expect = 5.935e-14
Identity = 110/527 (20.87%), Postives = 192/527 (36.43%), Query Frame = 3
Query:  489 TVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGAR----LTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKL-------RDSFSTLKAKVNQLLNG-KSIKCSATNRGFEKFNFPEAKAKIE-----IHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNR-------SSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGP---QFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESN--------NDIIGHGTILYRKNIQELDFGTYIC----TAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGS 1952
            T+ ++C +  I    V W K+G  +  T S +                 L+  N    I +V + D+G + C    +     S    L VL    PP+    G Q            P +   GD + L C  +     A     ++W  D+  ++ DL+ N +    G    IS+  + N  L       R   ++L+ KV  L     ++KC      +   + P    K        +  P   +DI   ++  + + N    + C+  G P   + KW  N  EV +D            +I  T + +     C+A N     +L M+   + P     K D+P      +G+ +TL CN   NP   + W +  +          I   G  L   ++++ D G Y C     AG     +    ++  +  +  I  +P  R    +S+  +C+    P+    Q+ W   G  L +     +++++       + + INN+  SD G Y C      GS
Sbjct: 3591 TIYLECPISGIPQPDVIWTKNGMDINMTDSRVI----------------LAQNNETFGIENVQVTDQGRYTCTATNRGGK-ASHDFSLDVL---SPPEFDIHGTQ------------PTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVEILCTSLATVKCREHENNYIARHMPHVVTKPREMSQSANAYPPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPSI-KWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPI---KALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSP--RLPAQQSLTLQCLAQGKPVP---QMRWTLNGTALTHSTPGITVASDS------TFIQINNVSLSDKGVYTCYAENVAGS 4070          

HSP 2 Score: 71.633 bits (174), Expect = 3.109e-12
Identity = 116/508 (22.83%), Postives = 191/508 (37.60%), Query Frame = 3
Query:  471 RVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVA-SGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMD--IVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANN--GKEGHDLRMLNVKYGPQFKDDSPPLYPANI--GDDVTLTCNTDSNPMANIYWQRES-----NNDIIG-HGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDH--RASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLG 1949
             +  ++T+ I CR + I   ++ W   G  + E         M G  V Y        G+  L+I ++    EG + C    K     + RA+    V  S PP+++      M  E +R       V  G    +RC+   G P   + W+ D E    DL                  +  +TKL    S L  +   L +G +  C ATN+  E     +    +E+ V P +  +  ++    GN +       + C   GRP  ++  W  N  E+   N   +   ATR  ++    CIA+N  G    D  +++V   P F+         NI  G+   + C  D +P   I W +       +N I+   G  L     Q  D G Y C A   ++    +   +    KP I E  D   +A  G  +  KC +    + N    +   RG   + ++++++I            L IN++   D GQY+C    + G
Sbjct: 3046 EIVADTTLEIPCRTEGIPPPEISWFLDGKPILE---------MPG--VTY------KQGDLSLRIDNIKPNQEGRYTCVAENK-----AGRAEQDTYVEISEPPRVV------MASEVMR-------VVEGRQTTIRCEV-FGNPEPVVNWLKDGEPYTSDL------------------LQFSTKL----SYLHLRETTLADGGTYTCIATNKAGES----QTTTDVEVLVPPRIEDEERVLQGKEGNTY------MVHCQVTGRPVPYV-TWKRNGKEIEQFNPVLHIRNATRA-DEGKYSCIASNEAGTAVADF-LIDVFTKPTFETHETTF---NIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVA-TNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPV----LGNPTPTVTWKRGDDAVPNDSRHTIVNNYD-------LKINSVTTEDAGQYSCIAVNEAG 3467          

HSP 3 Score: 71.2478 bits (173), Expect = 3.743e-12
Identity = 89/342 (26.02%), Postives = 133/342 (38.89%), Query Frame = 3
Query: 1032 DSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTV--TMDIVSQNL-GNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSS------YKIKATRTMNKAVVKCIANNGKEGHDLR---MLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESN-------NDIIGHGTILYRKNIQELDFGTYIC----TAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSP 1988
            D+   LKA   Q  +G    C ATN     +   E   K+ ++  P +  T+D   + + G E      I + C  LG P   +  W   D+ V ND+R +       KI +  T +     CIA N  E  +L       V   P F      LY     D +T+ C   S P+ +I W R            I   G+ +     +  D G YIC     AG  + DL  K ++  K  K  I  NP   A + R++  +C I  IP      ++W   G  +   +++  ++             I N+Q +D G+Y C+ T   G AS    L   SP
Sbjct: 3352 DTLMILKA---QRFDGGLYTCVATN----SYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGE------IILKCPVLGNPTPTV-TWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVN--EAGNLTTHYAAEVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNP--LAIVARTIYLECPISGIP---QPDVIWTKNGMDINMTDSRVILAQNN------ETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSP 3666          

HSP 4 Score: 57.7658 bits (138), Expect = 5.427e-8
Identity = 129/544 (23.71%), Postives = 210/544 (38.60%), Query Frame = 3
Query:  462 ENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRA-QLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKS--IKCSATNR-GFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNE---FSENDWITISCS-ALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTM-------NKAVVKCIANN--GKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYW---QRESNNDIIGHGTILYRKNIQELDF--GTYICTAGVENFDLKSKKIILAKRIKPMIRE---NPDHRASLGRSVQAKC-VIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGG 2015
            +N  V L   +++ C +Q   + K  +V S  G    R D              IP+D     + L ITD   E+ G + C+  + N+A  ++R   L VL    PP  +         E +   N  ++ +N   + L+CQ   G P   + W ID   +  D S  F+                     +S S L+    + L GKS  I C+A N+ G    +F      I+   APT       +N G++   F E++ IT+ C  +LG    F   W +     + +N + + +  TR         ++ +  C+ANN  G+   D  ++ V+  P+ K+    L   N G+++ LTC+ + NP     W   Q +   + +               +  G Y C A         K I +  R KP         +   +L RS+  +C V D+I +     I W   G+  + +             H +S       +  D G Y C+VT + G A+K   L    P P I+  GG
Sbjct: 1650 DNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPD-----------NVQIPSD----GHRLYITDAKPENNGKYMCR--VTNSAGKAERTLTLDVL---EPPVFV---------EPVFEANQKLIGNNP--IILQCQV-TGNPKPTVIWKIDGNDV--DKSWLFD---------------------ESLSLLRI---EKLTGKSAQISCTAENKAGTASRDF-----FIQNIAAPTF------KNEGDQETIFRESETITLDCPVSLG---DFQITW-MKQGLPLTENDAIFTLDNTRLTILNANRDHEDIYTCVANNTAGQVSKDFDVV-VQVLPKIKNAVVTL-EINEGEEIILTCDAEGNPTPTAKWDFNQGDLPKEAVFVNNNHTVVVNNVTKYHTGVYKCYA-TNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVG----ISWTVNGKPFLAETDGVQTLAGGRFLHIVSA------KTDDHGSYACTVTNEAGVATKTFNLFVQVP-PTIVNEGG 2106          

HSP 5 Score: 54.299 bits (129), Expect = 5.608e-7
Identity = 121/543 (22.28%), Postives = 204/543 (37.57%), Query Frame = 3
Query:  462 ENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLG-ETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNR-GFEKFNFPEAKAKIEIHVAPTV----TMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYI-------NDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLR-MLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRES---NNDII---------GHGTILYRKNIQELDFGTYICTAGVENFDLKSKKII-LAKRIKPMIRENPDHRASLG-------RSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSP 1988
            +N+    +STVT+ C         + W K G  +  E  +DI             IPN    GN  L+IT +   D G + C+    +N+  S    ++V V + P    +I   G+  +    +N  +V+         C     RP A++TW+   + ++ D             T+ + + +   KLR++ S+               C ATN  G +K +F     K+ + VAP+      +  ++ N GN        T+ C A G P   +  W         ND  V  D     +I  T   ++    CIA N     DL   L V   P    +         G    L C+++S  + ++ WQ++    N D +           G  +   + ++ D G Y C   V N   +++K+   A    P I    D  +S           V+  CV+   P   H ++ WL+  + L  D+  Y ++      ++   L I   Q    G Y C    ++G A K  ++  T+P
Sbjct: 2296 KNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADI-------------IPNGELNGN-QLKITRIKEGDAGKYTCEA---DNSAGSVEQDVNVNVITIP----KIEKDGIPSDYESQQNERVVI--------SCPV-YARPPAKITWLKAGKPLQSD---------KFVKTSANGQKLYLFKLRETDSS------------KYTCIATNEAGTDKRDF-----KVSMLVAPSFDEPNIVRRITVNSGNPS------TLHCPAKGSPSPTI-TWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGV-DVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCI--VRNPAGEARKLFDFAVNDPPSIS---DELSSANIQTIVPYYPVEINCVVSGSP---HPKVYWLFDDKPLEPDSAAYELT------NNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAP 2760          

HSP 6 Score: 52.373 bits (124), Expect = 2.071e-6
Identity = 99/414 (23.91%), Postives = 160/414 (38.65%), Query Frame = 3
Query:  804 GMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYIND---NEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRM--LNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRES---NNDIIGHGT----ILYRKNIQELDFGTYIC-TAGVENFDLKSKKIILAKRIKPMIRENPDHRASL-GRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLIL 2003
            GM  + +   NS   V +G+  A+ C    G P   +TW +D   I P+ S +F      T+T  +  IV   K   S+S +              C ATN   +     E K  I I   P ++    S N+      +D  TI C   G P K +  W ++D    E + +   S  I      ++    C A N   G+D R   L V   P    ++     A   DD+ L C   + P     W  E    ++ +I H       L  +N++  + G ++C  + +   D  S  + + ++ K +I E P     + G +++  C    +P        W   G  L  D  K+S+        ++  L I     +D G YNC VT + G++     +    P P+IL
Sbjct:  997 GMDEKHVAVVNSTHDVLDGEGFAIPCVVS-GTPPPIITWYLDGRPITPN-SRDF------TVTADNTLIVR--KADKSYSGVYT------------CQATNSAGDN----EQKTTIRIMNTPMISPGQSSFNM----VVDDLFTIPCDVYGDP-KPVITWLLDDKPFTEGVVNEDGSLTIPNVNEAHRGTFTCHAQNAA-GNDTRTVTLTVHTTPTINAENQEKI-ALQNDDIVLECPAKALPPPVRLWTYEGEKIDSQLIPHTIREDGALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPK-IISEVPGVVDVVKGFTIEIPCRATGVPEVIRT---WNKNGIDLKMDEKKFSVD-------NLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEP-PIIL 1365          

HSP 7 Score: 51.6026 bits (122), Expect = 3.997e-6
Identity = 128/536 (23.88%), Postives = 211/536 (39.37%), Query Frame = 3
Query:  468 QRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRA-QLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATN-RGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEF---SENDWITISCSALGRPD-----KFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRM--LNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRES---NNDIIGHGTILYRK-----NIQELDFGTYICTAGVENFDLKSKK-IILAKRIKP-MIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGS--ASKVMVLSKTS--PIPL 1997
            ++V       I+C V+     +V W+++G  + ET       G+ G  VRY     ++ G   L I +    D G + C     N A ++Q+A  L VLV+   PKII      + P             +G   +L C A RG P   ++W ++   I+   +G+  G   GT+                    KA+   L+     +C+A N  G +   FP     ++  VAP ++        GN +   SE     I C            K       ++N + +++    KI +TR  ++    C A N K G+  +   LNV   P+  +  P     + GD VTL C     P   I W +++    N  +       +K     +I     G Y C A  EN+   +++ I L   I P ++ E  +   +  ++V   C    IP      I W+      I +N KY I          + L+I N+   D G Y+C   +D G   A++ ++++K S  P P+
Sbjct: 4091 KQVIEGELAVIECLVEGYPAPQVSWLRNGNRV-ET-------GVQG--VRY-----VTDGRM-LTIIEARSLDSGIYLCSAT--NEAGSAQQAYTLEVLVS---PKIITSTPGVLTPS------------SGSKFSLPC-AVRGYPDPIISWTLNGNDIKDGENGHTIGA-DGTL-----------------HIEKAEERHLI----YECTAKNDAGADTLEFP-----VQTIVAPKISTS------GNRYINGSEGTETVIKCEIESESSEFSWSKNGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAAN-KAGNATQKTNLNVGVAPKIME-RPRTQVVHKGDQVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKA--ENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNATGIP---EPVISWMRDSNIAIQNNEKYQILG--------TTLAIRNVLPDDDGFYHCIAKSDAGQKIATRKLIVNKPSDRPAPI 4544          
BLAST of NEPH-2 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 75.0998 bits (183), Expect = 2.804e-13
Identity = 109/514 (21.21%), Postives = 185/514 (35.99%), Query Frame = 3
Query:  489 TVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGAR----LTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNR-------SSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGP---QFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESN--------NDIIGHGTILYRKNIQELDFGTYIC----TAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGS 1952
            T+ ++C +  I    V W K+G  +  T S +                 L+  N    I +V + D+G + C    +     S    L VL    PP+    G Q            P +   GD + L C  +     A     ++W  D+  ++ DL+ N +    G    IS+  + N  L                     C A NR  E       + K+EI   P +  DI   ++  + + N    + C+  G P   + KW  N  EV +D            +I  T + +     C+A N     +L M+   + P     K D+P      +G+ +TL CN   NP   + W +  +          I   G  L   ++++ D G Y C     AG     +    ++  +  +  I  +P  R    +S+  +C+    P+    Q+ W   G  L +     +++++       + + INN+  SD G Y C      GS
Sbjct: 3591 TIYLECPISGIPQPDVIWTKNGMDINMTDSRVI----------------LAQNNETFGIENVQVTDQGRYTCTATNRGGK-ASHDFSLDVL---SPPEFDIHGTQ------------PTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGL-------------------YTCIALNRAGEA----SLEFKVEILSPPVI--DISRNDVQPQVAVNQPTIMRCAVTGHPFPSI-KWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPI---KALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSP--RLPAQQSLTLQCLAQGKPVP---QMRWTLNGTALTHSTPGITVASDS------TFIQINNVSLSDKGVYTCYAENVAGS 4032          

HSP 2 Score: 71.633 bits (174), Expect = 3.296e-12
Identity = 116/508 (22.83%), Postives = 191/508 (37.60%), Query Frame = 3
Query:  471 RVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVA-SGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMD--IVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANN--GKEGHDLRMLNVKYGPQFKDDSPPLYPANI--GDDVTLTCNTDSNPMANIYWQRES-----NNDIIG-HGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDH--RASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLG 1949
             +  ++T+ I CR + I   ++ W   G  + E         M G  V Y        G+  L+I ++    EG + C    K     + RA+    V  S PP+++      M  E +R       V  G    +RC+   G P   + W+ D E    DL                  +  +TKL    S L  +   L +G +  C ATN+  E     +    +E+ V P +  +  ++    GN +       + C   GRP  ++  W  N  E+   N   +   ATR  ++    CIA+N  G    D  +++V   P F+         NI  G+   + C  D +P   I W +       +N I+   G  L     Q  D G Y C A   ++    +   +    KP I E  D   +A  G  +  KC +    + N    +   RG   + ++++++I            L IN++   D GQY+C    + G
Sbjct: 3046 EIVADTTLEIPCRTEGIPPPEISWFLDGKPILE---------MPG--VTY------KQGDLSLRIDNIKPNQEGRYTCVAENK-----AGRAEQDTYVEISEPPRVV------MASEVMR-------VVEGRQTTIRCEV-FGNPEPVVNWLKDGEPYTSDL------------------LQFSTKL----SYLHLRETTLADGGTYTCIATNKAGES----QTTTDVEVLVPPRIEDEERVLQGKEGNTY------MVHCQVTGRPVPYV-TWKRNGKEIEQFNPVLHIRNATRA-DEGKYSCIASNEAGTAVADF-LIDVFTKPTFETHETTF---NIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVA-TNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPV----LGNPTPTVTWKRGDDAVPNDSRHTIVNNYD-------LKINSVTTEDAGQYSCIAVNEAG 3467          

HSP 3 Score: 71.2478 bits (173), Expect = 3.805e-12
Identity = 89/342 (26.02%), Postives = 133/342 (38.89%), Query Frame = 3
Query: 1032 DSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTV--TMDIVSQNL-GNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSS------YKIKATRTMNKAVVKCIANNGKEGHDLR---MLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESN-------NDIIGHGTILYRKNIQELDFGTYIC----TAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSP 1988
            D+   LKA   Q  +G    C ATN     +   E   K+ ++  P +  T+D   + + G E      I + C  LG P   +  W   D+ V ND+R +       KI +  T +     CIA N  E  +L       V   P F      LY     D +T+ C   S P+ +I W R            I   G+ +     +  D G YIC     AG  + DL  K ++  K  K  I  NP   A + R++  +C I  IP      ++W   G  +   +++  ++             I N+Q +D G+Y C+ T   G AS    L   SP
Sbjct: 3352 DTLMILKA---QRFDGGLYTCVATN----SYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGE------IILKCPVLGNPTPTV-TWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVN--EAGNLTTHYAAEVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNP--LAIVARTIYLECPISGIP---QPDVIWTKNGMDINMTDSRVILAQNN------ETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSP 3666          

HSP 4 Score: 57.7658 bits (138), Expect = 5.426e-8
Identity = 129/544 (23.71%), Postives = 210/544 (38.60%), Query Frame = 3
Query:  462 ENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRA-QLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKS--IKCSATNR-GFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNE---FSENDWITISCS-ALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTM-------NKAVVKCIANN--GKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYW---QRESNNDIIGHGTILYRKNIQELDF--GTYICTAGVENFDLKSKKIILAKRIKPMIRE---NPDHRASLGRSVQAKC-VIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGG 2015
            +N  V L   +++ C +Q   + K  +V S  G    R D              IP+D     + L ITD   E+ G + C+  + N+A  ++R   L VL    PP  +         E +   N  ++ +N   + L+CQ   G P   + W ID   +  D S  F+                     +S S L+    + L GKS  I C+A N+ G    +F      I+   APT       +N G++   F E++ IT+ C  +LG    F   W +     + +N + + +  TR         ++ +  C+ANN  G+   D  ++ V+  P+ K+    L   N G+++ LTC+ + NP     W   Q +   + +               +  G Y C A         K I +  R KP         +   +L RS+  +C V D+I +     I W   G+  + +             H +S       +  D G Y C+VT + G A+K   L    P P I+  GG
Sbjct: 1650 DNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPD-----------NVQIPSD----GHRLYITDAKPENNGKYMCR--VTNSAGKAERTLTLDVL---EPPVFV---------EPVFEANQKLIGNNP--IILQCQV-TGNPKPTVIWKIDGNDV--DKSWLFD---------------------ESLSLLRI---EKLTGKSAQISCTAENKAGTASRDF-----FIQNIAAPTF------KNEGDQETIFRESETITLDCPVSLG---DFQITW-MKQGLPLTENDAIFTLDNTRLTILNANRDHEDIYTCVANNTAGQVSKDFDVV-VQVLPKIKNAVVTL-EINEGEEIILTCDAEGNPTPTAKWDFNQGDLPKEAVFVNNNHTVVVNNVTKYHTGVYKCYA-TNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVG----ISWTVNGKPFLAETDGVQTLAGGRFLHIVSA------KTDDHGSYACTVTNEAGVATKTFNLFVQVP-PTIVNEGG 2106          

HSP 5 Score: 54.299 bits (129), Expect = 5.947e-7
Identity = 121/543 (22.28%), Postives = 204/543 (37.57%), Query Frame = 3
Query:  462 ENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLG-ETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNR-GFEKFNFPEAKAKIEIHVAPTV----TMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYI-------NDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLR-MLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRES---NNDII---------GHGTILYRKNIQELDFGTYICTAGVENFDLKSKKII-LAKRIKPMIRENPDHRASLG-------RSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSP 1988
            +N+    +STVT+ C         + W K G  +  E  +DI             IPN    GN  L+IT +   D G + C+    +N+  S    ++V V + P    +I   G+  +    +N  +V+         C     RP A++TW+   + ++ D             T+ + + +   KLR++ S+               C ATN  G +K +F     K+ + VAP+      +  ++ N GN        T+ C A G P   +  W         ND  V  D     +I  T   ++    CIA N     DL   L V   P    +         G    L C+++S  + ++ WQ++    N D +           G  +   + ++ D G Y C   V N   +++K+   A    P I    D  +S           V+  CV+   P   H ++ WL+  + L  D+  Y ++      ++   L I   Q    G Y C    ++G A K  ++  T+P
Sbjct: 2296 KNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADI-------------IPNGELNGN-QLKITRIKEGDAGKYTCEA---DNSAGSVEQDVNVNVITIP----KIEKDGIPSDYESQQNERVVI--------SCPV-YARPPAKITWLKAGKPLQSD---------KFVKTSANGQKLYLFKLRETDSS------------KYTCIATNEAGTDKRDF-----KVSMLVAPSFDEPNIVRRITVNSGNPS------TLHCPAKGSPSPTI-TWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGV-DVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCI--VRNPAGEARKLFDFAVNDPPSIS---DELSSANIQTIVPYYPVEINCVVSGSP---HPKVYWLFDDKPLEPDSAAYELT------NNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAP 2760          

HSP 6 Score: 52.373 bits (124), Expect = 2.106e-6
Identity = 99/414 (23.91%), Postives = 160/414 (38.65%), Query Frame = 3
Query:  804 GMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYIND---NEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRM--LNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRES---NNDIIGHGT----ILYRKNIQELDFGTYIC-TAGVENFDLKSKKIILAKRIKPMIRENPDHRASL-GRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLIL 2003
            GM  + +   NS   V +G+  A+ C    G P   +TW +D   I P+ S +F      T+T  +  IV   K   S+S +              C ATN   +     E K  I I   P ++    S N+      +D  TI C   G P K +  W ++D    E + +   S  I      ++    C A N   G+D R   L V   P    ++     A   DD+ L C   + P     W  E    ++ +I H       L  +N++  + G ++C  + +   D  S  + + ++ K +I E P     + G +++  C    +P        W   G  L  D  K+S+        ++  L I     +D G YNC VT + G++     +    P P+IL
Sbjct:  997 GMDEKHVAVVNSTHDVLDGEGFAIPCVVS-GTPPPIITWYLDGRPITPN-SRDF------TVTADNTLIVR--KADKSYSGVYT------------CQATNSAGDN----EQKTTIRIMNTPMISPGQSSFNM----VVDDLFTIPCDVYGDP-KPVITWLLDDKPFTEGVVNEDGSLTIPNVNEAHRGTFTCHAQNAA-GNDTRTVTLTVHTTPTINAENQEKI-ALQNDDIVLECPAKALPPPVRLWTYEGEKIDSQLIPHTIREDGALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPK-IISEVPGVVDVVKGFTIEIPCRATGVPEVIRT---WNKNGIDLKMDEKKFSVD-------NLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEP-PIIL 1365          

HSP 7 Score: 52.373 bits (124), Expect = 2.178e-6
Identity = 107/502 (21.31%), Postives = 180/502 (35.86%), Query Frame = 3
Query:  585 RSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYC-QMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTW--------MIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNE-----VMNDNRSSYKIKATRTMNKAVVKCIANN--GKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTD-----SNPMANIYWQRES---------NNDIIGHGTILYRKNIQELDFGTYICTA----GVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSP 1988
            R    V N  R+ I N     NYDL+I  V  ED G + C  +N   N  T   A++      G P  ++ G            N   V++N D + + C     RP   ++W        + D   I PD S                  +N  KL D              GK I C A+N         +    ++I V P +    +  N     +   ++    S + +PD    K  ++ N      ++  N  ++ I+  +  ++    C A N  GK  HD   L+V   P+F            GD +TLTC        ++ + ++ W ++S         N DI   G  L        + G Y C A    G  + + K +  IL+  +  + R +   + ++ +    +C +   P  +   I WL  G+ + +D     +   +       +L I    +   G+++C    D G     MVL   +P
Sbjct: 3426 RGDDAVPNDSRHTIVN-----NYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEV-----IGKPTFVRKGG-----------NLYEVIEN-DTITMDCGV-TSRPLPSISWFRGDKPVYLYDRYSISPDGS---------------HITINKAKLSDG-------------GKYI-CRASNEA----GTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFS-LDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVE--ILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPS---IKWLKNGKEVTDDENIRIVEQGQ-------VLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTP 3858          

HSP 8 Score: 51.6026 bits (122), Expect = 4.239e-6
Identity = 128/536 (23.88%), Postives = 211/536 (39.37%), Query Frame = 3
Query:  468 QRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRA-QLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATN-RGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEF---SENDWITISCSALGRPD-----KFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRM--LNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRES---NNDIIGHGTILYRK-----NIQELDFGTYICTAGVENFDLKSKK-IILAKRIKP-MIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGS--ASKVMVLSKTS--PIPL 1997
            ++V       I+C V+     +V W+++G  + ET       G+ G  VRY     ++ G   L I +    D G + C     N A ++Q+A  L VLV+   PKII      + P             +G   +L C A RG P   ++W ++   I+   +G+  G   GT+                    KA+   L+     +C+A N  G +   FP     ++  VAP ++        GN +   SE     I C            K       ++N + +++    KI +TR  ++    C A N K G+  +   LNV   P+  +  P     + GD VTL C     P   I W +++    N  +       +K     +I     G Y C A  EN+   +++ I L   I P ++ E  +   +  ++V   C    IP      I W+      I +N KY I          + L+I N+   D G Y+C   +D G   A++ ++++K S  P P+
Sbjct: 4053 KQVIEGELAVIECLVEGYPAPQVSWLRNGNRV-ET-------GVQG--VRY-----VTDGRM-LTIIEARSLDSGIYLCSAT--NEAGSAQQAYTLEVLVS---PKIITSTPGVLTPS------------SGSKFSLPC-AVRGYPDPIISWTLNGNDIKDGENGHTIGA-DGTL-----------------HIEKAEERHLI----YECTAKNDAGADTLEFP-----VQTIVAPKISTS------GNRYINGSEGTETVIKCEIESESSEFSWSKNGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAAN-KAGNATQKTNLNVGVAPKIME-RPRTQVVHKGDQVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKA--ENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNATGIP---EPVISWMRDSNIAIQNNEKYQILG--------TTLAIRNVLPDDDGFYHCIAKSDAGQKIATRKLIVNKPSDRPAPI 4506          
BLAST of NEPH-2 vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 74.7146 bits (182), Expect = 3.377e-13
Identity = 109/514 (21.21%), Postives = 185/514 (35.99%), Query Frame = 3
Query:  489 TVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGAR----LTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNR-------SSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGP---QFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESN--------NDIIGHGTILYRKNIQELDFGTYIC----TAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGS 1952
            T+ ++C +  I    V W K+G  +  T S +                 L+  N    I +V + D+G + C    +     S    L VL    PP+    G Q            P +   GD + L C  +     A     ++W  D+  ++ DL+ N +    G    IS+  + N  L                     C A NR  E       + K+EI   P +  DI   ++  + + N    + C+  G P   + KW  N  EV +D            +I  T + +     C+A N     +L M+   + P     K D+P      +G+ +TL CN   NP   + W +  +          I   G  L   ++++ D G Y C     AG     +    ++  +  +  I  +P  R    +S+  +C+    P+    Q+ W   G  L +     +++++       + + INN+  SD G Y C      GS
Sbjct: 3591 TIYLECPISGIPQPDVIWTKNGMDINMTDSRVI----------------LAQNNETFGIENVQVTDQGRYTCTATNRGGK-ASHDFSLDVL---SPPEFDIHGTQ------------PTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGL-------------------YTCIALNRAGEA----SLEFKVEILSPPVI--DISRNDVQPQVAVNQPTIMRCAVTGHPFPSI-KWLKNGKEVTDDENIRIVEQGQVLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTPPVVSVKSDNPI---KALGETITLFCNASGNPYPQLKWAKGGSLIFDSPDGARISLKGARLDIPHLKKTDVGDYTCQALNAAGTSEASVSVDVLVPPEINRDGIDMSP--RLPAQQSLTLQCLAQGKPVP---QMRWTLNGTALTHSTPGITVASDS------TFIQINNVSLSDKGVYTCYAENVAGS 4032          

HSP 2 Score: 71.633 bits (174), Expect = 3.469e-12
Identity = 116/508 (22.83%), Postives = 191/508 (37.60%), Query Frame = 3
Query:  471 RVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVA-SGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMD--IVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANN--GKEGHDLRMLNVKYGPQFKDDSPPLYPANI--GDDVTLTCNTDSNPMANIYWQRES-----NNDIIG-HGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDH--RASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLG 1949
             +  ++T+ I CR + I   ++ W   G  + E         M G  V Y        G+  L+I ++    EG + C    K     + RA+    V  S PP+++      M  E +R       V  G    +RC+   G P   + W+ D E    DL                  +  +TKL    S L  +   L +G +  C ATN+  E     +    +E+ V P +  +  ++    GN +       + C   GRP  ++  W  N  E+   N   +   ATR  ++    CIA+N  G    D  +++V   P F+         NI  G+   + C  D +P   I W +       +N I+   G  L     Q  D G Y C A   ++    +   +    KP I E  D   +A  G  +  KC +    + N    +   RG   + ++++++I            L IN++   D GQY+C    + G
Sbjct: 3046 EIVADTTLEIPCRTEGIPPPEISWFLDGKPILE---------MPG--VTY------KQGDLSLRIDNIKPNQEGRYTCVAENK-----AGRAEQDTYVEISEPPRVV------MASEVMR-------VVEGRQTTIRCEV-FGNPEPVVNWLKDGEPYTSDL------------------LQFSTKL----SYLHLRETTLADGGTYTCIATNKAGES----QTTTDVEVLVPPRIEDEERVLQGKEGNTY------MVHCQVTGRPVPYV-TWKRNGKEIEQFNPVLHIRNATRA-DEGKYSCIASNEAGTAVADF-LIDVFTKPTFETHETTF---NIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDTLMILKAQRFDGGLYTCVA-TNSYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGEIILKCPV----LGNPTPTVTWKRGDDAVPNDSRHTIVNNYD-------LKINSVTTEDAGQYSCIAVNEAG 3467          

HSP 3 Score: 71.2478 bits (173), Expect = 4.176e-12
Identity = 89/342 (26.02%), Postives = 133/342 (38.89%), Query Frame = 3
Query: 1032 DSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTV--TMDIVSQNL-GNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSS------YKIKATRTMNKAVVKCIANNGKEGHDLRM---LNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESN-------NDIIGHGTILYRKNIQELDFGTYIC----TAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSP 1988
            D+   LKA   Q  +G    C ATN     +   E   K+ ++  P +  T+D   + + G E      I + C  LG P   +  W   D+ V ND+R +       KI +  T +     CIA N  E  +L       V   P F      LY     D +T+ C   S P+ +I W R            I   G+ +     +  D G YIC     AG  + DL  K ++  K  K  I  NP   A + R++  +C I  IP      ++W   G  +   +++  ++             I N+Q +D G+Y C+ T   G AS    L   SP
Sbjct: 3352 DTLMILKA---QRFDGGLYTCVATN----SYGDSEQDFKVNVYTKPYIDETIDQTPKAVAGGE------IILKCPVLGNPTPTV-TWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVN--EAGNLTTHYAAEVIGKPTFVRKGGNLYEVIENDTITMDCGVTSRPLPSISWFRGDKPVYLYDRYSISPDGSHITINKAKLSDGGKYICRASNEAGTSDIDLILKILVPPKIDKSNIIGNP--LAIVARTIYLECPISGIP---QPDVIWTKNGMDINMTDSRVILAQNN------ETFGIENVQVTDQGRYTCTATNRGGKASHDFSLDVLSP 3666          

HSP 4 Score: 57.3806 bits (137), Expect = 6.369e-8
Identity = 129/544 (23.71%), Postives = 210/544 (38.60%), Query Frame = 3
Query:  462 ENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRA-QLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKS--IKCSATNR-GFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNE---FSENDWITISCS-ALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTM-------NKAVVKCIANN--GKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYW---QRESNNDIIGHGTILYRKNIQELDF--GTYICTAGVENFDLKSKKIILAKRIKPMIRE---NPDHRASLGRSVQAKC-VIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGG 2015
            +N  V L   +++ C +Q   + K  +V S  G    R D              IP+D     + L ITD   E+ G + C+  + N+A  ++R   L VL    PP  +         E +   N  ++ +N   + L+CQ   G P   + W ID   +  D S  F+                     +S S L+    + L GKS  I C+A N+ G    +F      I+   APT       +N G++   F E++ IT+ C  +LG    F   W +     + +N + + +  TR         ++ +  C+ANN  G+   D  ++ V+  P+ K+    L   N G+++ LTC+ + NP     W   Q +   + +               +  G Y C A         K I +  R KP         +   +L RS+  +C V D+I +     I W   G+  + +             H +S       +  D G Y C+VT + G A+K   L    P P I+  GG
Sbjct: 1650 DNLEVFLGKDISLSCDLQTESDDKTTFVWSINGSESDRPD-----------NVQIPSD----GHRLYITDAKPENNGKYMCR--VTNSAGKAERTLTLDVL---EPPVFV---------EPVFEANQKLIGNNP--IILQCQV-TGNPKPTVIWKIDGNDV--DKSWLFD---------------------ESLSLLRI---EKLTGKSAQISCTAENKAGTASRDF-----FIQNIAAPTF------KNEGDQETIFRESETITLDCPVSLG---DFQITW-MKQGLPLTENDAIFTLDNTRLTILNANRDHEDIYTCVANNTAGQVSKDFDVV-VQVLPKIKNAVVTL-EINEGEEIILTCDAEGNPTPTAKWDFNQGDLPKEAVFVNNNHTVVVNNVTKYHTGVYKCYA-TNKVGQAVKTINVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVG----ISWTVNGKPFLAETDGVQTLAGGRFLHIVSA------KTDDHGSYACTVTNEAGVATKTFNLFVQVP-PTIVNEGG 2106          

HSP 5 Score: 53.9138 bits (128), Expect = 7.281e-7
Identity = 121/543 (22.28%), Postives = 204/543 (37.57%), Query Frame = 3
Query:  462 ENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLG-ETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNR-GFEKFNFPEAKAKIEIHVAPTV----TMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYI-------NDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLR-MLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRES---NNDII---------GHGTILYRKNIQELDFGTYICTAGVENFDLKSKKII-LAKRIKPMIRENPDHRASLG-------RSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSP 1988
            +N+    +STVT+ C         + W K G  +  E  +DI             IPN    GN  L+IT +   D G + C+    +N+  S    ++V V + P    +I   G+  +    +N  +V+         C     RP A++TW+   + ++ D             T+ + + +   KLR++ S+               C ATN  G +K +F     K+ + VAP+      +  ++ N GN        T+ C A G P   +  W         ND  V  D     +I  T   ++    CIA N     DL   L V   P    +         G    L C+++S  + ++ WQ++    N D +           G  +   + ++ D G Y C   V N   +++K+   A    P I    D  +S           V+  CV+   P   H ++ WL+  + L  D+  Y ++      ++   L I   Q    G Y C    ++G A K  ++  T+P
Sbjct: 2296 KNKTAVEHSTVTLSCPATGKPEPDITWFKDGEAIHIENIADI-------------IPNGELNGN-QLKITRIKEGDAGKYTCEA---DNSAGSVEQDVNVNVITIP----KIEKDGIPSDYESQQNERVVI--------SCPV-YARPPAKITWLKAGKPLQSD---------KFVKTSANGQKLYLFKLRETDSS------------KYTCIATNEAGTDKRDF-----KVSMLVAPSFDEPNIVRRITVNSGNPS------TLHCPAKGSPSPTI-TWLKDGNAIEPNDRYVFFDAGRQLQISKTEGSDQGRYTCIATNSVGSDDLENTLEVIIPPVIDGERREAVAVIEGFSSELFCDSNSTGV-DVEWQKDGLTINQDTLRGDSFIQIPSSGKKMSFLSARKSDSGRYTCI--VRNPAGEARKLFDFAVNDPPSIS---DELSSANIQTIVPYYPVEINCVVSGSP---HPKVYWLFDDKPLEPDSAAYELT------NNGETLKIVRSQVEHAGTYTCEAQNNVGKARKDFLVRVTAP 2760          

HSP 6 Score: 52.373 bits (124), Expect = 2.390e-6
Identity = 104/492 (21.14%), Postives = 177/492 (35.98%), Query Frame = 3
Query:  624 IPND---LSAGNYDLQITDVNLEDEGDFYC-QMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTW--------MIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNE-----VMNDNRSSYKIKATRTMNKAVVKCIANN--GKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTD-----SNPMANIYWQRES---------NNDIIGHGTILYRKNIQELDFGTYICTA----GVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSP 1988
            +PND       NYDL+I  V  ED G + C  +N   N  T   A++      G P  ++ G            N   V++N D + + C     RP   ++W        + D   I PD S                  +N  KL D              GK I C A+N         +    ++I V P +    +  N     +   ++    S + +PD    K  ++ N      ++  N  ++ I+  +  ++    C A N  GK  HD   L+V   P+F            GD +TLTC        ++ + ++ W ++S         N DI   G  L        + G Y C A    G  + + K +  IL+  +  + R +   + ++ +    +C +   P  +   I WL  G+ + +D     +   +       +L I    +   G+++C    D G     MVL   +P
Sbjct: 3431 VPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEV-----IGKPTFVRKGG-----------NLYEVIEN-DTITMDCGV-TSRPLPSISWFRGDKPVYLYDRYSISPDGS---------------HITINKAKLSDG-------------GKYI-CRASNEA----GTSDIDLILKILVPPKIDKSNIIGNPLAIVARTIYLECPISGIPQPDVIWTKNGMDINMTDSRVILAQNNETFGIENVQVTDQGRYTCTATNRGGKASHDFS-LDVLSPPEFDIHGTQPTIKREGDTITLTCPIKLAEDIADQVMDVSWTKDSRALDGDLTDNVDISDDGRKLTISQASLENAGLYTCIALNRAGEASLEFKVE--ILSPPVIDISRNDVQPQVAVNQPTIMRCAVTGHPFPS---IKWLKNGKEVTDDENIRIVEQGQ-------VLQILRTDSDHAGKWSCVAENDAGVKELEMVLDVFTP 3858          

HSP 7 Score: 52.373 bits (124), Expect = 2.578e-6
Identity = 99/414 (23.91%), Postives = 160/414 (38.65%), Query Frame = 3
Query:  804 GMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYIND---NEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRM--LNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRES---NNDIIGHGT----ILYRKNIQELDFGTYIC-TAGVENFDLKSKKIILAKRIKPMIRENPDHRASL-GRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLIL 2003
            GM  + +   NS   V +G+  A+ C    G P   +TW +D   I P+ S +F      T+T  +  IV   K   S+S +              C ATN   +     E K  I I   P ++    S N+      +D  TI C   G P K +  W ++D    E + +   S  I      ++    C A N   G+D R   L V   P    ++     A   DD+ L C   + P     W  E    ++ +I H       L  +N++  + G ++C  + +   D  S  + + ++ K +I E P     + G +++  C    +P        W   G  L  D  K+S+        ++  L I     +D G YNC VT + G++     +    P P+IL
Sbjct:  997 GMDEKHVAVVNSTHDVLDGEGFAIPCVVS-GTPPPIITWYLDGRPITPN-SRDF------TVTADNTLIVR--KADKSYSGVYT------------CQATNSAGDN----EQKTTIRIMNTPMISPGQSSFNM----VVDDLFTIPCDVYGDP-KPVITWLLDDKPFTEGVVNEDGSLTIPNVNEAHRGTFTCHAQNAA-GNDTRTVTLTVHTTPTINAENQEKI-ALQNDDIVLECPAKALPPPVRLWTYEGEKIDSQLIPHTIREDGALVLQNVKLENTGVFVCQVSNLAGEDSLSYTLTVHEKPK-IISEVPGVVDVVKGFTIEIPCRATGVPEVIRT---WNKNGIDLKMDEKKFSVD-------NLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDVQEP-PIIL 1365          

HSP 8 Score: 51.2174 bits (121), Expect = 5.146e-6
Identity = 128/536 (23.88%), Postives = 211/536 (39.37%), Query Frame = 3
Query:  468 QRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRA-QLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATN-RGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEF---SENDWITISCSALGRPD-----KFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRM--LNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRES---NNDIIGHGTILYRK-----NIQELDFGTYICTAGVENFDLKSKK-IILAKRIKP-MIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGS--ASKVMVLSKTS--PIPL 1997
            ++V       I+C V+     +V W+++G  + ET       G+ G  VRY     ++ G   L I +    D G + C     N A ++Q+A  L VLV+   PKII      + P             +G   +L C A RG P   ++W ++   I+   +G+  G   GT+                    KA+   L+     +C+A N  G +   FP     ++  VAP ++        GN +   SE     I C            K       ++N + +++    KI +TR  ++    C A N K G+  +   LNV   P+  +  P     + GD VTL C     P   I W +++    N  +       +K     +I     G Y C A  EN+   +++ I L   I P ++ E  +   +  ++V   C    IP      I W+      I +N KY I          + L+I N+   D G Y+C   +D G   A++ ++++K S  P P+
Sbjct: 4053 KQVIEGELAVIECLVEGYPAPQVSWLRNGNRV-ET-------GVQG--VRY-----VTDGRM-LTIIEARSLDSGIYLCSAT--NEAGSAQQAYTLEVLVS---PKIITSTPGVLTPS------------SGSKFSLPC-AVRGYPDPIISWTLNGNDIKDGENGHTIGA-DGTL-----------------HIEKAEERHLI----YECTAKNDAGADTLEFP-----VQTIVAPKISTS------GNRYINGSEGTETVIKCEIESESSEFSWSKNGVPLLPSNNLIFSEDYKLIKILSTRLSDQGEYSCTAAN-KAGNATQKTNLNVGVAPKIME-RPRTQVVHKGDQVTLWCEASGVPQPAITWYKDNELLTNTGVDETATTKKKSVIFSSISPSQAGVYTCKA--ENWVASTEEDIDLIVMIPPEVVPERMNVSTNPRQTVFLSCNATGIP---EPVISWMRDSNIAIQNNEKYQILG--------TTLAIRNVLPDDDGFYHCIAKSDAGQKIATRKLIVNKPSDRPAPI 4506          
BLAST of NEPH-2 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0332492)

HSP 1 Score: 174.866 bits (442), Expect = 2.761e-44
Identity = 145/539 (26.90%), Postives = 246/539 (45.64%), Query Frame = 3
Query:  441 NYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETR--SDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMN---IKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNL-GNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIK-ATRTMNKAVVKC-IANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENF-DLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLIN----DNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVM-VLSKTSPIPLILIVGG 2015
             +  + P++Q   + S VT+ CRV   K   + W K  FGLG+ R  S    + MVG+            G++ L I  + L+D+  + CQ+         I S+ A+L VLV    PKI Q      G   +  E+  I         L C ++ G+P A +TW+        D  GN   +++  I  + + + ++ ++  + S LK    +  +  +  C A N     +    AK  +E+  AP V + +V   L G +  E   + +SC A   P +  ++W+IND  +  D  +   I   +R  + A+VKC + N   +    + L++ +GP F+   P    A++G  V++ C+   NP   I W  E+++ ++G    L  K   E   G Y C A V  F ++ ++  +  KR  P+I  +      +G  V+  C+  SIP A H  I+W + G ++IN    D   Y        +   + L I + +A+ FG+YNC+V    G  S V+ +L +   IP++L+V G
Sbjct:   82 QHFAMEPQDQTAVVGSRVTLPCRVME-KVGALQWTKDDFGLGQHRNLSGFERYSMVGSD---------EEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQ------GDYLVTTEDREI--------ELECVSQGGKPAAEITWI--------DGLGN---VLTKGIEYVKEPLADSRRI-TARSILKLAPKKEHHNTTFTCQAQNTADRTYR--SAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFR-QRPVSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKLKVSSETA-GRYFCKAVVNGFPEIGAEATLYVKR-APIITSHKVQFGGVGGRVKIDCLAFSIPKAEH--ILWSFEG-KIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVVMG 576          
BLAST of NEPH-2 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0309498)

HSP 1 Score: 174.866 bits (442), Expect = 2.761e-44
Identity = 145/539 (26.90%), Postives = 246/539 (45.64%), Query Frame = 3
Query:  441 NYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETR--SDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMN---IKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNL-GNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIK-ATRTMNKAVVKC-IANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENF-DLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLIN----DNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVM-VLSKTSPIPLILIVGG 2015
             +  + P++Q   + S VT+ CRV   K   + W K  FGLG+ R  S    + MVG+            G++ L I  + L+D+  + CQ+         I S+ A+L VLV    PKI Q      G   +  E+  I         L C ++ G+P A +TW+        D  GN   +++  I  + + + ++ ++  + S LK    +  +  +  C A N     +    AK  +E+  AP V + +V   L G +  E   + +SC A   P +  ++W+IND  +  D  +   I   +R  + A+VKC + N   +    + L++ +GP F+   P    A++G  V++ C+   NP   I W  E+++ ++G    L  K   E   G Y C A V  F ++ ++  +  KR  P+I  +      +G  V+  C+  SIP A H  I+W + G ++IN    D   Y        +   + L I + +A+ FG+YNC+V    G  S V+ +L +   IP++L+V G
Sbjct:   82 QHFAMEPQDQTAVVGSRVTLPCRVME-KVGALQWTKDDFGLGQHRNLSGFERYSMVGSD---------EEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQ------GDYLVTTEDREI--------ELECVSQGGKPAAEITWI--------DGLGN---VLTKGIEYVKEPLADSRRI-TARSILKLAPKKEHHNTTFTCQAQNTADRTYR--SAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFR-QRPVSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKLKVSSETA-GRYFCKAVVNGFPEIGAEATLYVKR-APIITSHKVQFGGVGGRVKIDCLAFSIPKAEH--ILWSFEG-KIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVVMG 576          
BLAST of NEPH-2 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0070560)

HSP 1 Score: 174.866 bits (442), Expect = 2.761e-44
Identity = 145/539 (26.90%), Postives = 246/539 (45.64%), Query Frame = 3
Query:  441 NYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETR--SDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMN---IKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNL-GNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIK-ATRTMNKAVVKC-IANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENF-DLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLIN----DNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVM-VLSKTSPIPLILIVGG 2015
             +  + P++Q   + S VT+ CRV   K   + W K  FGLG+ R  S    + MVG+            G++ L I  + L+D+  + CQ+         I S+ A+L VLV    PKI Q      G   +  E+  I         L C ++ G+P A +TW+        D  GN   +++  I  + + + ++ ++  + S LK    +  +  +  C A N     +    AK  +E+  AP V + +V   L G +  E   + +SC A   P +  ++W+IND  +  D  +   I   +R  + A+VKC + N   +    + L++ +GP F+   P    A++G  V++ C+   NP   I W  E+++ ++G    L  K   E   G Y C A V  F ++ ++  +  KR  P+I  +      +G  V+  C+  SIP A H  I+W + G ++IN    D   Y        +   + L I + +A+ FG+YNC+V    G  S V+ +L +   IP++L+V G
Sbjct:   82 QHFAMEPQDQTAVVGSRVTLPCRVME-KVGALQWTKDDFGLGQHRNLSGFERYSMVGSD---------EEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQ------GDYLVTTEDREI--------ELECVSQGGKPAAEITWI--------DGLGN---VLTKGIEYVKEPLADSRRI-TARSILKLAPKKEHHNTTFTCQAQNTADRTYR--SAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFR-QRPVSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKLKVSSETA-GRYFCKAVVNGFPEIGAEATLYVKR-APIITSHKVQFGGVGGRVKIDCLAFSIPKAEH--ILWSFEG-KIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVVMG 576          
BLAST of NEPH-2 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0309499)

HSP 1 Score: 174.866 bits (442), Expect = 2.761e-44
Identity = 145/539 (26.90%), Postives = 246/539 (45.64%), Query Frame = 3
Query:  441 NYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETR--SDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMN---IKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNL-GNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIK-ATRTMNKAVVKC-IANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENF-DLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLIN----DNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVM-VLSKTSPIPLILIVGG 2015
             +  + P++Q   + S VT+ CRV   K   + W K  FGLG+ R  S    + MVG+            G++ L I  + L+D+  + CQ+         I S+ A+L VLV    PKI Q      G   +  E+  I         L C ++ G+P A +TW+        D  GN   +++  I  + + + ++ ++  + S LK    +  +  +  C A N     +    AK  +E+  AP V + +V   L G +  E   + +SC A   P +  ++W+IND  +  D  +   I   +R  + A+VKC + N   +    + L++ +GP F+   P    A++G  V++ C+   NP   I W  E+++ ++G    L  K   E   G Y C A V  F ++ ++  +  KR  P+I  +      +G  V+  C+  SIP A H  I+W + G ++IN    D   Y        +   + L I + +A+ FG+YNC+V    G  S V+ +L +   IP++L+V G
Sbjct:   82 QHFAMEPQDQTAVVGSRVTLPCRVME-KVGALQWTKDDFGLGQHRNLSGFERYSMVGSD---------EEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQ------GDYLVTTEDREI--------ELECVSQGGKPAAEITWI--------DGLGN---VLTKGIEYVKEPLADSRRI-TARSILKLAPKKEHHNTTFTCQAQNTADRTYR--SAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFR-QRPVSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKLKVSSETA-GRYFCKAVVNGFPEIGAEATLYVKR-APIITSHKVQFGGVGGRVKIDCLAFSIPKAEH--ILWSFEG-KIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVVMG 576          
BLAST of NEPH-2 vs. Ensembl Fly
Match: kirre (gene:FBgn0028369 transcript:FBtr0070559)

HSP 1 Score: 174.866 bits (442), Expect = 2.761e-44
Identity = 145/539 (26.90%), Postives = 246/539 (45.64%), Query Frame = 3
Query:  441 NYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETR--SDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMN---IKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNL-GNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIK-ATRTMNKAVVKC-IANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENF-DLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLIN----DNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVM-VLSKTSPIPLILIVGG 2015
             +  + P++Q   + S VT+ CRV   K   + W K  FGLG+ R  S    + MVG+            G++ L I  + L+D+  + CQ+         I S+ A+L VLV    PKI Q      G   +  E+  I         L C ++ G+P A +TW+        D  GN   +++  I  + + + ++ ++  + S LK    +  +  +  C A N     +    AK  +E+  AP V + +V   L G +  E   + +SC A   P +  ++W+IND  +  D  +   I   +R  + A+VKC + N   +    + L++ +GP F+   P    A++G  V++ C+   NP   I W  E+++ ++G    L  K   E   G Y C A V  F ++ ++  +  KR  P+I  +      +G  V+  C+  SIP A H  I+W + G ++IN    D   Y        +   + L I + +A+ FG+YNC+V    G  S V+ +L +   IP++L+V G
Sbjct:   82 QHFAMEPQDQTAVVGSRVTLPCRVME-KVGALQWTKDDFGLGQHRNLSGFERYSMVGSD---------EEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRFAKLTVLVPPEAPKITQ------GDYLVTTEDREI--------ELECVSQGGKPAAEITWI--------DGLGN---VLTKGIEYVKEPLADSRRI-TARSILKLAPKKEHHNTTFTCQAQNTADRTYR--SAKLLLEVKYAPKVIVSVVGGALAGGKIPEGAEVILSCQADANPHELSYRWFINDELMTGDFTTKMIIHNVSRQYHDAIVKCEVVNAVGKSEQSKKLDISFGPVFR-QRPVSVEADLGATVSMRCDVAGNPEPEIEWISENSDQVVGVAAELKLKVSSETA-GRYFCKAVVNGFPEIGAEATLYVKR-APIITSHKVQFGGVGGRVKIDCLAFSIPKAEH--ILWSFEG-KIINMSSADPDIYIFEEHHLPEGVRAALIIRDSKATHFGKYNCTVMNSYGGDSLVITLLREPGNIPVLLVVMG 576          
BLAST of NEPH-2 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 163.31 bits (412), Expect = 8.576e-42
Identity = 134/523 (25.62%), Postives = 225/523 (43.02%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIV-VDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P +  +     VT+ C +   + M V WVK G  LG  R D+  +       RYD+  D S G Y L I    L D+G F CQ      A  S+ AQL VLV    P II                +P+V +  GD + L C A   +P A + W+ + E+I        NG         +K ++ + K   + STL    + + +G+ I C A+N+     N  EA   I+I   P V + +  Q +     E + +   C+A   P    ++W    + + +    +Y++    +     V C   N     ++ R ++V +GP+   + P     + G D   +C    NP   I W +  +  ++ +   L  K +++ D G Y+C A V    +  K+++L     P I      +A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L++ NI  +DF   YNC+     GS ++++ L +   + L +I+G
Sbjct:   26 QPHDLVIVAGEPVTLPCTIIGYQGM-VLWVKDGLALGVNR-DLSGYP------RYDVIGDHSKGEYHLLIERTELVDDGSFECQA--IQVAGRSRPAQLTVLVPPDDPVII---------------GAPVVSLRAGDSLNLTCHANNAKPAASIIWIRNGEVI--------NG------AAYTKTLLRDGKRESTVSTLHISASNIESGQQITCRASNKAAP--NGKEATVTIDIQHFPLVNLSVEPQPV----LEGNLVKFHCAAKANPPVTHYRWAKGGSMITDATGDTYEVLVDHSFFTEPVSCEVTNALGSTNISRNVDVYFGPRLAAE-PQSLQVDRGSDAVFSCAWIGNPSLTIVWMKRGHGVVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRSTP--PPDRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIG 500          
BLAST of NEPH-2 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 164.466 bits (415), Expect = 3.269e-41
Identity = 134/523 (25.62%), Postives = 225/523 (43.02%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIV-VDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P +  +     VT+ C +   + M V WVK G  LG  R D+  +       RYD+  D S G Y L I    L D+G F CQ      A  S+ AQL VLV    P II                +P+V +  GD + L C A   +P A + W+ + E+I        NG         +K ++ + K   + STL    + + +G+ I C A+N+     N  EA   I+I   P V + +  Q +     E + +   C+A   P    ++W    + + +    +Y++    +     V C   N     ++ R ++V +GP+   + P     + G D   +C    NP   I W +  +  ++ +   L  K +++ D G Y+C A V    +  K+++L     P I      +A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L++ NI  +DF   YNC+     GS ++++ L +   + L +I+G
Sbjct:   26 QPHDLVIVAGEPVTLPCTIIGYQGM-VLWVKDGLALGVNR-DLSGYP------RYDVIGDHSKGEYHLLIERTELVDDGSFECQA--IQVAGRSRPAQLTVLVPPDDPVII---------------GAPVVSLRAGDSLNLTCHANNAKPAASIIWIRNGEVI--------NG------AAYTKTLLRDGKRESTVSTLHISASNIESGQQITCRASNKAAP--NGKEATVTIDIQHFPLVNLSVEPQPV----LEGNLVKFHCAAKANPPVTHYRWAKGGSMITDATGDTYEVLVDHSFFTEPVSCEVTNALGSTNISRNVDVYFGPRLAAE-PQSLQVDRGSDAVFSCAWIGNPSLTIVWMKRGHGVVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIG 500          
BLAST of NEPH-2 vs. Ensembl Zebrafish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 164.466 bits (415), Expect = 3.269e-41
Identity = 134/523 (25.62%), Postives = 225/523 (43.02%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIV-VDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P +  +     VT+ C +   + M V WVK G  LG  R D+  +       RYD+  D S G Y L I    L D+G F CQ      A  S+ AQL VLV    P II                +P+V +  GD + L C A   +P A + W+ + E+I        NG         +K ++ + K   + STL    + + +G+ I C A+N+     N  EA   I+I   P V + +  Q +     E + +   C+A   P    ++W    + + +    +Y++    +     V C   N     ++ R ++V +GP+   + P     + G D   +C    NP   I W +  +  ++ +   L  K +++ D G Y+C A V    +  K+++L     P I      +A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L++ NI  +DF   YNC+     GS ++++ L +   + L +I+G
Sbjct:   26 QPHDLVIVAGEPVTLPCTIIGYQGM-VLWVKDGLALGVNR-DLSGYP------RYDVIGDHSKGEYHLLIERTELVDDGSFECQA--IQVAGRSRPAQLTVLVPPDDPVII---------------GAPVVSLRAGDSLNLTCHANNAKPAASIIWIRNGEVI--------NG------AAYTKTLLRDGKRESTVSTLHISASNIESGQQITCRASNKAAP--NGKEATVTIDIQHFPLVNLSVEPQPV----LEGNLVKFHCAAKANPPVTHYRWAKGGSMITDATGDTYEVLVDHSFFTEPVSCEVTNALGSTNISRNVDVYFGPRLAAE-PQSLQVDRGSDAVFSCAWIGNPSLTIVWMKRGHGVVLSNENTLTLKAVRQEDAGKYVCRAVVPRVGVGEKEVMLTVNGPPSISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMRNIVPTDFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIG 500          
BLAST of NEPH-2 vs. Ensembl Zebrafish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 155.606 bits (392), Expect = 2.992e-39
Identity = 127/512 (24.80%), Postives = 222/512 (43.36%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIV-VDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSK 1979
             P++  V     VT+ C + P  +  V W++ G  LG  R D+  +       RY +  D  +G + L+I  V L D+  F CQ      A+ S+ A+L VLV    P I                  P+V +  GD + L C A+  +P A + W+ + E++        NG +       SK ++ + +   + STL    + + +G+ I C A+N+     N  E    I+I   P V + +  Q +     E + +   CSA   P    +KW    + +   +  +Y++    +     V C   N     ++ R ++V +GP+   + P     ++G D    C    NP   I W +  +  ++ +  IL  K++++ D G Y+C A V       K++ L     P I     H+A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    D  +S L+++NI  +DF   YNC+     GS ++++ L +
Sbjct:   39 QPQDLVVVAGQPVTLPCSI-PGYHGVVLWLRDGLALGVGR-DLSGYP------RYAVVGDHGSGEHHLRIQKVELMDDAVFECQA--IQAAMRSRPARLTVLVPPDDPMI---------------TGGPVVSLRAGDPLNLTCHADNAKPAASIIWIRNGEVL--------NGAM------YSKTLLRDGRRESTVSTLYISASNIESGQKIICRASNKAVP--NGKETSVTIDIQHLPLVNLSVEPQPV----LEGNLVKFHCSAKANPPVTQYKWAKGGSVIKEVSGDTYEVIVDHSFFTEPVSCEVTNPLGSTNISRNVDVYFGPRMAAE-PQSLQVDLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENILTLKSVRQEDAGKYVCRAVVPRVGAAEKEVSLTVNGPPTISSTQTHQAPHGEKGQIKCFIRSTP--PPDRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKE 502          
BLAST of NEPH-2 vs. Ensembl Zebrafish
Match: kirrel1a (kirre like nephrin family adhesion molecule 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2126])

HSP 1 Score: 155.606 bits (392), Expect = 2.252e-38
Identity = 134/532 (25.19%), Postives = 225/532 (42.29%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSP-IVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRML-NVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHS---------ISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGG 2015
             P +Q V L   V + C V     + V W K G  LG    D+R++       RY +   +  G Y+L+I+   L D+  + CQ      A+ S+RA+L VL+    P I               E SP I++  G    + C +   +P + + W  D   IE        G +S T      +++ + K   + S L  +      GK+  C ATN          A   + +H  P VT+ I  +++     E + +T +C A   P    +KW      +     S +  KA  +     V C   N     ++ +L +V +GP    +  P+   ++  DVTL C    NP   + W ++ ++ ++ +   LY K++ + D G Y+C A V    +   ++ L     P+I   P   A  G   + KC I S P    ++I+W ++    + +  K ++S    V+ S         +S L+INNI  SDF   YNC+     GS + ++ L +   +P+ +I GG
Sbjct:   25 EPADQSVVLGQRVVLSCVVFNYSGI-VQWTKDGLALG-IGEDLRAW------PRYRVLRLVDVGQYNLEISAAELSDDSLYECQAT--EAALRSRRAKLTVLIPPDEPVI---------------EGSPEILLTAGVPYNMSCVSRGAKPASVIEWQKDGLPIE--------GAVSTT------EVLPDRKRVTTRSYLPIQPLDTDTGKNFTCVATNLAVPMGK--RATITLNVHHPPVVTLSIEPRSV----LEGERVTFTCQATANPPIMGYKWAKGGVVIQGARESVFVTKADHSFFTEPVSCQVFNAVGSTNVSILVDVHFGPILVVEPKPVT-VDVDSDVTLNCKWAGNPPLTLTWTKKGSSMVLSNNNQLYLKSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSEPFQYAVRGERGEVKCYIASTPPP--DKIVWAWKEN--VWEKEKGTLSERYTVEQSKPSAQGGAVLSTLTINNIMESDFQSTYNCTAWNSFGSGTMIISLEEMEIVPVGIIAGG 506          
BLAST of NEPH-2 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 162.54 bits (410), Expect = 1.839e-40
Identity = 127/529 (24.01%), Postives = 229/529 (43.29%), Query Frame = 3
Query:  444 YINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIV-VDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAK---IEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLR-MLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDN-TKYSISTEKYVDHSISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTSPIPLILIV 2009
            + +  P ++ +    +VT+ C V   + + V W   G  LG  R D+  +       RY +  D S G ++L I  V L D+  + CQ      A+ SQRA+L VL+  G P I                 SP+  V       L C A   +P A +TW  D + ++  +               +K+++++ K   S S+L    +   +G S  C   N        PE + K   + +   P VT+ +    +    +E   +T  C A+  P+   ++W       +  +   Y ++   T   A V C  +N     ++   +NV +GP+   +  P+   +IGDD +  C    NP    +W ++   +++ +G  L    +   D G Y+C A V       K++ L  R  P+I     +  +LG   + +C+I+S P    ++I+W +  + L + +  ++S+ TE     +IS+L I+  + SDF  ++NCS     G  S ++ L + + +PL L++
Sbjct:    9 HFSQQPSDKVIVAGKSVTLPCVVIGYRGV-VQWTMDGLALGAER-DLPGWS------RYSVVGDPSLGEHNLHIEGVELSDDAIYECQAT--QAALRSQRARLTVLLPPGDPMI---------------PGSPVANVLLNVPYNLTCLAPVAKPAAEITWYRDGKKLDSAV--------------YTKELLSDGKSEGSASSLLITPSLADSGSSYTCRVRNEAL-----PEGREKSVTLSVQYPPKVTLSVEPPTI----TEGGSVTFLCGAVSNPEVTGYRW-AKGGVPLAVSGDKYTVEVDHTFFTAPVSCEVSNSVGASNVSTAVNVLFGPRLLTEPRPMT-VDIGDDASFFCGWTGNPTPTQFWSKKGTGEVLSNGNTLLLTKVTREDAGIYVCKAIVPRMGSTEKEVTLTVRGPPIITSEMHYETTLGGKARMECLIESTPAP--DRIVWAWDKQSLEDGSWGRFSVETEVTEVGAISVLVIDGAEQSDFLTEFNCSAINQYGEDSVIVSLRQQAALPLTLLL 485          
BLAST of NEPH-2 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 162.155 bits (409), Expect = 2.153e-40
Identity = 128/533 (24.02%), Postives = 230/533 (43.15%), Query Frame = 3
Query:  432 GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIV-VDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAK---IEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLR-MLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDN-TKYSISTEKYVDHSISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTSPIPLILIV 2009
            G   + +  P ++ +    +VT+ C V   + + V W   G  LG  R D+  +       RY +  D S G ++L I  V L D+  + CQ      A+ SQRA+L VL+  G P I                 SP+  V       L C A   +P A +TW  D + ++  +               +K+++++ K   S S+L    +   +G S  C   N        PE + K   + +   P VT+ +    +    +E   +T  C A+  P+   ++W       +  +   Y ++   T   A V C  +N     ++   +NV +GP+   +  P+   +IGDD +  C    NP    +W ++   +++ +G  L    +   D G Y+C A V       K++ L  R  P+I     +  +LG   + +C+I+S P    ++I+W +  + L + +  ++S+ TE     +IS+L I+  + SDF  ++NCS     G  S ++ L + + +PL L++
Sbjct:   17 GFGAHFSQQPSDKVIVAGKSVTLPCVVIGYRGV-VQWTMDGLALGAER-DLPGWS------RYSVVGDPSLGEHNLHIEGVELSDDAIYECQAT--QAALRSQRARLTVLLPPGDPMI---------------PGSPVANVLLNVPYNLTCLAPVAKPAAEITWYRDGKKLDSAV--------------YTKELLSDGKSEGSASSLLITPSLADSGSSYTCRVRNEAL-----PEGREKSVTLSVQYPPKVTLSVEPPTI----TEGGSVTFLCGAVSNPEVTGYRW-AKGGVPLAVSGDKYTVEVDHTFFTAPVSCEVSNSVGASNVSTAVNVLFGPRLLTEPRPMT-VDIGDDASFFCGWTGNPTPTQFWSKKGTGEVLSNGNTLLLTKVTREDAGIYVCKAIVPRMGSTEKEVTLTVRGPPIITSEMHYETTLGGKARMECLIESTPAP--DRIVWAWDKQSLEDGSWGRFSVETEVTEVGAISVLVIDGAEQSDFLTEFNCSAINQYGEDSVIVSLRQQAALPLTLLL 497          
BLAST of NEPH-2 vs. Ensembl Xenopus
Match: eif4e (eukaryotic translation initiation factor 4E [Source:Xenbase;Acc:XB-GENE-855435])

HSP 1 Score: 159.073 bits (401), Expect = 3.503e-40
Identity = 128/533 (24.02%), Postives = 230/533 (43.15%), Query Frame = 3
Query:  432 GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIV-VDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAK---IEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLR-MLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDN-TKYSISTEKYVDHSISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTSPIPLILIV 2009
            G   + +  P ++ +    +VT+ C V   + + V W   G  LG  R D+  +       RY +  D S G ++L I  V L D+  + CQ      A+ SQRA+L VL+  G P I                 SP+  V       L C A   +P A +TW  D + ++  +               +K+++++ K   S S+L    +   +G S  C   N        PE + K   + +   P VT+ +    +    +E   +T  C A+  P+   ++W       +  +   Y ++   T   A V C  +N     ++   +NV +GP+   +  P+   +IGDD +  C    NP    +W ++   +++ +G  L    +   D G Y+C A V       K++ L  R  P+I     +  +LG   + +C+I+S P    ++I+W +  + L + +  ++S+ TE     +IS+L I+  + SDF  ++NCS     G  S ++ L + + +PL L++
Sbjct:   21 GFGAHFSQQPSDKVIVAGKSVTLPCVVIGYRGV-VQWTMDGLALGAER-DLPGWS------RYSVVGDPSLGEHNLHIEGVELSDDAIYECQAT--QAALRSQRARLTVLLPPGDPMI---------------PGSPVANVLLNVPYNLTCLAPVAKPAAEITWYRDGKKLDSAV--------------YTKELLSDGKSEGSASSLLITPSLADSGSSYTCRVRNEAL-----PEGREKSVTLSVQYPPKVTLSVEPPTI----TEGGSVTFLCGAVSNPEVTGYRW-AKGGVPLAVSGDKYTVEVDHTFFTAPVSCEVSNSVGASNVSTAVNVLFGPRLLTEPRPMT-VDIGDDASFFCGWTGNPTPTQFWSKKGTGEVLSNGNTLLLTKVTREDAGIYVCKAIVPRMGSTEKEVTLTVRGPPIITSEMHYETTLGGKARMECLIESTPAP--DRIVWAWDKQSLEDGSWGRFSVETEVTEVGAISVLVIDGAEQSDFLTEFNCSAINQYGEDSVIVSLRQQAALPLTLLL 501          
BLAST of NEPH-2 vs. Ensembl Xenopus
Match: rps7 (ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-977326])

HSP 1 Score: 159.458 bits (402), Expect = 6.649e-40
Identity = 132/522 (25.29%), Postives = 223/522 (42.72%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P++Q V     V++ C + P  +  + W+K G  +G  R D+  +       RY +  D  +G + L I    L+D+  + CQ      AI S+ A+L VLV    P I        GP         I +  GD + L C A+  +P A +TWM + E++        NG          K ++ + K     STL    + + NG++I C ATN+        EA   I I   P V + +  Q +     E++ +   C+A   P    ++W      +      +Y+     +     V C   N     ++ R ++V +GP+   + P     ++G D T  C    NP   I W +  +  ++ +   L  KN+++ D G Y+C A V       + I L     P+I       A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+I+NI  +DF   YNC+     GS ++++ L +   +P+ +I+G
Sbjct:   11 QPQDQVVVAGQPVSLLCAI-PGYHGLLLWIKDGLAIGVGR-DLSGYP------RYSVGGDHLSGEHHLMIQRAELQDDAMYECQA--IQAAIRSRPARLTVLVPPDDPVITG------GPV--------ISIRAGDPLNLTCHADNAKPAATITWMKNGEVL--------NG------ATYYKTLLRDGKRESIISTLFVSSSDIENGQTITCRATNKAVPGGK--EATVTINIQHPPLVNLTVEPQPV----LEDNVVKFHCAAKANPAVTQYRWAKGGQILKEVTDETYETVVDFSFFTEPVSCEVTNALGSTNVSRTVDVYFGPRMSSE-PESITVDLGSDATFHCAWIGNPSLTIVWMKRGSGVVLSNENTLTLKNVRQEDAGKYVCRAVVPRVGAGERDISLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTP--PPDRIAWSWKENVLESGTSGRYTVETVSTDEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPVTVIIG 485          
BLAST of NEPH-2 vs. Ensembl Xenopus
Match: rps7 (ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-977326])

HSP 1 Score: 159.458 bits (402), Expect = 9.567e-40
Identity = 132/522 (25.29%), Postives = 223/522 (42.72%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P++Q V     V++ C + P  +  + W+K G  +G  R D+  +       RY +  D  +G + L I    L+D+  + CQ      AI S+ A+L VLV    P I        GP         I +  GD + L C A+  +P A +TWM + E++        NG          K ++ + K     STL    + + NG++I C ATN+        EA   I I   P V + +  Q +     E++ +   C+A   P    ++W      +      +Y+     +     V C   N     ++ R ++V +GP+   + P     ++G D T  C    NP   I W +  +  ++ +   L  KN+++ D G Y+C A V       + I L     P+I       A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+I+NI  +DF   YNC+     GS ++++ L +   +P+ +I+G
Sbjct:   24 QPQDQVVVAGQPVSLLCAI-PGYHGLLLWIKDGLAIGVGR-DLSGYP------RYSVGGDHLSGEHHLMIQRAELQDDAMYECQA--IQAAIRSRPARLTVLVPPDDPVITG------GPV--------ISIRAGDPLNLTCHADNAKPAATITWMKNGEVL--------NG------ATYYKTLLRDGKRESIISTLFVSSSDIENGQTITCRATNKAVPGGK--EATVTINIQHPPLVNLTVEPQPV----LEDNVVKFHCAAKANPAVTQYRWAKGGQILKEVTDETYETVVDFSFFTEPVSCEVTNALGSTNVSRTVDVYFGPRMSSE-PESITVDLGSDATFHCAWIGNPSLTIVWMKRGSGVVLSNENTLTLKNVRQEDAGKYVCRAVVPRVGAGERDISLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTP--PPDRIAWSWKENVLESGTSGRYTVETVSTDEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPVTVIIG 498          
BLAST of NEPH-2 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 162.155 bits (409), Expect = 2.643e-41
Identity = 135/522 (25.86%), Postives = 227/522 (43.49%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P++Q V     VT+ C + P  +  V W+K G  LG  R D+ S+       +Y +  +  +G + L+I    L+D+  + CQ      AI S+ A+L VLV    P I+       GP         I +  GD + L C A+  +P A + W+   E+I        NG         SK ++ + K     STL      + NG+SI C ATN+        E    I+I   P V + +  Q +     E++ +T  CSA   P    ++W    + +   +   Y+     T     V C   N     +L R ++V +GP+   +   L   ++G D   +C    NP   I W +  +  ++ +   L  K++++ D G Y+C A V       +++ L     P+I       A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+I+NI  +DF   YNC+     GS ++++ L +   +P+ +I+G
Sbjct:   20 QPQDQVVVSGQPVTLLCAI-PEYDGFVLWIKDGLALGVGR-DLSSYP------QYLVVGNHLSGEHHLKILRAELQDDAVYECQA--IQAAIRSRPARLTVLVPPDDPIILG------GPV--------ISLRAGDPLNLTCHADNAKPAASIIWLRKGEVI--------NG------ATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK--ETSVTIDIQHPPLVNLSVEPQPV----LEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLL-VDLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTP--PPDRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIG 494          
BLAST of NEPH-2 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 162.155 bits (409), Expect = 1.172e-40
Identity = 135/522 (25.86%), Postives = 227/522 (43.49%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P++Q V     VT+ C + P  +  V W+K G  LG  R D+ S+       +Y +  +  +G + L+I    L+D+  + CQ      AI S+ A+L VLV    P I+       GP         I +  GD + L C A+  +P A + W+   E+I        NG         SK ++ + K     STL      + NG+SI C ATN+        E    I+I   P V + +  Q +     E++ +T  CSA   P    ++W    + +   +   Y+     T     V C   N     +L R ++V +GP+   +   L   ++G D   +C    NP   I W +  +  ++ +   L  K++++ D G Y+C A V       +++ L     P+I       A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+I+NI  +DF   YNC+     GS ++++ L +   +P+ +I+G
Sbjct:   20 QPQDQVVVSGQPVTLLCAI-PEYDGFVLWIKDGLALGVGR-DLSSYP------QYLVVGNHLSGEHHLKILRAELQDDAVYECQA--IQAAIRSRPARLTVLVPPDDPIILG------GPV--------ISLRAGDPLNLTCHADNAKPAASIIWLRKGEVI--------NG------ATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK--ETSVTIDIQHPPLVNLSVEPQPV----LEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLL-VDLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTP--PPDRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIG 494          
BLAST of NEPH-2 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 162.155 bits (409), Expect = 1.172e-40
Identity = 135/522 (25.86%), Postives = 227/522 (43.49%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P++Q V     VT+ C + P  +  V W+K G  LG  R D+ S+       +Y +  +  +G + L+I    L+D+  + CQ      AI S+ A+L VLV    P I+       GP         I +  GD + L C A+  +P A + W+   E+I        NG         SK ++ + K     STL      + NG+SI C ATN+        E    I+I   P V + +  Q +     E++ +T  CSA   P    ++W    + +   +   Y+     T     V C   N     +L R ++V +GP+   +   L   ++G D   +C    NP   I W +  +  ++ +   L  K++++ D G Y+C A V       +++ L     P+I       A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+I+NI  +DF   YNC+     GS ++++ L +   +P+ +I+G
Sbjct:   20 QPQDQVVVSGQPVTLLCAI-PEYDGFVLWIKDGLALGVGR-DLSSYP------QYLVVGNHLSGEHHLKILRAELQDDAVYECQA--IQAAIRSRPARLTVLVPPDDPIILG------GPV--------ISLRAGDPLNLTCHADNAKPAASIIWLRKGEVI--------NG------ATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK--ETSVTIDIQHPPLVNLSVEPQPV----LEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLL-VDLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTP--PPDRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIG 494          
BLAST of NEPH-2 vs. Ensembl Mouse
Match: Kirrel3 (kirre like nephrin family adhesion molecule 3 [Source:MGI Symbol;Acc:MGI:1914953])

HSP 1 Score: 162.54 bits (410), Expect = 1.230e-40
Identity = 135/522 (25.86%), Postives = 227/522 (43.49%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P++Q V     VT+ C + P  +  V W+K G  LG  R D+ S+       +Y +  +  +G + L+I    L+D+  + CQ      AI S+ A+L VLV    P I+       GP         I +  GD + L C A+  +P A + W+   E+I        NG         SK ++ + K     STL      + NG+SI C ATN+        E    I+I   P V + +  Q +     E++ +T  CSA   P    ++W    + +   +   Y+     T     V C   N     +L R ++V +GP+   +   L   ++G D   +C    NP   I W +  +  ++ +   L  K++++ D G Y+C A V       +++ L     P+I       A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+I+NI  +DF   YNC+     GS ++++ L +   +P+ +I+G
Sbjct:   53 QPQDQVVVSGQPVTLLCAI-PEYDGFVLWIKDGLALGVGR-DLSSYP------QYLVVGNHLSGEHHLKILRAELQDDAVYECQA--IQAAIRSRPARLTVLVPPDDPIILG------GPV--------ISLRAGDPLNLTCHADNAKPAASIIWLRKGEVI--------NG------ATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK--ETSVTIDIQHPPLVNLSVEPQPV----LEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEASGELYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTSEPQSLL-VDLGSDAVFSCAWIGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTP--PPDRIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQESVPMAVIIG 527          
BLAST of NEPH-2 vs. Ensembl Mouse
Match: Kirrel (kirre like nephrin family adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:1891396])

HSP 1 Score: 156.377 bits (394), Expect = 1.365e-38
Identity = 128/536 (23.88%), Postives = 225/536 (41.98%), Query Frame = 3
Query:  432 GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVV-DNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRML-NVKYGPQFKDDSPPLYP----ANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRL-INDNTKYSISTEKYVDHSISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGG 2015
            G +   +  P +Q V       + C +     + V W K G  LG  +  ++++       RY +     AG Y+L+ITD  L D+  + CQ      A+ S+RA+L VL+                PE+ R +  P+++   G    L C+A   +P A + W  D    E            G +T  S +++ + K   + S L  +   L  G+   C + N      N  E   ++++H  PTVT+ I  Q +     E + +  +C A   P+   ++W      + + + S Y+     +     V C   N     ++  L NV + P+       +YP     +IG DVTLTC    NP   + W ++ +N ++ +   L  K++ + D GTY C A V    +  +++ L     P+I       A  G   + +C I S P    ++I W ++   L +    +Y++         +S L+INN+  +DF   YNC+     G  + ++ L +   +P+ +I G 
Sbjct:   50 GTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGI-VQWTKDGLALGMGQG-LKAWP------RYRVVGSADAGQYNLEITDAELSDDASYECQAT--EAALRSRRAKLTVLIP---------------PEETRIDGGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQE------------GAVT--STELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEAIP--NGKETSIELDVHHPPTVTLSIEPQTV----LEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNVSTLVNVHFAPRIV-----VYPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDGGKVECFIGSTP--PPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGA 533          
BLAST of NEPH-2 vs. UniProt/SwissProt
Match: sp|Q08180|ICCR_DROME (Irregular chiasm C-roughest protein OS=Drosophila melanogaster OX=7227 GN=rst PE=1 SV=2)

HSP 1 Score: 168.318 bits (425), Expect = 1.284e-41
Identity = 140/551 (25.41%), Postives = 239/551 (43.38%), Query Frame = 3
Query:  453 VHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETR--SDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIK---NNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLR--DSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQ-------------------NLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIK-ATRTMNKAVVKC-IANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTK-YSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGS-ASKVMVLSKTSPIPLILIVGG 2015
            + P++Q   + + VT+ CRV   K   + W K  FGLG +R  S    + MVG+            G+Y L I  V L+D+  + CQ++       AI S  A L VLV    PKI Q G+     E  + E             + C +  G+P A +TW+              +G+ +    NI   ++     R   + S L+    +  +  +  C A N     +    AK ++E+  AP V ++++                     + G+   E+  + + C A   P    ++W+IND  ++   ++   I+  TR  + A+VKC + N+  +  D   L++ Y P F+   P    A++G  V+LTC  DSNP   I W +  ++ ++G  T L   ++     G Y C A V  +   S    +  +  P I         +G + + +C   S+P A H  + W + G+ + +++   YSI  +       S L I + QA  +G+YNC+V  D G+  +++ + +K S   L+ IVGG
Sbjct:   32 MEPQDQTAVVGARVTLPCRVIN-KQGTLQWTKDDFGLGTSRDLSGFERYAMVGSD---------EEGDYSLDIYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQ-GDVIYATEDRKVE-------------IECVSVGGKPAAEITWI--------------DGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYR--SAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKFHDAIVKCEVQNSVGKSEDSETLDISYAPSFRQ-RPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNL-TFSVSNETAGRYYCKANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVPRARH--VSWTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGG 538          
BLAST of NEPH-2 vs. UniProt/SwissProt
Match: sp|Q96J84|KIRR1_HUMAN (Kin of IRRE-like protein 1 OS=Homo sapiens OX=9606 GN=KIRREL1 PE=1 SV=2)

HSP 1 Score: 156.377 bits (394), Expect = 6.950e-38
Identity = 126/532 (23.68%), Postives = 222/532 (41.73%), Query Frame = 3
Query:  432 GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVV-DNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRML-NVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRL-INDNTKYSISTEKYVDHSISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGG 2015
            G +   +  P +Q V       + C +     + V W K G  LG  +  ++++       RY +     AG Y+L+ITD  L D+  + CQ      A+ S+RA+L VL+                PE  R +  P+++   G    L C+A   +P A + W  D    E        G ++ T      +++ + K   + S L      L  G+   C + N         E   ++++H  PTVT+ I  Q +     E + +  +C A   P+   ++W      + + + S Y+     +     V C  +N     ++  L NV + P+   D  P    +IG DVTLTC    NP   + W ++ +N ++ +   L  K++ + D GTY C A V    +  +++ L     P+I       A  G   + +C I S P    ++I W ++   L +    +Y++         +S L+INN+  +DF   YNC+     G  + ++ L +   +P+ +I G 
Sbjct:   18 GTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGI-VQWTKDGLALGMGQG-LKAWP------RYRVVGSADAGQYNLEITDAELSDDASYECQAT--EAALRSRRAKLTVLIP---------------PEDTRIDGGPVILLQAGTPHNLTCRAFNAKPAATIIWFRDGTQQE--------GAVAST------ELLKDGKRETTVSQLLINPTDLDIGRVFTCRSMNEAIPSGK--ETSIELDVHHPPTVTLSIEPQTV----QEGERVVFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPT-TTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQYAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGA 501          
BLAST of NEPH-2 vs. UniProt/SwissProt
Match: sp|Q80W68|KIRR1_MOUSE (Kin of IRRE-like protein 1 OS=Mus musculus OX=10090 GN=Kirrel1 PE=1 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 9.548e-38
Identity = 128/536 (23.88%), Postives = 225/536 (41.98%), Query Frame = 3
Query:  432 GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVV-DNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRML-NVKYGPQFKDDSPPLYP----ANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRL-INDNTKYSISTEKYVDHSISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGG 2015
            G +   +  P +Q V       + C +     + V W K G  LG  +  ++++       RY +     AG Y+L+ITD  L D+  + CQ      A+ S+RA+L VL+                PE+ R +  P+++   G    L C+A   +P A + W  D    E            G +T  S +++ + K   + S L  +   L  G+   C + N      N  E   ++++H  PTVT+ I  Q +     E + +  +C A   P+   ++W      + + + S Y+     +     V C   N     ++  L NV + P+       +YP     +IG DVTLTC    NP   + W ++ +N ++ +   L  K++ + D GTY C A V    +  +++ L     P+I       A  G   + +C I S P    ++I W ++   L +    +Y++         +S L+INN+  +DF   YNC+     G  + ++ L +   +P+ +I G 
Sbjct:   50 GTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGI-VQWTKDGLALGMGQG-LKAWP------RYRVVGSADAGQYNLEITDAELSDDASYECQAT--EAALRSRRAKLTVLIP---------------PEETRIDGGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQE------------GAVT--STELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEAIP--NGKETSIELDVHHPPTVTLSIEPQTV----LEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNVSTLVNVHFAPRIV-----VYPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDGGKVECFIGSTP--PPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGA 533          
BLAST of NEPH-2 vs. UniProt/SwissProt
Match: sp|Q6X936|KIRR1_RAT (Kin of IRRE-like protein 1 OS=Rattus norvegicus OX=10116 GN=Kirrel1 PE=1 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 1.290e-37
Identity = 128/536 (23.88%), Postives = 224/536 (41.79%), Query Frame = 3
Query:  432 GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVV-DNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRML-NVKYGPQFKDDSPPLYP----ANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRL-INDNTKYSISTEKYVDHSISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGG 2015
            G +   +  P +Q V       + C +     + V W K G  LG  +  ++++       RY +     AG Y+L+ITD  L D+  + CQ      A+ S+RA+L VL+                PE  R +  P+++   G    L C+A   +P A + W  D    E            G +T  S +++ + K   + S L  +   L  G+   C + N      N  E   ++++H  PTVT+ I  Q +     E + +  +C A   P+   ++W      + + + S Y+     +     V C   N     ++  L NV + P+       +YP     +IG DVTLTC    NP   + W ++ +N ++ +   L  K++ + D GTY C A V    +  +++ L     P+I       A  G   + +C I S P    ++I W ++   L +    +Y++         +S L+INN+  +DF   YNC+     G  + ++ L +   +P+ +I G 
Sbjct:   50 GTQTRFSQEPADQTVVAGHRAVLPCVLLNYSGI-VQWTKDGLALGMGQG-LKAWP------RYRVVGSADAGQYNLEITDAELSDDASYECQAT--EAALRSRRAKLTVLIP---------------PEDTRIDGGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQE------------GAVT--STELLKDGKRETTISQLLIQPTDLDIGRVFTCRSMNEAIP--NGKETSIELDVHHPPTVTLSIEPQTV----LEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNVSTLVNVHFAPRIV-----VYPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDGGKVECFIGSTPPP--DRIAWAWKENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGA 533          
BLAST of NEPH-2 vs. UniProt/SwissProt
Match: sp|Q8IZU9|KIRR3_HUMAN (Kin of IRRE-like protein 3 OS=Homo sapiens OX=9606 GN=KIRREL3 PE=1 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.673e-37
Identity = 135/534 (25.28%), Postives = 226/534 (42.32%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLS------------KTSPIPLILIVG 2012
             P++Q V     VT+ C + P  +  V W+K G  LG  R D+ S+       +Y +  +  +G + L+I    L+D+  + CQ      AI S+ A+L VLV    P I+       GP         I +  GD + L C A+  +P A + W+   E+I        NG         SK ++ + K     STL      + NG+SI C ATN+        E    I+I   P V + +  Q +     E++ +T  CSA   P    ++W      +   +   Y+     T     V C   N     +L R ++V +GP+   +   L   ++G D   +C    NP   I W +  +  ++ +   L  K++++ D G Y+C A V       +++ L     P+I       A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+I+NI  +DF   YNC+     GS ++++ L             +   +P+ +I+G
Sbjct:   53 QPQDQVVVSGQPVTLLCAI-PEYDGFVLWIKDGLALGVGR-DLSSYP------QYLVVGNHLSGEHHLKILRAELQDDAVYECQA--IQAAIRSRPARLTVLVPPDDPVILG------GPV--------ISLRAGDPLNLTCHADNAKPAASIIWLRKGEVI--------NG------ATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGK--ETSVTIDIQHPPLVNLSVEPQPV----LEDNVVTFHCSAKANPAVTQYRWAKRGQIIKEASGEVYRTTVDYTYFSEPVSCEVTNALGSTNLSRTVDVYFGPRMTTEPQSLL-VDLGSDAIFSCAWTGNPSLTIVWMKRGSGVVLSNEKTLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVNGPPIISSTQTQHALHGEKGQIKCFIRSTP--PPDRIAWSWKENVLESGTSGRYTVETISTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRLKEQGSEMKSGAGLEAESVPMAVIIG 539          
BLAST of NEPH-2 vs. TrEMBL
Match: A0A0H3YFE9 (NEPH-2 OS=Schmidtea mediterranea OX=79327 GN=NEPH-2 PE=2 SV=1)

HSP 1 Score: 1707.58 bits (4421), Expect = 0.000e+0
Identity = 842/842 (100.00%), Postives = 842/842 (100.00%), Query Frame = 3
Query:  432 GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGXXXXXXXXXXXXXALCVCKRGICSNKYQKGSPTNRINSNNSTDPLKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDIDDVYKEEFYPSSNPAMMCSMHITPTGSGAINRASPCNAHPYSVPQHQISLPQYNFTSFANPPYLSNYLPGSNNNFALPSYPVHSPSSEPGINGGSGLMIPPVLPPIDTNDANHNVELGLSPQQTSFIKPGMTISQNMANYLSPNIRPKPNSYNYTLSGNSNDGNSFKSRTLDRRGPISSFTNVDQTTNI 2957
            GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGTVFITMVMMIVIIALCVCKRGICSNKYQKGSPTNRINSNNSTDPLKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDIDDVYKEEFYPSSNPAMMCSMHITPTGSGAINRASPCNAHPYSVPQHQISLPQYNFTSFANPPYLSNYLPGSNNNFALPSYPVHSPSSEPGINGGSGLMIPPVLPPIDTNDANHNVELGLSPQQTSFIKPGMTISQNMANYLSPNIRPKPNSYNYTLSGNSNDGNSFKSRTLDRRGPISSFTNVDQTTNI
Sbjct:   17 GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGTVFITMVMMIVIIALCVCKRGICSNKYQKGSPTNRINSNNSTDPLKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDIDDVYKEEFYPSSNPAMMCSMHITPTGSGAINRASPCNAHPYSVPQHQISLPQYNFTSFANPPYLSNYLPGSNNNFALPSYPVHSPSSEPGINGGSGLMIPPVLPPIDTNDANHNVELGLSPQQTSFIKPGMTISQNMANYLSPNIRPKPNSYNYTLSGNSNDGNSFKSRTLDRRGPISSFTNVDQTTNI 858          
BLAST of NEPH-2 vs. TrEMBL
Match: A0A4E0S4A9 (Irregular chiasm C-roughest protein OS=Fasciola hepatica OX=6192 GN=D915_000115 PE=4 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 3.634e-145
Identity = 248/652 (38.04%), Postives = 382/652 (58.59%), Query Frame = 3
Query:  447 INVHPENQRVTLNSTVTIQCRVQPI------KNMKVYWVKSGFGLGETRSDIRSFGMVG--NKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNE--IIEPDLSGNFNGIISGTITNISKKIVNNTK---LRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGXXXXXXXXXXXXXALCVCKRGICSNKYQKG--SPTNRINSNNSTDP-----------LKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMC 2324
            I +HPE+Q VTLNSTV +QCRV+ +         +VYW K+ FG+G  R DI+ +G        RYD+P +L  G YDLQI +V L DEG + CQ+N       SQ A L V V S  PK+IQI  +G GPE     ++P VV++G ++AL+C A  G+PGA LTW+ID    I+EP   G      SG + N++ ++  ++K   L D+ S + A++N+L +GK I+C A N G+E      A  K+E+H AP V++ I  Q   NE+ E+D IT+ C+A GRPD F W+W++N  +V N     Y+++ TR M+ AV +CIA + ++GH   ++ VK+GPQF++ S  L+ A+ G+DV ++C    NP   I W+RES ++++  G    + N++E DFGTY+CTA V+ F   SK++ +AKR  P I+ NP   A LGR  + +C ++S+P+    Q  W Y GR  I  +++++   E+++   + IL I ++  +D+G+YNC+V    G+  K++ L     IPL  I+G  V + +++++ II LCVC++ IC  KY+KG  +PT  I  + S  P            K P    D   + +++ W  NN    ++ +FVR G D+D++ S+ N S    +G D C
Sbjct:   45 IQLHPESQAVTLNSTVRLQCRVRILVDPTTGAGAQVYWSKNDFGIGGNRDDIQEYGRSARYKYSRYDLPYNLKDGQYDLQIINVELSDEGSYVCQVNFMKQQYLSQTAVLTVQVPSEAPKLIQITKEGKGPEVEVGASTPAVVEDGAILALKCVARHGKPGALLTWLIDGVPVIVEPGGDGQNGTFRSGFVGNLTVQVTPSSKFPRLMDATSQMSARLNKLHHGKLIECRAENVGYESHALRPAYTKLEVHYAPVVSIQIRPQRRNNEYMEHDVITVECTAHGRPDSFFWEWFVNGRQVENLVDPWYRLRLTRNMHNAVFRCIAISNRKGHAEMIVRVKFGPQFQEPSALLFTASPGEDVAMSCPARGNPEPRIDWRRESGHEVLHRGVTYRKDNLREEDFGTYVCTAYVQEFPPISKQMYIAKRRPPTIQPNPLVPARLGRPARLRCTVNSVPLPPMGQTHWFYNGRP-IRPDSQHTFEREEFIGGVVLILHIAHVMMTDYGKYNCTVQNGYGTDWKLIELVHQEDIPLQFIIGAAVAVGILLVVGIILLCVCRQRICGRKYKKGRPTPTQSIQGSKSNQPSLQDYGVVNTEFKVPPNGHDGTQRQSYYPWFTNN--AHLQGTFVRCGSDMDEQRSVHNSS---KQGQDKC 690          
BLAST of NEPH-2 vs. TrEMBL
Match: A0A4S2MJS2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000877 PE=4 SV=1)

HSP 1 Score: 439.499 bits (1129), Expect = 1.415e-135
Identity = 231/647 (35.70%), Postives = 375/647 (57.96%), Query Frame = 3
Query:  432 GNENYINVHPENQRVTLNSTVTIQCRVQPIKN------MKVYWVKSGFGLGETRSDIRSFGMVGNK--VRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLS-----GNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGXXXXXXXXXXXXXALCVCKRGICSNKYQKGSPTNRINSNNSTDPLKSP---------QFEMDYQCQPNFFQ-----WIPNNNREQVKSSFVRYGQDVDDRSSIRNG 2291
            G +  I +HP++Q VTLNSTV +QCRV+ + +       +VYW K+ FG+G +R DI+ +G        RYD+P +L  G YDLQIT+V L DEG + CQ+N   +   SQ A L V V S  PK+ Q+ N+G GPE      +P +VD+G ++ L+C A  G+PGA ++W ID   I+ +         F    +G +TN      +  +L+D+ S + A++N+L +GK ++C ATN G+++     A  K+E+H AP V++ +      NE+ E+D IT+ C+A GRPD F+W+W++N  +V N     Y+++ TR M+ AV +CIA + K+GH    + VK+GPQF + SP L+ A++G+D+ + C    NP   I W+RE  ++++  G    + ++++ DFGTYICTA V  F   SK++ ++KR  P I+ NP   A LGR+ + +C ++S+P    +Q  W + GR +  DN  ++   E+++   + IL I ++  +D+G+YNC+V    GS  K++ LS+   IPL  IVG  + + +++++ +I LC C++ IC  KY KG      NS+ S  P+++P         +F+     Q   ++     W PN    Q ++S++  G D D++ S+  G
Sbjct:   10 GVDGIIQIHPDSQAVTLNSTVRLQCRVRILTDPQTGAGAQVYWSKNDFGIGGSREDIQEYGRSSRYPYSRYDLPYNLKDGQYDLQITNVELSDEGSYVCQVNFMKHQYLSQTALLTVQVPSEAPKLYQVTNEGKGPEVEIGSATPAIVDDGAILVLKCVARHGKPGAIISWSIDGVPIQVETDPVKKVNVFRAGFTGNLTNSLTPSPSFPRLKDASSQMSARLNKLHHGKLVECRATNLGYDEQALRPAFTKLEVHYAPVVSIQVRPPRRDNEYMEHDIITVECAAHGRPDSFMWEWFVNGRQVENIADPWYRLRLTRDMHNAVFRCIAISNKKGHTETTVRVKFGPQFLEPSPLLFTASVGEDIAMECPARGNPTPRIDWRREGGHEVLHRGVTYRKDSLRDDDFGTYICTAYVSEFPPVSKQMYISKRRPPTIQPNPVVHAKLGRTARLRCTVNSVPQPPPDQTHWYFNGRPVRQDN-HHTFEREEFLGGVVLILQIAHVMRTDYGKYNCTVRNGYGSDWKLIELSQQEDIPLQFIVGSAIAVGILIVVGLIILCACRQRICGGKYTKGRQNQ--NSSTSMRPVQAPFSEYGVINSEFKAPLSSQNGSYRSSYSPWYPNAT-VQPQTSYIGCGSDTDEQRSLTKG 652          
BLAST of NEPH-2 vs. TrEMBL
Match: A0A4S2MJ83 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000877 PE=4 SV=1)

HSP 1 Score: 439.499 bits (1129), Expect = 3.432e-135
Identity = 231/647 (35.70%), Postives = 375/647 (57.96%), Query Frame = 3
Query:  432 GNENYINVHPENQRVTLNSTVTIQCRVQPIKN------MKVYWVKSGFGLGETRSDIRSFGMVGNK--VRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLS-----GNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGXXXXXXXXXXXXXALCVCKRGICSNKYQKGSPTNRINSNNSTDPLKSP---------QFEMDYQCQPNFFQ-----WIPNNNREQVKSSFVRYGQDVDDRSSIRNG 2291
            G +  I +HP++Q VTLNSTV +QCRV+ + +       +VYW K+ FG+G +R DI+ +G        RYD+P +L  G YDLQIT+V L DEG + CQ+N   +   SQ A L V V S  PK+ Q+ N+G GPE      +P +VD+G ++ L+C A  G+PGA ++W ID   I+ +         F    +G +TN      +  +L+D+ S + A++N+L +GK ++C ATN G+++     A  K+E+H AP V++ +      NE+ E+D IT+ C+A GRPD F+W+W++N  +V N     Y+++ TR M+ AV +CIA + K+GH    + VK+GPQF + SP L+ A++G+D+ + C    NP   I W+RE  ++++  G    + ++++ DFGTYICTA V  F   SK++ ++KR  P I+ NP   A LGR+ + +C ++S+P    +Q  W + GR +  DN  ++   E+++   + IL I ++  +D+G+YNC+V    GS  K++ LS+   IPL  IVG  + + +++++ +I LC C++ IC  KY KG      NS+ S  P+++P         +F+     Q   ++     W PN    Q ++S++  G D D++ S+  G
Sbjct:   39 GVDGIIQIHPDSQAVTLNSTVRLQCRVRILTDPQTGAGAQVYWSKNDFGIGGSREDIQEYGRSSRYPYSRYDLPYNLKDGQYDLQITNVELSDEGSYVCQVNFMKHQYLSQTALLTVQVPSEAPKLYQVTNEGKGPEVEIGSATPAIVDDGAILVLKCVARHGKPGAIISWSIDGVPIQVETDPVKKVNVFRAGFTGNLTNSLTPSPSFPRLKDASSQMSARLNKLHHGKLVECRATNLGYDEQALRPAFTKLEVHYAPVVSIQVRPPRRDNEYMEHDIITVECAAHGRPDSFMWEWFVNGRQVENIADPWYRLRLTRDMHNAVFRCIAISNKKGHTETTVRVKFGPQFLEPSPLLFTASVGEDIAMECPARGNPTPRIDWRREGGHEVLHRGVTYRKDSLRDDDFGTYICTAYVSEFPPVSKQMYISKRRPPTIQPNPVVHAKLGRTARLRCTVNSVPQPPPDQTHWYFNGRPVRQDN-HHTFEREEFLGGVVLILQIAHVMRTDYGKYNCTVRNGYGSDWKLIELSQQEDIPLQFIVGSAIAVGILIVVGLIILCACRQRICGGKYTKGRQNQ--NSSTSMRPVQAPFSEYGVINSEFKAPLSSQNGSYRSSYSPWYPNAT-VQPQTSYIGCGSDTDEQRSLTKG 681          
BLAST of NEPH-2 vs. TrEMBL
Match: A0A0H3YJJ7 (NEPH-3 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=NEPH-3 PE=2 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 8.199e-135
Identity = 274/811 (33.79%), Postives = 435/811 (53.64%), Query Frame = 3
Query:  438 ENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVG-NKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFN-GIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKD-DSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGXXXXXXXXXXXXXALCVCKRGICSNKYQKGSPTN-RINSNNSTDPLKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDIDDVYKEEFYPSSNPAMMCSMHITPTGSGAINRAS----------PCNAHPYSVPQHQISLPQYNFTSFANPPYLSNYLPGSNNNFALPSYPVHSPSSEPGINGGSGLMIPPVLPPIDTNDANHNVELGLSPQQTSFIKPGMTISQNMANYLSPNIR 2828
            ++YI VHPE Q   LNST+T++CRV+ ++  +V+WVK GFGLG +R+DIR +G    ++ R+D+P +L+ G YDL+ITD+ L DEG FYCQ+ +   A +SQ+  + VLV S  P+++QI    +GP+ +RNE +PI+V++G+ + ++C A+ GRPGA L W ++   IE   +G  N   ++G IT  S+   N  KL D  ++L+ K+  L NG  +KC A N G+         A+I ++  P V +++  +   N F END +  +CSA GRP  F W W I D  ++N     YK+K TR  +   + C A +   G +   + VKYGP FKD DS  +Y A+IG+++ + C  D NP   I WQR S+N++I  G+IL R +IQ  DFG YIC A V+ F  + K I L ++  P I+         G+S +  C I SIP  N N+I W+++ ++L+ + T++ +  +      IS+L I ++Q  DFG YNCSV+T  GS    ++L + S  P+++IVG T+    +++++I+ LC+C+R    ++Y KG+P++  I  ++     KS   + D QC PN + WIP       +S  V+   DV  +   ++G+       ++ S Y++S+P SQ+  K ++      + K E   ++NP ++ +MH    G+  +NR S          P    P      Q +  QY + +  NP    N       + A P Y V  P+++                        H ++      QT F  PG  I +N  N  S N+ 
Sbjct:   37 DDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINK--IGPQAIRNEKNPIIVNDGEYLHIKCIAKNGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLL-EGTRHKMYRQINEKIVISVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMKGNPSSPEIPLHHEA---KSTLIDSDCQCNPNLYSWIP-------QSFDVKSQNDVLSKIHYQDGNFWP-NSQEIESCYSNSVPDSQSSNKSVK------ITKHE-NANTNP-ILYNMHT--IGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCT--QYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANK-----------------------KHQIQF-----QTDFYSPGKPIIKNKLNSGSANME 793          
BLAST of NEPH-2 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 165.236 bits (417), Expect = 9.531e-42
Identity = 133/523 (25.43%), Postives = 228/523 (43.59%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIV-VDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P++  V     VT+ C + P  +  V W+K G  LG  R D+  +       RY +  D S+G + L+I  V L D+  F CQ      A+ S+ A+L VLV    P I               +  PIV +  GD + L C A+  +P A + W+ + E++        NG +       SK ++ + +   + STL    + +  G+ I C A+N+     N  E    I+I   P V + +  Q +     E + +   CSA   P    +KW      +   +  +Y++    +     V C   N     ++ R ++V +GP+   + P     ++G D    C    NP   I W +  +  ++ +  IL  K +++ D G Y+C A V       K++ L     P I     H+A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    D  +S L+++NI  +DF   YNC+     GS ++++ L +   +P+ +I+G
Sbjct:    5 QPQDLVVVAGQPVTLPCSI-PGYHGVVLWIKDGLALGVGR-DLSGYP------RYTVVGDHSSGEHHLRIQRVELMDDAVFECQA--IQAAMRSRPARLTVLVPPEDPVI---------------DGGPIVSLRAGDPLNLTCHADNAKPAASIIWIRNGEVL--------NGAM------YSKTLLRDGRRESTVSTLYISPSNIETGQKIICRASNKAIP--NGKETSVTIDIQHLPLVNLSVEPQPV----LEGNLVKFHCSAKANPPVTQYKWAKGGTVIKEVSGDTYEVIVDHSFFTEAVSCEVTNPLGSTNISRNVDVYFGPRMAAE-PQSLQVDLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENILTLKAVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTHQAPHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 479          
BLAST of NEPH-2 vs. Ensembl Cavefish
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:HGNC Symbol;Acc:HGNC:23204])

HSP 1 Score: 165.236 bits (417), Expect = 1.245e-41
Identity = 133/523 (25.43%), Postives = 228/523 (43.59%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIV-VDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P++  V     VT+ C + P  +  V W+K G  LG  R D+  +       RY +  D S+G + L+I  V L D+  F CQ      A+ S+ A+L VLV    P I               +  PIV +  GD + L C A+  +P A + W+ + E++        NG +       SK ++ + +   + STL    + +  G+ I C A+N+     N  E    I+I   P V + +  Q +     E + +   CSA   P    +KW      +   +  +Y++    +     V C   N     ++ R ++V +GP+   + P     ++G D    C    NP   I W +  +  ++ +  IL  K +++ D G Y+C A V       K++ L     P I     H+A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    D  +S L+++NI  +DF   YNC+     GS ++++ L +   +P+ +I+G
Sbjct:    5 QPQDLVVVAGQPVTLPCSI-PGYHGVVLWIKDGLALGVGR-DLSGYP------RYTVVGDHSSGEHHLRIQRVELMDDAVFECQA--IQAAMRSRPARLTVLVPPEDPVI---------------DGGPIVSLRAGDPLNLTCHADNAKPAASIIWIRNGEVL--------NGAM------YSKTLLRDGRRESTVSTLYISPSNIETGQKIICRASNKAIP--NGKETSVTIDIQHLPLVNLSVEPQPV----LEGNLVKFHCSAKANPPVTQYKWAKGGTVIKEVSGDTYEVIVDHSFFTEAVSCEVTNPLGSTNISRNVDVYFGPRMAAE-PQSLQVDLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENILTLKAVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTHQAPHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEDGVLSTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 479          
BLAST of NEPH-2 vs. Ensembl Cavefish
Match: kirrel3a (kirre like nephrin family adhesion molecule 3a [Source:ZFIN;Acc:ZDB-GENE-091117-44])

HSP 1 Score: 157.532 bits (397), Expect = 3.234e-39
Identity = 134/523 (25.62%), Postives = 222/523 (42.45%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIV-VDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P +  V     VT+ C +     M V W   G  LG  R D+  +       RYD+  D S G Y L I    L D+G F CQ       I S+ A+L VLV    P II                +PIV +  GD + L C A+  +P A + W+ + E++        NG +       SK ++ + +   + STL    + + +G+ I C A+N+     N  EA   I+I   P V + +  Q +     E + +   CSA   P    ++W      + +    SY+     +     V C   N     ++ R ++V +GP+   + P     ++G D    C    NP   I W +  +  ++ +   L  K +++ D G Y+C A V    +  K++ L     P I      +A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+++NI  +DF   YNC+     GS ++++ L +   + L +I+G
Sbjct:   34 QPHDVVVVAGQPVTLPCSITGFHGM-VLW--DGLALGVNR-DLSGYP------RYDVIGDHSKGEYHLLIQRTELGDDGSFECQG--IQAGIRSRPARLTVLVPPDDPVII---------------GAPIVSLRAGDPLNLTCHADNAKPAASIIWIRNGEVL--------NGAM------YSKTLLRDGQRESTVSTLYISASNIESGQRITCRASNKAAP--NGKEATVTIDIQHLPLVNLSVEPQPI----LEGNLVKFHCSAKANPPVTHYRWAKGGAVIRDVLGDSYEAVVDHSFFTEPVSCEVTNALGSTNISRNVDVYFGPRLAAE-PQSLQVDLGSDAVFNCAWTGNPSLTIVWMKRGHGVVLSNENTLTLKAVKQEDAGKYVCRAVVPRVGVGEKEVTLTVNGPPTISSTQTQQALYGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVSTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQGSLRLAVIIG 506          
BLAST of NEPH-2 vs. Ensembl Cavefish
Match: kirrel1a (kirre like nephrin family adhesion molecule 1 [Source:NCBI gene;Acc:103031116])

HSP 1 Score: 149.058 bits (375), Expect = 2.360e-36
Identity = 131/532 (24.62%), Postives = 220/532 (41.35%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSP-IVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRML-NVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHS---------ISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGG 2015
             P +Q V L   V + C V     + V W K G  LG    D+R++       RY +   +  G Y+L+I+   L D+  + CQ      A+ S+RA+L VL+    P I               E SP I++  G    L C +   +P A + W  D   IE    G F+          + +++ + K   + S L         GK+  C ATN              + +H  P V + I  +++     E + +T +C A   P    +KW      +     S +  KA  +     V C   N     ++ +L +V +GP    +  P+   +   DVTL C    NP   + W ++ ++ ++ +   LY K++ + D G Y+C A V    +   ++ L     P+I   P   A  G   + KC I S P    ++I+W ++    + +  K ++     V+ S         +S L+INN+  SDF   YNC+     G  + ++ L +T  +P+ +I GG
Sbjct:    7 EPADQSVVLGQRVVLSCVVFNYSGI-VQWTKDGLALG-IGEDLRAW------PRYRVLRMVDIGQYNLEISSAELSDDSLYECQAT--EAALRSRRAKLTVLIPPDEPVI---------------EGSPEILLTAGVPHNLSCVSRGAKPPAAIEWQKDGLPIE----GAFS----------TTEVLPDRKRVTTRSFLPVLPVDTDTGKNFTCMATNPAVPMGK--RTTITLNVHHPPVVVLSIEPRSV----LEGERVTFTCQATANPPIMGYKWAKGGVVIQGARESVFITKADHSFFTEPVSCQVFNAVGSTNVSILVDVHFGPILVVEPKPVT-VDSDSDVTLNCKWAGNPPLTLTWTKKGSSMVLSNNNQLYLKSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSEPVQYAVRGERGEVKCYIASTPPP--DKIVWAWKEN--VWEKEKGTLPERYTVEQSKPSSDGGAVLSTLTINNVMESDFQSTYNCTAWNGFGPGTMIITLEETEVVPVGIIAGG 488          
BLAST of NEPH-2 vs. Ensembl Cavefish
Match: kirrel1b (kirre like nephrin family adhesion molecule 1b [Source:ZFIN;Acc:ZDB-GENE-070912-173])

HSP 1 Score: 133.65 bits (335), Expect = 1.441e-31
Identity = 125/524 (23.85%), Postives = 217/524 (41.41%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSP-IVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRML-NVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLY--------RGRRLINDNTKYSISTEKYVDHS---ISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTS 1985
             P +Q V L   V + C V     + V W K G  LG    D+R++       RY +   +  G Y+L+I+   L D+  + CQ      A+ S+RA+L VL+    P I               E +P I++  G    L C +   +P + + W  D  I++                + S +++ + K   + S L  +      G +  C A+N          A   + +H APTV + I  +++     E + +T +C A   P    ++W      +     S +   A  +     V C   N     ++ +L +V +GP    +  P+   ++  DVTL C    NP   + W ++ ++ ++ +   LY K++ + D G Y+C A V    +   ++ L     P+I   P   A  G   + KC I S P    ++I+W +        RG  L     +Y++   K V      +S L+INN+  SDF   YNC+     G  + ++ L++T+
Sbjct:   28 EPADQSVVLGERVVLSCVVFNYTGI-VQWTKDGLALG-IGEDLRAWP------RYRVLRIVDVGQYNLEISSSELSDDSLYECQAT--EAALRSRRAKLTVLIPPDDPVI---------------EGAPEILLMAGVPYNLTCVSRGAKPLSTIEWYKDGVIVDG--------------AHTSTEVLADRKRVTTRSFLPIQPVDTDTGHNFSCVASNLAVPLGK--RATITLNVHHAPTVLLSISPRSV----LEGERVTFTCQATANPPVMGYRWAKGGVILEGARESVFVTTADHSFFTEPVSCQVFNAVGSTNVSILVDVHFGPILVVEPRPVT-VDVDSDVTLNCKWAGNPPLTLTWTKKGSSMVLSNNNQLYLKSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSEPVQYAVRGEKGEIKCYIASTPPP--DKIVWAWKENVWEKERGTLL----ERYTVEQSKPVSQGGAVLSTLTINNVMESDFQSTYNCTAWNSFGPGTMIITLAETA 499          
BLAST of NEPH-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010550.1 (pep scaffold:Pmarinus_7.0:GL479154:26986:35474:-1 gene:ENSPMAG00000009556.1 transcript:ENSPMAT00000010550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.1149 bits (209), Expect = 4.856e-18
Identity = 51/184 (27.72%), Postives = 87/184 (47.28%), Query Frame = 3
Query: 1428 GPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRL-INDNTKYSISTEKYVDHSISILSINNIQASDF-GQYNCSVTTDLGSASKVMVL 1973
            GP+   +  P    + G D T TC    NP   + W R+ +N ++ +  +L  K + + D G Y+C A V    +  K+++L     P+I  +    A  G   + +C I S P A+H  + W ++   L +    +Y++ T   VD  +S L+I N+   DF   YNC+     GS +++  L
Sbjct:    1 GPRIVTEPQP-QTVDRGSDATFTCAWSGNPPLTLAWTRKGSNVVLSNSNMLLLKGVTQDDTGRYVCKAIVPRIGVGEKEVMLNVNGPPIISSDLLQHALRGEKGRVECFIGSTPPAHH--LAWAWKENVLEVGTYERYTVETVSRVDGVLSTLTITNVMEGDFQTAYNCTAWNGFGSDTEIFTL 181          
BLAST of NEPH-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010567.1 (pep scaffold:Pmarinus_7.0:GL479154:561817:685780:1 gene:ENSPMAG00000009565.1 transcript:ENSPMAT00000010567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 1.449e-12
Identity = 119/539 (22.08%), Postives = 193/539 (35.81%), Query Frame = 3
Query:  447 INVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGN-YDLQITD--VNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKI-VNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNR----SSYKIKATRT--MNKAVVKCIANN--GKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDII-----------------GHGTILYRKNIQELDFGTYICTAGVENFDLKSKKII-----LAKRIKPMIRENPDHRA-SLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSAS 1958
            I  HP +  V+     T+ C+ +      V W K G  +   R D RS  M+           L  G+ + L+I        DEG + C          S+ A L V                      R+  S + V   +   + C+  RG P             EP +S   NG+    +T+  +++ +   KL  S +T KA     +      C  TN   E+ + P   A  E        M++V   L +  +E       C   G P   + +W   D ++   +R      Y ++  R    ++    C+  N  GK      ++ V   PQF    P       G   T  C T  NP   ++WQRE + +++                 GH TI    ++Q  D G Y C A      + +K ++     LA    P+IR+ P ++  ++G      C    +P  +   + WL        D +K S+ + +    S   LSI ++Q  D G Y C   +  G  +
Sbjct:   32 IAEHPSDLIVSRGEPATLNCKAEGRPAPTVEWYKDGERVETDRDDPRSHRML-----------LPTGSLFFLRIVHGRRTKTDEGSYVCVARNYLGEAVSRNASLEVANIR---------------RNYRSSPSAVKVAAREPAVMECRPPRGHP-------------EPTVSWKRNGV---ALTDKDERVTIRGGKLMIS-NTQKADAGMYV------CVGTNMVGERDSEPAELAVFERPTFARKPMNLVM--LADSDAE-----FRCEVHGDPPPTV-RWRKEDGDLPKGSRFEIQDDYTLRVERVGGTDEGTYTCVGENRVGKAEASASLV-VHAPPQFVV-RPRDQIVAQGQSATFLCETTGNPPPAVFWQREGSQNLLFPNQPSQPSSRFSVSQTGHLTI---TDVQRSDSGYYTCQALSVAGSILAKALLEVGDALADSPPPIIRQGPANQTLAVGSVALLACQAMGMPTPS---VHWL-------KDGSKLSLGSARLGLQSGGTLSIKDVQLMDAGLYTCVAVSPSGETT 498          
BLAST of NEPH-2 vs. Ensembl Sea Lamprey
Match: pxdn (peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2])

HSP 1 Score: 63.5438 bits (153), Expect = 2.151e-10
Identity = 93/407 (22.85%), Postives = 157/407 (38.57%), Query Frame = 3
Query:  819 KLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAK-IEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVM-NDNRSSYKIKATRTMNKA------VVKCIANNGKEG-HDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNN-------DIIGHGTILYRKNIQELDFGTYICTA-GVENFDLKSKKIILAKRIKPMIRENP-DHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTS 1985
            ++ +E   + V  G+ + LRC+AE G P   + W+ ++  I        N +  GT+      ++ +T+  D                + +C A N   E    PE   +  ++   PT     V Q    E    + +T+ CSA G P   +  W  +D+E +  D R S        + +A         C A+N ++       + +K  PQF   +P       G  V L C     P+  I W +  +         ++  GT+   + +   D G + C A  V      + ++ +  R+ P+    P D     GR V+  C     P      +MW   G   I ++ K+ +S E Y       L I +   +D G+Y C     +G AS  M+LS T+
Sbjct:  184 RITSEPHDVDVTPGNTVYLRCRAE-GNPKPAIIWLHNSNEIAMAEDERRNLLQDGTL------MIRDTRHTDQ--------------GTYQCMARNVAGE-VKAPEVVLRYFDVPAPPT----FVIQPHDTEVLVGESVTLECSAGGHPAPRV-SWTRDDSEQLPADPRFSVTASGGLHVERAGPGDEGRYTCHASNNQDSIRASATILLKSAPQFI-LAPEDQVVTEGHTVDLHCEAQGRPLPVIAWTKAGSQLPSDRRLTVLSSGTLRIAR-VALHDQGQFECQAVNVVGVRRAATQLTVLPRVTPVFSVTPSDITTDSGRDVRIACSAQGEP---QPSLMWAKDGVH-ITESGKFHVSAEGY-------LEIRDAGPADQGRYECIARNSIGHASTSMLLSVTA 550          

HSP 2 Score: 62.003 bits (149), Expect = 7.538e-10
Identity = 61/279 (21.86%), Postives = 108/279 (38.71%), Query Frame = 3
Query: 1230 ITISCSALGRPDKFLWKWYINDNEVM--NDNR------SSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKDDSPPLY---PAN----IGDDVTLTCNTDSNPMANIYWQRESNNDI-------IGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLG---SASKVMVLSKTSPI 1991
            + + C A G P   +  W  N NE+    D R       +  I+ TR  ++   +C+A N         + ++Y   F   +PP +   P +    +G+ VTL C+   +P   + W R+ +  +       +     L+ +     D G Y C A      +++   IL K     I    D   + G +V   C     P+     I W   G +L +D     +S+          L I  +   D GQ+ C     +G   +A+++ VL + +P+
Sbjct:  200 VYLRCRAEGNPKPAII-WLHNSNEIAMAEDERRNLLQDGTLMIRDTRHTDQGTYQCMARNVAGEVKAPEVVLRY---FDVPAPPTFVIQPHDTEVLVGESVTLECSAGGHPAPRVSWTRDDSEQLPADPRFSVTASGGLHVERAGPGDEGRYTCHASNNQDSIRASATILLKSAPQFILAPEDQVVTEGHTVDLHCEAQGRPLP---VIAWTKAGSQLPSDRRLTVLSS--------GTLRIARVALHDQGQFECQAVNVVGVRRAATQLTVLPRVTPV 463          
BLAST of NEPH-2 vs. Ensembl Sea Lamprey
Match: cntn3b (contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645])

HSP 1 Score: 61.6178 bits (148), Expect = 7.686e-10
Identity = 69/286 (24.13%), Postives = 113/286 (39.51%), Query Frame = 3
Query: 1209 EFSENDWITISCSALGRPDKFLWKWYINDNEVMN-------DNRSSYKIKATRTMNKAVVKCIANNGK----EGHDLRMLNVKYGPQFKDDSPPLYPANI--GDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKN---------IQELDFGTYICTAGVENFDLKSKKIILAKRIKP--MIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRL--INDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSP 1988
            E    D ++ +C A G P  F ++W + D E +         +  +  I A    +  + +C A NG        +LR+L  +Y P F   SP    A++  G   TL C   ++P A I W+R     I+    +  R+           ++ D G Y C A  EN   ++   +     +P  M R   D  A++  SV   C   +     +    W   GR L    D  K+ I+++         L+I  ++ +D G+Y C+  T + S S    L    P
Sbjct:  221 ELDIGDRLSWACEARGHPAPF-YRW-LRDGEALRPGGPVELGDDGTLTISAVDLSHSGMYQCEARNGNGTIYSAAELRVL--EYAPHF-GSSPDPGTAHVVRGGAATLLCRPRASPHATISWERH-GAPILNSSRVFVRERDSSLLILNATEDADGGAYTCVA--ENARGRANLTVQLHVQEPTRMSRPPTDVTANVSDSVLLPCQASAAAAGMNIAYTWEALGRTLDPGRDAEKFWIASQ---SEDSGDLTIVKVRLADSGRYTCTARTPIDSVSASATLRVKGP 495          
BLAST of NEPH-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004946.1 (pep scaffold:Pmarinus_7.0:GL501092:7822:21335:1 gene:ENSPMAG00000004486.1 transcript:ENSPMAT00000004946.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.6102 bits (135), Expect = 1.909e-8
Identity = 74/338 (21.89%), Postives = 126/338 (37.28%), Query Frame = 3
Query:  657 LQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMID-NEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLG-------NEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKE-----GHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTA 1631
            L + +V+L D+ +F C + +      S +  ++V   S P  I+         +++  E +  V D        C A+ G P  ++ W  + N IIE  +    N  +   +T       NN  L    S L+ +  +   G  I C     G           +IE  +A  VT+ +     G       N   E D +T++C     P      +          N++++K+         V KC A              R +NV Y  + +    P    N GD++T+TC+  S+     +W ++        G IL R ++   D G+Y C A
Sbjct:   99 LVVKNVSLVDQREFICSITLAATEAKSTKVNVYVSSKSSP-GIVSKYRATYREQQISKEYN--VAD--------CVAKDGYPEPKIVWFKNSNPIIEVKIE---NAEVMPVVTK------NNQGLFTVTSVLRMRPQKTDKGSLINCCVMTGG--------GNTEIEAPLATMVTIHLSYPPEGVSLEVFPNFIKEGDTVTLTCVTDAFPPPTYAFFQGETLLAETGNKNTFKMPYINRRQGGVYKCEARYTSSPMQTTAKAERQINVHYIERLRIMGIPDGEVNKGDNITMTCSASSSGNITYHWNKDGERK--EDGRILTRLHVTSYDSGSYTCVA 406          
BLAST of NEPH-2 vs. Ensembl Nematostella
Match: EDO45383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT26])

HSP 1 Score: 58.151 bits (139), Expect = 1.008e-8
Identity = 46/166 (27.71%), Postives = 75/166 (45.18%), Query Frame = 3
Query:  459 PENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGET--RSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPD 950
            P+N+ VT  S VT+ C+++      V W+K    L  +  R  +   G  GN                L IT++   DE  + C+     NA   + ++  +L  + PPK ++I    +  E++RNE         D + L C+ E G+P A + W+ DN  +EPD
Sbjct:  319 PKNETVTEKSNVTLTCQLECKPKCSVTWLKDNTPLDTSPDRITVTHPGSYGNTTS------------SLTITNLVRTDEARYSCKAI---NAAGEKSSEQGLLTVNYPPKFLEI----LKAEEMRNET--------DNLTLTCKLE-GKPLATVLWLKDNTELEPD 456          
BLAST of NEPH-2 vs. Ensembl Nematostella
Match: EDO30451 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0R2])

HSP 1 Score: 56.225 bits (134), Expect = 1.418e-8
Identity = 62/261 (23.75%), Postives = 108/261 (41.38%), Query Frame = 3
Query: 1230 ITISCSALGRPDKFLWKWYINDNEVMNDNRS----SYKIKATRTMNKA---VVKCIANNGKEGHDLRMLNVK--YGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQA-KCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQ-ASDFGQYNCSVTTDLGSASKVMVLSK 1979
            +++ C A G P   +  WY   ++ +    S      +++ T T +       KC A+N   G   R++ V   Y P F  +SP        D + LTC +D  P   + W R+    ++   ++ Y  ++   + GTY CTA  E     +  + +    KP +  +  + +S  R V + +C    +P      I W   G + I       IS         S L +   Q A D+GQY C  +  LGS  +++ +++
Sbjct:    2 LSLQCKARGVPSPQI-TWYRPGDQPITAGVSPISGGSQLQVTTTQDAGDYGQYKCRASN-LLGSVERLIYVTQWYKPSFISNSPYQTVNETIDFLKLTCESDGYPAPTVTWSRD--GVVVSQTSVYYSNSVTRSEAGTYTCTATNE-MGSDTTTVQVTVNYKPEMASSTTNTSSWNRKVLSLQCKARGVP---SPHITWYKPGGQPITAGVS-PISGG-------SQLQVTTTQEAGDYGQYKCRASNLLGSVERLIYVTQ 246          
BLAST of NEPH-2 vs. Ensembl Nematostella
Match: EDO29616 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T347])

HSP 1 Score: 57.7658 bits (138), Expect = 1.503e-8
Identity = 69/302 (22.85%), Postives = 120/302 (39.74%), Query Frame = 3
Query: 1107 RGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPD-KFLWKWYINDNEVMNDNRS-SYKIKATRTMNKAVVKCIANN----GKEGHDLRMLNVKYGPQFKDDSPPLYPANI--GDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTA---GVENFDLKSKKIILAKRIKP-MIRENPDHRASLGRS-VQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGS-ASKVMV 1970
            R F     P A   + + VAP  T  + S     + +END +T +CSA GRP     W    + + V +   S +  +   +     + +C A N    G    D+ ++ V+Y P+      P+    +  G+ +TLTC    NP  ++ W +  +    G G +  +    +   G Y+CTA      N   ++    +  + KP +I   P    +     ++  C+ D  P      + W   G  +   +  YS                N++  S+ G Y C+ T ++GS A+ V V
Sbjct:   98 RTFSSPLSPSASWDLNVKVAPAFTSSLSSSL---DVAENDDVTNTCSASGRPAPNVTWVNKTSGSPVAHGTGSATLSLLKIQRHQAGLYQCQAINDVGRGAITQDVTII-VQYPPEIT----PIQNTTVRAGETITLTCAVAGNPTPSVSWSKAGSGHSTG-GNVFTKAGATKAVTGQYVCTAVNTVTGNTQTRTASTYVMVKYKPSIISSYPGQTVNETIDFLKLTCISDGYPAPT---VTWSRDGLVVSRTSVYYS----------------NSVTRSEAGTYTCTATNEMGSDATTVQV 371          
BLAST of NEPH-2 vs. Ensembl Nematostella
Match: EDO31942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF5])

HSP 1 Score: 55.8398 bits (133), Expect = 7.634e-8
Identity = 58/261 (22.22%), Postives = 103/261 (39.46%), Query Frame = 3
Query: 1209 EFSENDWITISCSALGRPD-KFLWKWYINDNEVMNDNRSS-YKIKATRTMNKAVVKCIANN----GKEGHDLRMLNVKYGPQFKDDSPPLYPANI--GDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTA---GVENFDLKSKKIILAKRIKPMIRENPDHRA--SLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGS 1952
            + +E+   +I+CSA GRP     W    + + V +   S+   +   +     V +C A N    G    D   +NV+Y P+      P+    +  G+ +TLTC    NP  ++ W +  +    G G +       + + G Y+CTA      N   K+    +  + KP I  N  ++       S++  C+ D  P      + W                S +  V    S+   +++  S+ G Y C+ T ++GS
Sbjct:   13 DVAEDKDFSITCSASGRPAPNVTWVNKTSGSPVAHGTGSAILSLLKIQRHQAGVYQCQATNDVKRGAITQDF-TINVQYPPEIT----PIQNTTVRAGETITLTCAVAGNPTPSVSWSKAGSGQSTG-GNVFNEAGATKAETGQYVCTAVNIVSGNTQTKTVSTYVIVKYKPSIIANSPYQTVNETTGSLKLSCISDGYPAP---MVTW----------------SRDGVVVSPTSVYYSDSVTRSEAGTYTCTATNEMGS 248          

HSP 2 Score: 55.0694 bits (131), Expect = 1.223e-7
Identity = 51/200 (25.50%), Postives = 86/200 (43.00%), Query Frame = 3
Query: 1419 VKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQA-KCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQAS-DFGQYNCSVTTDLGSASKVMVLSK-TSPIPLILIV 2009
            VKY P    +SP          + L+C +D  P   + W R+    ++   ++ Y  ++   + GTY CTA  E     +  + +    KP +  +  + +S  R V + +C    +P+    QI W   G + I         T      S   L +   Q S D+GQY C  +  LGS  +++ +++  SP P I+IV
Sbjct:  174 VKYKPSIIANSPYQTVNETTGSLKLSCISDGYPAPMVTWSRD--GVVVSPTSVYYSDSVTRSEAGTYTCTATNE-MGSDTNTVQVTVNYKPEMASSTTNTSSWNRKVLSLQCKARGVPLP---QITWYKPGGQPI---------TAGVSPISGGQLQVTTTQDSGDYGQYKCRASNLLGSVGRLIYVTQWFSPGPPIIIV 358          
BLAST of NEPH-2 vs. Ensembl Nematostella
Match: EDO27477 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T954])

HSP 1 Score: 51.6026 bits (122), Expect = 1.908e-7
Identity = 38/172 (22.09%), Postives = 72/172 (41.86%), Query Frame = 3
Query: 1188 VSQNLGNEFSENDWITISCSALGRPD-KFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNG--KEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNI-----QELDFGTYICTA----GVENFDLKSKKI 1667
            +S ++    +  D +T+ C A G P     W    ++   +  N S   +           +C A+NG  K      +L+V + P+ +      +  ++G  + LTC+ +  P+ ++ W R+ +   I    +  R  +     Q  DFG YIC A    G ++  L  K++
Sbjct:    6 ISPDVSVTINRTDSVTLQCHASGDPAPNITWS---HEGAPLEHNGSILTLYNVTRREAGSYECKADNGIRKPAKASAVLSVNFAPEIERQKKKHFETSLGKAINLTCDVEGGPLPSVTWSRKRSQFSIIFSPVRMRSVLEVIPKQSRDFGDYICMARNIMGWDSHTLTLKRV 174          

HSP 2 Score: 49.2914 bits (116), Expect = 1.350e-6
Identity = 43/172 (25.00%), Postives = 72/172 (41.86%), Query Frame = 3
Query: 1470 NIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMI-RENPDH-RASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSK 1979
            N  D VTL C+   +P  NI W  E    +  +G+IL   N+   + G+Y C A            +L+    P I R+   H   SLG+++   C ++  P+ +   + W  +        +++SI          S+L +   Q+ DFG Y C     +G  S  + L +
Sbjct:   15 NRTDSVTLQCHASGDPAPNITWSHE-GAPLEHNGSILTLYNVTRREAGSYECKADNGIRKPAKASAVLSVNFAPEIERQKKKHFETSLGKAINLTCDVEGGPLPS---VTWSRK-------RSQFSIIFSPV--RMRSVLEVIPKQSRDFGDYICMARNIMGWDSHTLTLKR 173          
BLAST of NEPH-2 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 164.466 bits (415), Expect = 2.052e-41
Identity = 133/522 (25.48%), Postives = 229/522 (43.87%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P++  V     VT+ C + P  +  V W+K G  LG  R D+  +       RY +  D  +G + L+I  V L D+  F CQ      A+ S+ A+L VLV    P I      G GP         + +  GD + L C A+  +P A + WM + E++        NG +       SK +V + +   + STL    + +  G+ I C A+N+     N  EA   I+I   P V + +  Q +     E   +   CSA   P   L++W    + +   +  +Y++    +     V C   N     ++ R ++V +GP+   + P     ++G D    C    NP   I W +  +  ++ +  +L  K++++ D G Y+C A V       K++ L     P I      +A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+++NI  +DF   YNC+     GS ++++ L +   +P+ +I+G
Sbjct:   51 QPQDLVVVAGQPVTLPCSI-PGYHGIVLWIKDGLALGVGR-DLSGYP------RYTVIGDHGSGEHHLRIQRVELMDDAVFECQA--VQAAMRSRPARLTVLVPPDDPVI------GGGP--------VVSLRAGDPLNLTCHADNAKPAASIIWMRNGEVL--------NGAM------YSKALVRDGRRESTVSTLYLSPSNIETGQQIICRASNKAVP--NGKEASVTIDIQHLPLVNLSVEPQAV----LEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTYEVIVDHSFFTEPVSCEVTNSLGSTNVSRNVDVYFGPRMAAE-PQSLQVDLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 525          
BLAST of NEPH-2 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 164.081 bits (414), Expect = 4.539e-41
Identity = 133/522 (25.48%), Postives = 229/522 (43.87%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P++  V     VT+ C + P  +  V W+K G  LG  R D+  +       RY +  D  +G + L+I  V L D+  F CQ      A+ S+ A+L VLV    P I      G GP         + +  GD + L C A+  +P A + WM + E++        NG +       SK +V + +   + STL    + +  G+ I C A+N+     N  EA   I+I   P V + +  Q +     E   +   CSA   P   L++W    + +   +  +Y++    +     V C   N     ++ R ++V +GP+   + P     ++G D    C    NP   I W +  +  ++ +  +L  K++++ D G Y+C A V       K++ L     P I      +A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+++NI  +DF   YNC+     GS ++++ L +   +P+ +I+G
Sbjct:   93 QPQDLVVVAGQPVTLPCSI-PGYHGIVLWIKDGLALGVGR-DLSGYP------RYTVIGDHGSGEHHLRIQRVELMDDAVFECQA--VQAAMRSRPARLTVLVPPDDPVI------GGGP--------VVSLRAGDPLNLTCHADNAKPAASIIWMRNGEVL--------NGAM------YSKALVRDGRRESTVSTLYLSPSNIETGQQIICRASNKAVP--NGKEASVTIDIQHLPLVNLSVEPQAV----LEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTYEVIVDHSFFTEPVSCEVTNSLGSTNVSRNVDVYFGPRMAAE-PQSLQVDLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 567          
BLAST of NEPH-2 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 162.925 bits (411), Expect = 6.677e-41
Identity = 131/522 (25.10%), Postives = 230/522 (44.06%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSKTSPIPLILIVG 2012
             P++  V     VT+ C + P  +  V W+K G  LG  R D+  +       RY +  D  +G + L+I  V L D+  F CQ      A+ S+ A+L VLV    P I      G GP         + +  GD + L C A+  +P A + WM + E++        NG +   ++   + +V + +   + STL    + +  G+ I C A+N+     N  EA   I+I   P V + +  Q +     E   +   CSA   P   L++W    + +   +  +Y++    +     V C   N     ++ R ++V +GP+   + P     ++G D    C    NP   I W +  +  ++ +  +L  K++++ D G Y+C A V       K++ L     P I      +A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+++NI  +DF   YNC+     GS ++++ L +   +P+ +I+G
Sbjct:   23 QPQDLVVVAGQPVTLPCSI-PGYHGIVLWIKDGLALGVGR-DLSGYP------RYTVIGDHGSGEHHLRIQRVELMDDAVFECQA--VQAAMRSRPARLTVLVPPDDPVI------GGGP--------VVSLRAGDPLNLTCHADNAKPAASIIWMRNGEVL--------NGAMYSKVS--IEALVRDGRRESTVSTLYLSPSNIETGQQIICRASNKAVP--NGKEASVTIDIQHLPLVNLSVEPQAV----LEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTYEVIVDHSFFTEPVSCEVTNSLGSTNVSRNVDVYFGPRMAAE-PQSLQVDLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQESLPVAVIIG 501          
BLAST of NEPH-2 vs. Ensembl Medaka
Match: KIRREL3 (kirre like nephrin family adhesion molecule 3 [Source:NCBI gene;Acc:101170290])

HSP 1 Score: 159.073 bits (401), Expect = 1.173e-39
Identity = 133/526 (25.29%), Postives = 229/526 (43.54%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDL-RMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNT-KYSISTEKYVDHSISILSINNIQASDFGQ-YNCSVTTDLGSASKVMVLSK----TSPIPLILIVG 2012
             P++  V     VT+ C + P  +  V W+K G  LG  R D+  +       RY +  D  +G + L+I  V L D+  F CQ      A+ S+ A+L VLV    P I      G GP         + +  GD + L C A+  +P A + WM + E++        NG +       SK +V + +   + STL    + +  G+ I C A+N+     N  EA   I+I   P V + +  Q +     E   +   CSA   P   L++W    + +   +  +Y++    +     V C   N     ++ R ++V +GP+   + P     ++G D    C    NP   I W +  +  ++ +  +L  K++++ D G Y+C A V       K++ L     P I      +A  G   Q KC I S P    ++I W ++   L +  + +Y++ T    +  IS L+++NI  +DF   YNC+     GS ++++ L +       +P+ +I+G
Sbjct:   19 QPQDLVVVAGQPVTLPCSI-PGYHGIVLWIKDGLALGVGR-DLSGYP------RYTVIGDHGSGEHHLRIQRVELMDDAVFECQA--VQAAMRSRPARLTVLVPPDDPVI------GGGP--------VVSLRAGDPLNLTCHADNAKPAASIIWMRNGEVL--------NGAM------YSKALVRDGRRESTVSTLYLSPSNIETGQQIICRASNKAVP--NGKEASVTIDIQHLPLVNLSVEPQAV----LEGSLVRFQCSAKANPPVTLYRWAKGGSIIKEVSGDTYEVIVDHSFFTEPVSCEVTNSLGSTNVSRNVDVYFGPRMAAE-PQSLQVDLGSDAVFNCAWTGNPSLTIVWMKRGSGVVLSNENLLTLKSVRQEDAGKYVCRAVVPRVGAGEKEVSLTVNGPPTISSTQTQQALHGEKGQIKCFIRSTPPP--DRIAWSWKETVLESGTSGRYTVETVNTEEGVISTLTMSNIVPADFQTIYNCTAWNSFGSDTEIIRLKEQGGSQESLPVAVIIG 497          
BLAST of NEPH-2 vs. Ensembl Medaka
Match: kirrel1a (kin of IRRE-like protein 1 [Source:NCBI gene;Acc:101168819])

HSP 1 Score: 144.05 bits (362), Expect = 9.116e-35
Identity = 127/532 (23.87%), Postives = 223/532 (41.92%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAK---IEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRML-NVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLIND----NTKYSISTEKYVDHS---ISILSINNIQASDF-GQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGG 2015
             P +Q V     V + C V     + V W K G  LG    D+R++       RY +     +G Y+L+I   +L D+  + CQ    + A+ S+RA+L VL+    P I        GPE L N         G+   L C +   +P + + W+ D   +E        G +S T      +++ + K   + S L         G++  C  +N        P  K+    + +H  P VT+ I  +++     E D +T +C A   P    ++W      +     S +  KA  +     V C+  N     ++ +L +V++GP    +  P    ++  DVTL C    NP   + W ++ +N ++ +   LY +++ + D G Y+C A V    +   ++ L     P+I  +P   A  G   + KC I S P    ++I+W ++      +      +Y++   K        +S L+INN+  SDF   YNC+     G  + ++ L +   +P+ +I  G
Sbjct:   21 EPADQSVVRGQRVILSCVVFNYSGI-VQWTKDGLALG-IGEDLRAW------PRYRVLRVQESGQYNLEILSADLSDDAVYECQA--PDAALRSRRAKLTVLIPPDDPVI------DGGPEVLLNA--------GESYNLSCVSRGAKPPSTIEWLKDGLPVE--------GAVSIT------EVLADRKRVTTQSHLPIHPVDTDTGRNYSCVTSN-----LAVPSGKSTTVTLNVHHPPVVTLSIEPRSV----LEGDRVTFTCQAHANPPIMGYRWAKGGVVLQGARESVFTTKADHSFFTEPVSCLVFNAVGKTNVSILVDVQFGPILLVEPQPKT-VDVNSDVTLNCKWAGNPPLTLTWFKKGSNMVLSNSNQLYLQSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSDPVQYAVRGERGEVKCYIASTPPP--DKIVWAWKENVWEKERGTLQERYTVEQSKLSAEGGGVLSTLTINNVMESDFLSTYNCTAWNSFGPGTMIITLEEKEEVPVGIIAVG 502          
BLAST of NEPH-2 vs. Planmine SMEST
Match: SMESG000071657.1 (SMESG000071657.1)

HSP 1 Score: 1707.58 bits (4421), Expect = 0.000e+0
Identity = 842/842 (100.00%), Postives = 842/842 (100.00%), Query Frame = 3
Query:  432 GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGXXXXXXXXXXXXXALCVCKRGICSNKYQKGSPTNRINSNNSTDPLKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDIDDVYKEEFYPSSNPAMMCSMHITPTGSGAINRASPCNAHPYSVPQHQISLPQYNFTSFANPPYLSNYLPGSNNNFALPSYPVHSPSSEPGINGGSGLMIPPVLPPIDTNDANHNVELGLSPQQTSFIKPGMTISQNMANYLSPNIRPKPNSYNYTLSGNSNDGNSFKSRTLDRRGPISSFTNVDQTTNI 2957
            GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGTVFITMVMMIVIIALCVCKRGICSNKYQKGSPTNRINSNNSTDPLKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDIDDVYKEEFYPSSNPAMMCSMHITPTGSGAINRASPCNAHPYSVPQHQISLPQYNFTSFANPPYLSNYLPGSNNNFALPSYPVHSPSSEPGINGGSGLMIPPVLPPIDTNDANHNVELGLSPQQTSFIKPGMTISQNMANYLSPNIRPKPNSYNYTLSGNSNDGNSFKSRTLDRRGPISSFTNVDQTTNI
Sbjct:   17 GNENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGTVFITMVMMIVIIALCVCKRGICSNKYQKGSPTNRINSNNSTDPLKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDIDDVYKEEFYPSSNPAMMCSMHITPTGSGAINRASPCNAHPYSVPQHQISLPQYNFTSFANPPYLSNYLPGSNNNFALPSYPVHSPSSEPGINGGSGLMIPPVLPPIDTNDANHNVELGLSPQQTSFIKPGMTISQNMANYLSPNIRPKPNSYNYTLSGNSNDGNSFKSRTLDRRGPISSFTNVDQTTNI 858          
BLAST of NEPH-2 vs. Planmine SMEST
Match: SMESG000022777.1 (SMESG000022777.1)

HSP 1 Score: 434.491 bits (1116), Expect = 4.489e-138
Identity = 273/811 (33.66%), Postives = 434/811 (53.51%), Query Frame = 3
Query:  438 ENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVG-NKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFN-GIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKD-DSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGXXXXXXXXXXXXXALCVCKRGICSNKYQKGSPTN-RINSNNSTDPLKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDIDDVYKEEFYPSSNPAMMCSMHITPTGSGAINRAS----------PCNAHPYSVPQHQISLPQYNFTSFANPPYLSNYLPGSNNNFALPSYPVHSPSSEPGINGGSGLMIPPVLPPIDTNDANHNVELGLSPQQTSFIKPGMTISQNMANYLSPNIR 2828
            ++YI VHPE Q   LNST+T++CRV+ ++  +V+WVK GFGLG +R+DIR +G    ++ R+D+P +L+ G YDL+ITD+ L DEG FYCQ+ +   A +SQ+  + VLV S  P+++QI    +GP+ +RNE +PI+V++G+ + ++C A+ GRPGA L W ++   IE   +G  N   ++G IT  S+   N  KL D  ++L+ K+  L NG  +KC A N G+         A+I ++  P V +++  +   N F END +  +CSA GRP  F W W I D  ++N     YK+K TR  +   + C A +   G +   + VKYGP FKD DS  +Y A+IG+++ + C  D NP   I WQR S+N++I  G+IL R +IQ  DFG YIC A V+ F  + K I L ++  P I+         G+S +  C I SIP  N N+I W+++ ++L+ + T++ +  +       S+L I ++Q  DFG YNCSV+T  GS    ++L + S  P+++IVG T+    +++++I+ LC+C+R    ++Y KG+P++  I  ++     KS   + D QC PN + WIP       +S  V+   DV  +   ++G+       ++ S Y++S+P SQ+  K ++      + K E   ++NP ++ +MH    G+  +NR S          P    P      Q +  QY + +  NP    N       + A P Y V  P+++                        H ++      QT F  PG  I +N  N  S N+ 
Sbjct:   17 DDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINK--IGPQAIRNEKNPIIVNDGEYLHIKCIAKHGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLL-EGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMKGNPSSPEIPLHHEA---KSTLIDSDCQCNPNLYSWIP-------QSFDVKSQNDVLSKIHYQDGNFWP-NSQEIESCYSNSVPDSQSSNKSVK------ITKHE-NANTNP-ILYNMHT--IGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCT--QYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANK-----------------------KHQIQF-----QTDFYSPGKPIIKNKLNSGSANME 773          
BLAST of NEPH-2 vs. Planmine SMEST
Match: SMESG000022777.1 (SMESG000022777.1)

HSP 1 Score: 434.106 bits (1115), Expect = 6.973e-138
Identity = 273/811 (33.66%), Postives = 434/811 (53.51%), Query Frame = 3
Query:  438 ENYINVHPENQRVTLNSTVTIQCRVQPIKNMKVYWVKSGFGLGETRSDIRSFGMVG-NKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFN-GIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGPQFKD-DSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGXXXXXXXXXXXXXALCVCKRGICSNKYQKGSPTN-RINSNNSTDPLKSPQFEMDYQCQPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTYTSSIPGSQNGEKPIRNPDIDDVYKEEFYPSSNPAMMCSMHITPTGSGAINRAS----------PCNAHPYSVPQHQISLPQYNFTSFANPPYLSNYLPGSNNNFALPSYPVHSPSSEPGINGGSGLMIPPVLPPIDTNDANHNVELGLSPQQTSFIKPGMTISQNMANYLSPNIR 2828
            ++YI VHPE Q   LNST+T++CRV+ ++  +V+WVK GFGLG +R+DIR +G    ++ R+D+P +L+ G YDL+ITD+ L DEG FYCQ+ +   A +SQ+  + VLV S  P+++QI    +GP+ +RNE +PI+V++G+ + ++C A+ GRPGA L W ++   IE   +G  N   ++G IT  S+   N  KL D  ++L+ K+  L NG  +KC A N G+         A+I ++  P V +++  +   N F END +  +CSA GRP  F W W I D  ++N     YK+K TR  +   + C A +   G +   + VKYGP FKD DS  +Y A+IG+++ + C  D NP   I WQR S+N++I  G+IL R +IQ  DFG YIC A V+ F  + K I L ++  P I+         G+S +  C I SIP  N N+I W+++ ++L+ + T++ +  +       S+L I ++Q  DFG YNCSV+T  GS    ++L + S  P+++IVG T+    +++++I+ LC+C+R    ++Y KG+P++  I  ++     KS   + D QC PN + WIP       +S  V+   DV  +   ++G+       ++ S Y++S+P SQ+  K ++      + K E   ++NP ++ +MH    G+  +NR S          P    P      Q +  QY + +  NP    N       + A P Y V  P+++                        H ++      QT F  PG  I +N  N  S N+ 
Sbjct:   20 DDYILVHPERQVAALNSTITLKCRVKVVEKYEVHWVKDGFGLGNSRTDIRQYGQRKPHQFRFDLPFNLAEGEYDLRITDLELFDEGVFYCQIVVNGKAYSSQKVLVQVLVPSDKPQLVQINK--IGPQAIRNEKNPIIVNDGEYLHIKCIAKHGRPGASLYWYLNEIKIEAQKNGVLNETFLNGKITITSESSENLPKLYDVVNSLELKIVSLKNGNWLKCLAINNGYTNQKLNYTSAQIVVYTVPIVVINVYPKKQNNIFIENDIVEFTCSASGRPSDFHWAWTIGDESLVNIRDPKYKLKITRVDHGKKITCCATSKSIGCNSTNILVKYGPNFKDSDSLTIYAASIGENMQMECRADGNPEPLITWQRISSNEVIARGSILLRNDIQADDFGDYICKAAVKEFPERHKYIYLGEKGPPEIKNPSVSYGREGQSARLSCTIKSIPFPNDNEIKWIFKNKQLL-EGTRHKMYRQINEKIVTSVLHILSVQPHDFGDYNCSVSTKYGSDMATIILLRKSETPMLMIVGATIIFLFILLVIIVVLCICQRRKFKDEYMKGNPSSPEIPLHHEA---KSTLIDSDCQCNPNLYSWIP-------QSFDVKSQNDVLSKIHYQDGNFWP-NSQEIESCYSNSVPDSQSSNKSVK------ITKHE-NANTNP-ILYNMHT--IGTNTLNRYSTNMPFTNLPIPREKDPRFCDSSQCT--QYLYQNLYNPVVEHNSQLNPTESTASPIYIVKKPANK-----------------------KHQIQF-----QTDFYSPGKPIIKNKLNSGSANME 776          
BLAST of NEPH-2 vs. Planmine SMEST
Match: SMESG000074081.1 (SMESG000074081.1)

HSP 1 Score: 162.925 bits (411), Expect = 1.053e-40
Identity = 167/643 (25.97%), Postives = 260/643 (40.44%), Query Frame = 3
Query:  459 PENQRVTLNSTVTIQCRVQ------PIKNMKVYWVKSGFGL-GETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYCQMNIKNNAI-TSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNENSPIVVDNGDL---MALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSF--------STLKAKVNQLLNGKSIKCSATNRGFEKFNFPE-AKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKWYINDNEVMNDNRSSY-------KIKATRTMNKAVVKC--------------------IANNG----------KEGHDLRMLNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRE--------SNNDIIG--------------HGTIL-----YRKNIQELD-FGTYICTAGVENFDLKSKKIILAKRIKPMIRENPD-HRASLGRSVQAKCVIDSIPIANHNQIMWLYR-GRRLINDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGXXXXXXXXXXXXXALCVCK----RGICSNK---YQKG 2105
            P +  V +NST  ++CRV       P+K   V W K GFG   ET  D           RY +P     G YDL I  V+ +D+G++ CQ+N   + + T++   L V+V   PP  I++ +     +     N  I    G L   + L C+ +  RP   L W +    +    SG+ +G   GT+T         ++  DSF        S L+ ++ +  NG+ +KC+  N        P+ A  K+ +     V MD++       F+E++ I I+CSA   P   ++ W   +          Y       KIK  R +N   ++C                    I +N             G    +L V+Y P   D       A +GD VTL C  DSNP A I W +         +N D++G                T+L     Y   I + D  G +IC A  + F    K + + +   P I  N     A  G SV+  C I SIP+ +  +I+W      + I   +K  I  E+ +   +S L I+ +   D+G YNCSV+   G  S  + L      P+I I+G +  I + ++   I  C+ +    R   +N+   Y KG
Sbjct:   36 PVSTSVLINSTARLRCRVTFNNSNTPVK---VQWQKDGFGYENETLRD-------HFNGRYQMPGPRETGTYDLVIHSVDKQDDGEYACQVNAAIHILETTKSINLTVIV---PPDKIKLKSSQFDFQNNSTNNEIIQNIWGHLNEFLILSCEIQYSRPATELVWKLGEFALREGKSGDIDGQEVGTVT-------TKSEFMDSFDQFYYKSESHLRLRLRKDHNGEILKCTIANEQSFMHKTPKPAIMKLNVLFVLDVKMDVIPHRPFFHFTEHEMIQINCSASTNPANVIYNWIKYNPTTKTTTIIKYFDRSGVLKIKVRRDLNNMFIRCQVLSVLAGQECYSNFQPESIIYDNSYLVNCSERHTANGSSQIILRVQYSPIILDSILETKAAFLGDVVTLDCRADSNPPAKITWYKSKFSSKEIMANPDLVGARNLQKDTQMSSYSSMTLLSISDKYHFTITDADNLGLFICIALTDGFPPVQKTVFVGQGATPQIVNNQKIIIAKSGLSVRISCHIISIPLPDKGKIIWFKNLNTKPIEAKSKNQIYEEERLAGVVSYLYIHKVTYEDYGTYNCSVSNPYGRVSSTIELIPPVETPMIFIIGSSCAIALAVLFAFIIFCIIRTSKNRSTSTNQRSVYMKG 658          
BLAST of NEPH-2 vs. Planmine SMEST
Match: SMESG000077979.1 (SMESG000077979.1)

HSP 1 Score: 109.383 bits (272), Expect = 5.441e-24
Identity = 137/636 (21.54%), Postives = 246/636 (38.68%), Query Frame = 3
Query:  456 HPENQRVTLNSTVTIQCRVQPIKN---MKVYWVKSGFGL-GETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLEDEGDFYC--QMNIKNNAITSQRAQLHVLVASGPPKIIQ----------IGNQGMGPEKLRNENSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISGTITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRG-FEKFNFPEAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFL-WKWYINDNEVMNDN------RSSYK---IKATRTMNKAVVKCIANNGKEGH------------DLRM-------LNVKYGPQFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQR----ESNN----------------------DIIGHGTILYRKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIR-ENPDHRASLGRSVQAKCVIDSIPIANHNQIMWLYRGRRL--INDNTKYSISTEKYVDHSISILSINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPL-----ILIVGGXXXXXXXXXXXXXALCVCKRGICSNKYQKGSPTNRI 2123
             P   +V L     ++CR++  +N   +K+ W K  FGL   T  D+        K R  IP  + +G YDL      L+DE  + C  ++ ++++ I      +  L+  G  KII+          + N        +  +S I V     +   C ++ G P  +L W +  E    D     NG I                 R ++S ++   +   +  +I C   N+  +     P A   +++       +   + N+       + ++ SC+++  P   + + W++  N V   N      RSS     IKA+   + + + C+     +              +LR        LN+ Y P+ K     +   NIG+ V L+C  DSNP A+I W +     S N                      ++I   +    + + E D   YIC A    F    K +++AK+ +P I+ E    +          C+++S P  + + I W +    L  I+   +Y I+  + +    S L    +  SD+G Y CS      S  K +V  +   +PL     I I  G + + ++++I +  +C CK+G    +  K +P  +I
Sbjct:   32 EPSEVKVILGQPTVLKCRLEIPENVVKIKLQWSKDMFGLENSTIQDVY-------KGRLTIPGSIQSGYYDLHFKTTELQDEALYGCHIELTLRDSEI------VESLIGKGSLKIIEPPTELGFQFHVANASYSGIIWQKRDSIIWVPENQKLNFTCISKNGSPMPQLMWTVKTETGLSD-----NGKIQ----------------RQNYSLMRLSSD--FHNSNISCKIVNKKDYLDGKLPTAVVTVQVLYIKNAVILRTNGNIDKPIHNGEAVSFSCNSIFTPGIIIYYSWFVEYNNVEKQNGEYLVERSSSNNIVIKASPKFHFSRLHCMLFTSVQKDNCDSNINRNCNIELRHKAVSSKSLNILYPPKIKTPFENITVTNIGEWVVLSCEVDSNPQASIRWYKTHFGTSKNTRSINWYYQTSTINLNEVTVIENMISSTSYHKFQVVNEYDLDIYICEAQASTFQKIYKYVVVAKKEEPTIKVEQATIKVENDGIASLMCLVESWPKPSPSNIKWYFETSELAIISTERRYLINKRQLMGVE-SKLFFKKVIDSDYGTYTCSF-----SYGKTIVTKQIHLLPLKNKFIIFISIGALGVLVLLIIAVAIICACKKGTSKKRKCKKTPLQKI 625          
The following BLAST results are available for this feature:
BLAST of NEPH-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL31.759e-4025.86kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL11.447e-3823.68kirre like nephrin family adhesion molecule 1 [Sou... [more]
KIRREL34.487e-3825.28kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL37.649e-3825.28kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL13.170e-2823.46kirre like nephrin family adhesion molecule 1 [Sou... [more]
back to top
BLAST of NEPH-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syg-11.736e-3425.86Synaptogenesis protein syg-1 [Source:UniProtKB/Sw... [more]
syg-12.154e-3425.86Synaptogenesis protein syg-1 [Source:UniProtKB/Sw... [more]
him-45.935e-1420.87High Incidence of Males (Increased X chromosome lo... [more]
him-42.804e-1321.21High Incidence of Males (Increased X chromosome lo... [more]
him-43.377e-1321.21High Incidence of Males (Increased X chromosome lo... [more]
back to top
BLAST of NEPH-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kirre2.761e-4426.90gene:FBgn0028369 transcript:FBtr0332492[more]
kirre2.761e-4426.90gene:FBgn0028369 transcript:FBtr0309498[more]
kirre2.761e-4426.90gene:FBgn0028369 transcript:FBtr0070560[more]
kirre2.761e-4426.90gene:FBgn0028369 transcript:FBtr0309499[more]
kirre2.761e-4426.90gene:FBgn0028369 transcript:FBtr0070559[more]
back to top
BLAST of NEPH-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kirrel3a8.576e-4225.62kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3a3.269e-4125.62kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel3a3.269e-4125.62kirre like nephrin family adhesion molecule 3a [So... [more]
KIRREL32.992e-3924.80kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel1a2.252e-3825.19kirre like nephrin family adhesion molecule 1a [So... [more]
back to top
BLAST of NEPH-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4e1.839e-4024.01eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e2.153e-4024.02eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e3.503e-4024.02eukaryotic translation initiation factor 4E [Sourc... [more]
rps76.649e-4025.29ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-9... [more]
rps79.567e-4025.29ribosomal protein S7 [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of NEPH-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kirrel32.643e-4125.86kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel31.172e-4025.86kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel31.172e-4025.86kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel31.230e-4025.86kirre like nephrin family adhesion molecule 3 [Sou... [more]
Kirrel1.365e-3823.88kirre like nephrin family adhesion molecule 1 [Sou... [more]
back to top
BLAST of NEPH-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08180|ICCR_DROME1.284e-4125.41Irregular chiasm C-roughest protein OS=Drosophila ... [more]
sp|Q96J84|KIRR1_HUMAN6.950e-3823.68Kin of IRRE-like protein 1 OS=Homo sapiens OX=9606... [more]
sp|Q80W68|KIRR1_MOUSE9.548e-3823.88Kin of IRRE-like protein 1 OS=Mus musculus OX=1009... [more]
sp|Q6X936|KIRR1_RAT1.290e-3723.88Kin of IRRE-like protein 1 OS=Rattus norvegicus OX... [more]
sp|Q8IZU9|KIRR3_HUMAN3.673e-3725.28Kin of IRRE-like protein 3 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of NEPH-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFE90.000e+0100.00NEPH-2 OS=Schmidtea mediterranea OX=79327 GN=NEPH-... [more]
A0A4E0S4A93.634e-14538.04Irregular chiasm C-roughest protein OS=Fasciola he... [more]
A0A4S2MJS21.415e-13535.70Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2MJ833.432e-13535.70Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0H3YJJ78.199e-13533.79NEPH-3 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
back to top
BLAST of NEPH-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL39.531e-4225.43kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL31.245e-4125.43kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel3a3.234e-3925.62kirre like nephrin family adhesion molecule 3a [So... [more]
kirrel1a2.360e-3624.62kirre like nephrin family adhesion molecule 1 [Sou... [more]
kirrel1b1.441e-3123.85kirre like nephrin family adhesion molecule 1b [So... [more]
back to top
BLAST of NEPH-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010550.14.856e-1827.72pep scaffold:Pmarinus_7.0:GL479154:26986:35474:-1 ... [more]
ENSPMAT00000010567.11.449e-1222.08pep scaffold:Pmarinus_7.0:GL479154:561817:685780:1... [more]
pxdn2.151e-1022.85peroxidasin [Source:ZFIN;Acc:ZDB-GENE-140415-2][more]
cntn3b7.686e-1024.13contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645][more]
ENSPMAT00000004946.11.909e-821.89pep scaffold:Pmarinus_7.0:GL501092:7822:21335:1 ge... [more]
back to top
BLAST of NEPH-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NEPH-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453831.008e-827.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO304511.418e-823.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO296161.503e-822.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319427.634e-822.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274771.908e-722.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NEPH-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIRREL32.052e-4125.48kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL34.539e-4125.48kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL36.677e-4125.10kirre like nephrin family adhesion molecule 3 [Sou... [more]
KIRREL31.173e-3925.29kirre like nephrin family adhesion molecule 3 [Sou... [more]
kirrel1a9.116e-3523.87kin of IRRE-like protein 1 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of NEPH-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071657.10.000e+0100.00SMESG000071657.1[more]
SMESG000022777.14.489e-13833.66SMESG000022777.1[more]
SMESG000022777.16.973e-13833.66SMESG000022777.1[more]
SMESG000074081.11.053e-4025.97SMESG000074081.1[more]
SMESG000077979.15.441e-2421.54SMESG000077979.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30012867
GenBankAKN21715.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012867 ID=SMED30012867|Name=NEPH-2|organism=Schmidtea mediterranea sexual|type=transcript|length=3052bp
TAGAAGTGTTCTAGAATTTAATTGGCTGGTTTTTGAATCATCTCTCATGA
TGCATTTGCTGATGCCGTTTTTCCATTCGGTGTGCTAGATGCTGCATGCT
ATCTCAACTTTCAAAAACTGGTGCTGCGCTATTTTCAAAACAGAATTAGC
CGTTTTTTTTGTTGTTGTGAAAATTTATTATTTAATTTGATCTTCTCAAG
AACCTTCGGAAAATTTTTCGGTGAAATAGATTTTGATTGGAAAAGAGATC
TTTCAGGAAAAAAAAACTAATAAACATTTGAGTTTTTTTTTCAGATTAGA
TTATTATTATTATTGTTATTTATTATTTTATTTTTCGAAAAACGGGAGTA
TATATCAGTTCTATTATTTATTGAAAAAAAGAAATGCTATTGAAACTTTT
CATATTCATTATTAGTTTGAAATTTATTTTTGGAAATGAAAATTACATAA
ATGTTCATCCTGAAAATCAAAGAGTCACTTTGAACAGCACTGTGACTATT
CAGTGCAGAGTTCAGCCAATAAAAAATATGAAAGTTTATTGGGTTAAAAG
TGGCTTTGGATTAGGAGAAACTCGTTCTGATATCAGATCTTTTGGAATGG
TTGGCAACAAGGTTCGATATGACATACCAAACGATCTTTCAGCTGGAAAT
TACGATCTGCAGATTACAGATGTAAACTTGGAGGATGAAGGAGATTTCTA
CTGCCAAATGAATATAAAAAACAATGCCATAACTAGTCAACGAGCTCAAC
TGCATGTTTTAGTTGCTTCAGGGCCACCGAAAATTATTCAAATAGGCAAT
CAAGGAATGGGGCCTGAAAAACTGCGAAATGAAAACTCTCCAATTGTCGT
AGACAATGGAGACCTAATGGCACTTAGGTGTCAGGCAGAAAGAGGCCGAC
CAGGAGCTCGGTTGACGTGGATGATTGACAATGAAATTATCGAACCGGAT
TTAAGTGGGAATTTTAATGGAATTATAAGTGGAACTATTACTAATATTTC
GAAGAAAATCGTAAATAATACGAAATTGCGAGACTCATTCAGCACATTAA
AAGCCAAAGTTAATCAGCTTTTGAATGGGAAATCAATAAAATGTTCTGCG
ACCAACAGAGGATTCGAAAAGTTTAATTTTCCAGAGGCGAAAGCAAAAAT
TGAAATACATGTGGCACCTACAGTGACAATGGATATTGTATCCCAGAATT
TAGGAAATGAGTTCTCAGAAAATGATTGGATCACCATTTCCTGCTCCGCT
CTGGGCAGACCAGACAAATTTCTCTGGAAGTGGTATATAAATGACAATGA
GGTAATGAATGATAACCGAAGCTCCTACAAGATCAAAGCTACTCGAACAA
TGAATAAAGCTGTTGTGAAATGCATTGCTAATAATGGAAAAGAAGGTCAT
GATCTGAGGATGCTTAACGTTAAATATGGACCCCAGTTCAAAGATGATTC
TCCACCTCTTTATCCAGCTAATATTGGTGATGATGTAACGTTAACTTGCA
ATACTGACAGCAATCCAATGGCAAATATTTACTGGCAAAGAGAATCCAAT
AATGACATCATTGGTCATGGAACCATTTTATACAGAAAGAACATCCAAGA
ACTTGATTTCGGTACATACATTTGTACGGCTGGTGTGGAAAACTTTGATT
TGAAATCAAAAAAAATAATTCTAGCAAAACGAATCAAGCCGATGATCCGT
GAAAATCCTGATCACAGAGCCTCACTAGGAAGATCAGTTCAAGCGAAATG
TGTCATAGATTCAATTCCAATAGCAAATCACAATCAAATAATGTGGCTCT
ACCGGGGTCGGCGTTTGATAAACGACAACACTAAATACAGTATTTCCACA
GAAAAATATGTCGATCATTCAATAAGTATCTTAAGCATCAATAACATCCA
AGCAAGTGATTTCGGTCAGTATAACTGCTCGGTAACTACCGATTTGGGGT
CAGCTTCAAAGGTCATGGTGTTATCTAAAACAAGTCCAATTCCTTTAATA
CTTATCGTCGGTGGCACTGTTTTCATAACCATGGTGATGATGATTGTCAT
AATTGCTCTATGTGTCTGTAAAAGAGGAATATGCAGCAACAAATATCAGA
AAGGAAGTCCAACAAATCGTATCAATAGCAATAATTCTACAGATCCATTG
AAAAGTCCCCAGTTTGAAATGGACTACCAGTGCCAACCGAATTTCTTTCA
ATGGATTCCTAATAATAATAGAGAACAAGTAAAATCATCTTTCGTCAGAT
ATGGACAGGATGTAGACGACAGGAGTTCTATTCGAAATGGAAGTATCAAT
CAGTATCGTGGATTGGATATGTGCTCGACATATACAAGTTCAATTCCCGG
AAGTCAAAACGGAGAAAAGCCAATCAGAAATCCTGATATTGATGATGTTT
ACAAAGAAGAATTTTATCCATCTTCTAATCCTGCAATGATGTGCAGCATG
CACATTACTCCGACAGGAAGTGGAGCAATTAACCGAGCATCCCCATGCAA
TGCACATCCTTATTCAGTTCCCCAACATCAAATATCTTTACCACAATACA
ATTTTACATCTTTTGCTAACCCGCCATACCTTTCAAATTATCTACCCGGT
TCTAATAACAATTTTGCACTGCCATCATACCCAGTTCACTCACCATCATC
GGAGCCCGGTATAAATGGTGGGTCTGGATTAATGATACCCCCCGTTTTAC
CCCCAATCGACACAAATGATGCAAATCACAATGTCGAACTAGGTCTTTCT
CCCCAGCAAACTTCTTTCATCAAACCCGGCATGACAATAAGCCAAAACAT
GGCTAATTATTTATCACCAAATATTCGTCCAAAACCAAATTCATATAATT
ATACATTATCTGGTAACAGTAATGATGGAAACAGTTTCAAGAGTCGGACT
CTTGATCGTCGAGGACCAATATCTAGTTTTACCAATGTTGATCAAACAAC
AAATATTTAATACTCATTTGTGATTATTATTGTCATCAATATTACTTTGT
ACAAAAATATTTTATTTCCAAAAAATAAAGCGTCTGTTTTTTTATATCAT
TA
back to top

protein sequence of SMED30012867-orf-1

>SMED30012867-orf-1 ID=SMED30012867-orf-1|Name=SMED30012867-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=859bp
MLLKLFIFIISLKFIFGNENYINVHPENQRVTLNSTVTIQCRVQPIKNMK
VYWVKSGFGLGETRSDIRSFGMVGNKVRYDIPNDLSAGNYDLQITDVNLE
DEGDFYCQMNIKNNAITSQRAQLHVLVASGPPKIIQIGNQGMGPEKLRNE
NSPIVVDNGDLMALRCQAERGRPGARLTWMIDNEIIEPDLSGNFNGIISG
TITNISKKIVNNTKLRDSFSTLKAKVNQLLNGKSIKCSATNRGFEKFNFP
EAKAKIEIHVAPTVTMDIVSQNLGNEFSENDWITISCSALGRPDKFLWKW
YINDNEVMNDNRSSYKIKATRTMNKAVVKCIANNGKEGHDLRMLNVKYGP
QFKDDSPPLYPANIGDDVTLTCNTDSNPMANIYWQRESNNDIIGHGTILY
RKNIQELDFGTYICTAGVENFDLKSKKIILAKRIKPMIRENPDHRASLGR
SVQAKCVIDSIPIANHNQIMWLYRGRRLINDNTKYSISTEKYVDHSISIL
SINNIQASDFGQYNCSVTTDLGSASKVMVLSKTSPIPLILIVGGTVFITM
VMMIVIIALCVCKRGICSNKYQKGSPTNRINSNNSTDPLKSPQFEMDYQC
QPNFFQWIPNNNREQVKSSFVRYGQDVDDRSSIRNGSINQYRGLDMCSTY
TSSIPGSQNGEKPIRNPDIDDVYKEEFYPSSNPAMMCSMHITPTGSGAIN
RASPCNAHPYSVPQHQISLPQYNFTSFANPPYLSNYLPGSNNNFALPSYP
VHSPSSEPGINGGSGLMIPPVLPPIDTNDANHNVELGLSPQQTSFIKPGM
TISQNMANYLSPNIRPKPNSYNYTLSGNSNDGNSFKSRTLDRRGPISSFT
NVDQTTNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR013106Ig_V-set
IPR003599Ig_sub
IPR003598Ig_sub2
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR013162CD80_C2-set
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 26..126
e-value: 4.5E-11
score: 52.8
coord: 151..347
e-value: 140.0
score: 1.4
coord: 357..433
e-value: 0.0017
score: 27.6
coord: 441..530
e-value: 3.4E-5
score: 33.3
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 32..114
e-value: 0.87
score: 7.7
coord: 447..522
e-value: 0.13
score: 15.8
coord: 363..421
e-value: 0.0017
score: 27.6
IPR013106Immunoglobulin V-set domainSMARTSM00406igv1_8coord: 367..517
e-value: 2.3
score: 1.0
coord: 36..109
e-value: 0.0021
score: 27.3
IPR013106Immunoglobulin V-set domainPFAMPF07686V-setcoord: 26..126
e-value: 1.3E-9
score: 38.2
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 443..530
e-value: 2.1E-7
score: 30.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 433..532
e-value: 6.1E-15
score: 57.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 17..130
e-value: 5.8E-21
score: 76.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 265..346
e-value: 3.6E-5
score: 25.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 347..429
e-value: 3.9E-11
score: 45.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 147..264
e-value: 5.8E-10
score: 41.3
IPR013162CD80-like, immunoglobulin C2-setPFAMPF08205C2-set_2coord: 163..245
e-value: 1.2E-4
score: 22.1
NoneNo IPR availablePFAMPF13927Ig_3coord: 362..416
e-value: 4.7E-8
score: 33.5
NoneNo IPR availablePANTHERPTHR11640NEPHRINcoord: 18..576
NoneNo IPR availablePANTHERPTHR11640:SF31NEPHROSIS 1, CONGENITAL, FINNISH TYPE (NEPHRIN)-RELATEDcoord: 18..576
NoneNo IPR availableCDDcd00096Igcoord: 368..416
e-value: 1.99739E-5
score: 41.0737
NoneNo IPR availableCDDcd00096Igcoord: 37..108
e-value: 7.5207E-5
score: 39.5329
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.814
NoneNo IPR availableTMHMMTMhelixcoord: 539..561
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 20..124
score: 9.029
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 350..416
score: 10.335
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 262..347
score: 8.266
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 436..531
score: 11.116
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 132..257
score: 7.758
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 345..416
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 258..335
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 435..531
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 22..132