serine/threonine-protein kinase DCLK1

Overview
Nameserine/threonine-protein kinase DCLK1
Smed IDSMED30012858
Length (bp)3457
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of serine/threonine-protein kinase DCLK1 (SMED30012858) t-SNE clustered cells

Violin plots show distribution of expression levels for serine/threonine-protein kinase DCLK1 (SMED30012858) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of serine/threonine-protein kinase DCLK1 (SMED30012858) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for serine/threonine-protein kinase DCLK1 (SMED30012858) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012858

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30012858SMESG000078466.1 SmedASXL_012887SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30012858SMESG000078466.1 dd_Smed_v4_13093_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30012858 dd_Smed_v4_5129_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30012858 dd_Smed_v4_5129_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012858SMESG000078466.1 dd_Smed_v4_13093_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012858 dd_Smed_v4_5129_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30012858 dd_Smed_v4_5129_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Human
Match: DCX (doublecortin [Source:HGNC Symbol;Acc:HGNC:2714])

HSP 1 Score: 97.0561 bits (240), Expect = 8.730e-21
Identity = 69/281 (24.56%), Postives = 120/281 (42.70%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +K  ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  ++ LP G+R ++T    R+I  +++LE G  YVC+ +  +K + Y K     W                      + NV  + N K                    A QS  + N     A        PKL+                 I+   VKP+               VR+LLNK++  S+E +L+DI  +++     +   + +++ L GK++  + DFF +DD FIA G
Sbjct:   50 KKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNW----------------------SVNVKTSANMK--------------------APQSLASSNSAQ--ARENKDFVRPKLVT----------------IIRSGVKPRKA-------------VRVLLNKKTAHSFEQVLTDITEAIK----LETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG 253          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Human
Match: DCX (doublecortin [Source:HGNC Symbol;Acc:HGNC:2714])

HSP 1 Score: 97.0561 bits (240), Expect = 8.730e-21
Identity = 69/281 (24.56%), Postives = 120/281 (42.70%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +K  ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  ++ LP G+R ++T    R+I  +++LE G  YVC+ +  +K + Y K     W                      + NV  + N K                    A QS  + N     A        PKL+                 I+   VKP+               VR+LLNK++  S+E +L+DI  +++     +   + +++ L GK++  + DFF +DD FIA G
Sbjct:   50 KKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNW----------------------SVNVKTSANMK--------------------APQSLASSNSAQ--ARENKDFVRPKLVT----------------IIRSGVKPRKA-------------VRVLLNKKTAHSFEQVLTDITEAIK----LETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG 253          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Human
Match: DCX (doublecortin [Source:HGNC Symbol;Acc:HGNC:2714])

HSP 1 Score: 97.0561 bits (240), Expect = 8.730e-21
Identity = 69/281 (24.56%), Postives = 120/281 (42.70%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +K  ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  ++ LP G+R ++T    R+I  +++LE G  YVC+ +  +K + Y K     W                      + NV  + N K                    A QS  + N     A        PKL+                 I+   VKP+               VR+LLNK++  S+E +L+DI  +++     +   + +++ L GK++  + DFF +DD FIA G
Sbjct:   50 KKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNW----------------------SVNVKTSANMK--------------------APQSLASSNSAQ--ARENKDFVRPKLVT----------------IIRSGVKPRKA-------------VRVLLNKKTAHSFEQVLTDITEAIK----LETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG 253          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Human
Match: DCX (doublecortin [Source:HGNC Symbol;Acc:HGNC:2714])

HSP 1 Score: 97.0561 bits (240), Expect = 9.273e-21
Identity = 69/281 (24.56%), Postives = 120/281 (42.70%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +K  ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  ++ LP G+R ++T    R+I  +++LE G  YVC+ +  +K + Y K     W                      + NV  + N K                    A QS  + N     A        PKL+                 I+   VKP+               VR+LLNK++  S+E +L+DI  +++     +   + +++ L GK++  + DFF +DD FIA G
Sbjct:   50 KKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNW----------------------SVNVKTSANMK--------------------APQSLASSNSAQ--ARENKDFVRPKLVT----------------IIRSGVKPRKA-------------VRVLLNKKTAHSFEQVLTDITEAIK----LETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG 253          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Human
Match: DCX (doublecortin [Source:HGNC Symbol;Acc:HGNC:2714])

HSP 1 Score: 97.0561 bits (240), Expect = 1.036e-20
Identity = 69/281 (24.56%), Postives = 120/281 (42.70%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +K  ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  ++ LP G+R ++T    R+I  +++LE G  YVC+ +  +K + Y K     W                      + NV  + N K                    A QS  + N     A        PKL+                 I+   VKP+               VR+LLNK++  S+E +L+DI  +++     +   + +++ L GK++  + DFF +DD FIA G
Sbjct:   50 KKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNW----------------------SVNVKTSANMK--------------------APQSLASSNSAQ--ARENKDFVRPKLVT----------------IIRSGVKPRKA-------------VRVLLNKKTAHSFEQVLTDITEAIK----LETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG 253          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Celegans
Match: zyg-8 (Serine/threonine-protein kinase zyg-8 [Source:UniProtKB/Swiss-Prot;Acc:Q95QC4])

HSP 1 Score: 92.4337 bits (228), Expect = 7.464e-19
Identity = 67/294 (22.79%), Postives = 123/294 (41.84%), Query Frame = 2
Query:  212 HGRKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNK-MPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQI 1090
            H  K  R+RF+ NGD++F G + ++   R +++  LM +L    +     LP+GIR +FT    +RI+ ++Q E G  YVC+  + +K + Y +  +  W     + ++R+     L L+                  C+   +                               +P++IK                ++   VKP+ I+             R LLNK++ +S++ +L D+   ++         I ++F L G+ + S+ DFFR+DD F+A G NE +    +
Sbjct:   53 HLLKAKRLRFYRNGDQYFKGIQYALQSDRVKSMQPLMEDLMKTVICDSTALPHGIRHIFTIDGAQRITSVDQFEDGGGYVCSSTDAFKPVDYSRAAEPSWRLTLANRYNRHLETKKLALSVVE--------------PCHENTD-----------------------------FVFPRIIK----------------VIRNGVKPRRIS-------------RHLLNKKTARSFDQVLRDLTFVVK----LDSGAIRKLFTLSGRPVLSLQDFFRDDDVFVAYGGNEKMAADDL 270          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Celegans
Match: zyg-8 (Serine/threonine-protein kinase zyg-8 [Source:UniProtKB/Swiss-Prot;Acc:Q95QC4])

HSP 1 Score: 92.4337 bits (228), Expect = 8.954e-19
Identity = 67/294 (22.79%), Postives = 123/294 (41.84%), Query Frame = 2
Query:  212 HGRKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNK-MPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQI 1090
            H  K  R+RF+ NGD++F G + ++   R +++  LM +L    +     LP+GIR +FT    +RI+ ++Q E G  YVC+  + +K + Y +  +  W     + ++R+     L L+                  C+   +                               +P++IK                ++   VKP+ I+             R LLNK++ +S++ +L D+   ++         I ++F L G+ + S+ DFFR+DD F+A G NE +    +
Sbjct:  206 HLLKAKRLRFYRNGDQYFKGIQYALQSDRVKSMQPLMEDLMKTVICDSTALPHGIRHIFTIDGAQRITSVDQFEDGGGYVCSSTDAFKPVDYSRAAEPSWRLTLANRYNRHLETKKLALSVVE--------------PCHENTD-----------------------------FVFPRIIK----------------VIRNGVKPRRIS-------------RHLLNKKTARSFDQVLRDLTFVVK----LDSGAIRKLFTLSGRPVLSLQDFFRDDDVFVAYGGNEKMAADDL 423          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Celegans
Match: W07G1.1 (pep chromosome:WBcel235:II:13937995:13939631:-1 gene:WBGene00012328.1 transcript:W07G1.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07G1.1)

HSP 1 Score: 52.373 bits (124), Expect = 9.895e-7
Identity = 27/86 (31.40%), Postives = 54/86 (62.79%), Query Frame = 2
Query:  230 RIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYG 487
            +I  + N D FF G ++ ++ HR  ++D L++ +T +    + L NG ++L+T+S G  + DIN+++ G++YV A + ++   +YG
Sbjct:   32 KIHVYRNADVFFQGIQMVVNTHRVPSVDVLLDVITER----IGLINGAKKLYTTS-GTLVKDINKIKDGQNYV-ASSSHFTPAAYG 111          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Celegans
Match: F27C1.13 (pep chromosome:WBcel235:I:5443878:5446855:-1 gene:WBGene00017860.1 transcript:F27C1.13.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F27C1.13)

HSP 1 Score: 47.7506 bits (112), Expect = 7.155e-6
Identity = 24/89 (26.97%), Postives = 45/89 (50.56%), Query Frame = 2
Query:  233 IRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEK 499
            I  +   D F+ G ++ +  HRY+ +D LM++L   M    YLP G+R + T      I+ ++Q +    YV + +   K +   K+++
Sbjct:   46 ITIYKENDTFYTGHRVPVSNHRYKTLDVLMDDLNRTM----YLPYGVRTITTPMGRTIITSLDQFQHLGKYVASSSNPPKGVDLEKIQE 130          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111274)

HSP 1 Score: 96.2857 bits (238), Expect = 8.173e-20
Identity = 75/282 (26.60%), Postives = 132/282 (46.81%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAG-NENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            RK LRI+F+ NGD+F+PG  I +   RY++ + L  +LT  +  +V +P  +R ++ +  G++I+ +++LE G+ YVC+  NEN+K + Y             +  S+    LPL            +N + + H     + + P +    AG S     G       G     P +    S  +               V P+++T++R S  K +  +R+LLNKR+  S++ +L+ I   +R    +    + ++F L G  +  + DFF +DD F A G
Sbjct:  155 RKALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRLLEENVKIPGAVRTIY-NLCGKKITSLDELEDGQSYVCSCNNENFKKVEY-------------NTGSQPLSNLPL------------SNSRSNSHRLAKCRPSSPLKNGLLAGSSPFPACG------GGTGNGSPLIASRLSDRVTV-------------VHPRIVTLIR-SGTKPRRIMRLLLNKRNSPSFDHVLTAITQVVRLDTGY----VRKVFTLSGIPVVRLSDFFGSDDVFFAYG 386          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Fly
Match: CG17528 (gene:FBgn0261387 transcript:FBtr0111277)

HSP 1 Score: 96.2857 bits (238), Expect = 8.173e-20
Identity = 75/282 (26.60%), Postives = 132/282 (46.81%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAG-NENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            RK LRI+F+ NGD+F+PG  I +   RY++ + L  +LT  +  +V +P  +R ++ +  G++I+ +++LE G+ YVC+  NEN+K + Y             +  S+    LPL            +N + + H     + + P +    AG S     G       G     P +    S  +               V P+++T++R S  K +  +R+LLNKR+  S++ +L+ I   +R    +    + ++F L G  +  + DFF +DD F A G
Sbjct:  155 RKALRIKFYRNGDRFYPGITIPVSNERYRSFERLFEDLTRLLEENVKIPGAVRTIY-NLCGKKITSLDELEDGQSYVCSCNNENFKKVEY-------------NTGSQPLSNLPL------------SNSRSNSHRLAKCRPSSPLKNGLLAGSSPFPACG------GGTGNGSPLIASRLSDRVTV-------------VHPRIVTLIR-SGTKPRRIMRLLLNKRNSPSFDHVLTAITQVVRLDTGY----VRKVFTLSGIPVVRLSDFFGSDDVFFAYG 386          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0331181)

HSP 1 Score: 51.2174 bits (121), Expect = 7.152e-6
Identity = 34/90 (37.78%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  221 KPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGK 490
            K  R+ F+ NGD FFPG ++     R  ++  L N L +K+ P + LP G R +F S  G R   +++LE G  YV +  + +K  SYGK
Sbjct:  169 KARRVVFYRNGDPFFPGVELRYRPGR--DVTSLDN-LLDKISPKMDLPRGARYVF-SMDGDRKYHLDELEDGAFYVVSSFKAFKPASYGK 254          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Fly
Match: DCX-EMAP (gene:FBgn0259099 transcript:FBtr0299509)

HSP 1 Score: 51.2174 bits (121), Expect = 7.398e-6
Identity = 34/90 (37.78%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  221 KPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGK 490
            K  R+ F+ NGD FFPG ++     R  ++  L N L +K+ P + LP G R +F S  G R   +++LE G  YV +  + +K  SYGK
Sbjct:  169 KARRVVFYRNGDPFFPGVELRYRPGR--DVTSLDN-LLDKISPKMDLPRGARYVF-SMDGDRKYHLDELEDGAFYVVSSFKAFKPASYGK 254          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Zebrafish
Match: dclk2b (doublecortin-like kinase 2b [Source:ZFIN;Acc:ZDB-GENE-110411-1])

HSP 1 Score: 85.8853 bits (211), Expect = 6.714e-18
Identity = 66/263 (25.10%), Postives = 117/263 (44.49%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKE 1006
            ++  ++RF+ NGD++F G   ++   R++++D L+ ELT  +  +++LP G+R ++T+   ++IS + +L  G  YVCA NE Y+ + Y K   +P +  R           P+G A                          PT   R  G+S  +K+ I            PKL+                 ++   VKP             +  VRILLNK++  S+E +L+DI  +++  L   +  + R++ L GK+
Sbjct:   68 KRAKKVRFYRNGDRYFKGLVYAVSSDRFRSMDALLAELTRALADNLHLPQGVRNIYTADGAKKISSLEELAEGESYVCASNEPYRKVDYTK-NVNPNWGSRMAGAGSVVAAGPVGGAVR------------------------PT-VQRIVGESRESKDFIK-----------PKLV----------------TVIRSGVKP-------------RKAVRILLNKKTAHSFEQVLADITEAIK--LDSGV--VKRLYTLDGKQ 260          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Zebrafish
Match: dclk3 (doublecortin-like kinase 3 [Source:ZFIN;Acc:ZDB-GENE-081104-224])

HSP 1 Score: 82.0333 bits (201), Expect = 1.775e-15
Identity = 42/114 (36.84%), Postives = 73/114 (64.04%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHP-QTSHVLKYW 1153
            V+P+++TVVR     S   + +LLN+R+VQ++E L++D+  +L     +  + I R+F+  G+EI S+ DFFR D  F+A G N    +++++  LD+LYP++P    H+L+ W
Sbjct:   35 VRPRIVTVVRPCGNDSVRKISLLLNRRAVQTFEQLMADVSEALGFPCWNNSR-IRRLFSPMGREIHSLSDFFRFDHAFMAFG-NSRPSLEEVQAALDELYPENPVHCEHLLRIW 146          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 81.2629 bits (199), Expect = 4.207e-15
Identity = 33/91 (36.26%), Postives = 58/91 (63.74%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGK 490
            +K  ++RF+ NGDK+F G   ++   R+++ D L+ ELT  +  +V LP G+R ++T+  G++I+ ++ L  G  YVCA NE ++ + Y K
Sbjct:   61 KKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTK 151          

HSP 2 Score: 67.0106 bits (162), Expect = 1.105e-10
Identity = 41/114 (35.96%), Postives = 65/114 (57.02%), Query Frame = 2
Query:  719 GASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            GAS + P L   K++    ++ +Y        +KPK++TV+R+  +  K  VRILLNK++  S+E +L+DI     D +      + R++ L GK+I  + DFF +DD FIA G
Sbjct:  164 GASRSMPSLTATKNELRERESKDY--------IKPKLVTVIRSGVKPRKA-VRILLNKKTAHSFEQVLTDIT----DAIKLDSGAVKRLYTLEGKQIICLQDFFGDDDVFIACG 264          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 81.2629 bits (199), Expect = 4.586e-15
Identity = 33/91 (36.26%), Postives = 58/91 (63.74%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGK 490
            +K  ++RF+ NGDK+F G   ++   R+++ D L+ ELT  +  +V LP G+R ++T+  G++I+ ++ L  G  YVCA NE ++ + Y K
Sbjct:   61 KKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTK 151          

HSP 2 Score: 67.781 bits (164), Expect = 6.910e-11
Identity = 42/114 (36.84%), Postives = 65/114 (57.02%), Query Frame = 2
Query:  719 GASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            GAS + P L   K++    ++ +Y        +KPK++TV+R S  K +  VRILLNK++  S+E +L+DI     D +      + R++ L GK+I  + DFF +DD FIA G
Sbjct:  164 GASRSMPSLTATKNELRERESKDY--------IKPKLVTVIR-SGVKPRKAVRILLNKKTAHSFEQVLTDIT----DAIKLDSGAVKRLYTLEGKQIICLQDFFGDDDVFIACG 264          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Zebrafish
Match: dclk2a (doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-050420-170])

HSP 1 Score: 81.2629 bits (199), Expect = 4.639e-15
Identity = 34/97 (35.05%), Postives = 59/97 (60.82%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPW 508
            +K  ++RF+ NGDK+F G   ++   R+++ D L+ ELT  +  +V LP G+R ++T+  G++I+ ++ L  G  YVCA NE ++ + Y K     W
Sbjct:   61 KKAKKVRFYRNGDKYFKGLVYAVSGDRFRSFDALLMELTRSLSDNVNLPQGVRSIYTADGGKKITSLDDLVEGESYVCASNEPFRKVDYTKNVNPNW 157          

HSP 2 Score: 67.0106 bits (162), Expect = 9.635e-11
Identity = 41/114 (35.96%), Postives = 65/114 (57.02%), Query Frame = 2
Query:  719 GASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            GAS + P L   K++    ++ +Y        +KPK++TV+R+  +  K  VRILLNK++  S+E +L+DI     D +      + R++ L GK+I  + DFF +DD FIA G
Sbjct:  164 GASRSMPSLTATKNELRERESKDY--------IKPKLVTVIRSGVKPRKA-VRILLNKKTAHSFEQVLTDIT----DAIKLDSGAVKRLYTLEGKQIICLQDFFGDDDVFIACG 264          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Xenopus
Match: ovch1 (ovochymase 1 [Source:Xenbase;Acc:XB-GENE-6449526])

HSP 1 Score: 83.1889 bits (204), Expect = 1.581e-15
Identity = 45/105 (42.86%), Postives = 68/105 (64.76%), Query Frame = 2
Query:  806 NQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPD 1120
            N  VKP+++TVV+      K  + +LLNKRSVQ++E L++DI  +L      K   + +++NL GKEI+S+ DFFR DD FIA+G  E L  K  + + ++LYP+
Sbjct:   34 NSPVKPRIVTVVKPGSHPLKK-ITLLLNKRSVQTFEQLVADISEAL-GFPRWKNDRVRKLYNLRGKEIRSISDFFRGDDIFIALG-REKLTTKCTESVFNELYPE 135          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Xenopus
Match: DCLK2 (doublecortin like kinase 2 [Source:NCBI gene;Acc:100487296])

HSP 1 Score: 82.0333 bits (201), Expect = 3.711e-15
Identity = 33/97 (34.02%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPW 508
            RK  ++RF+ NGD++F G   ++   R++++D L+ ELT  +  +V LP G+R ++T    ++I  + +L+ G  YVCA NE Y+ + Y +     W
Sbjct:   69 RKAKKVRFYRNGDRYFKGLPYAVSAERFRSLDALLMELTRSLSDNVSLPQGVRCIYTLDGNKKIGSLEELQEGESYVCASNEPYRKVDYNRNVSPNW 165          

HSP 2 Score: 63.5438 bits (153), Expect = 1.809e-9
Identity = 34/82 (41.46%), Postives = 53/82 (64.63%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +KPK++TV+R S  K +  VRILLNK++  S+E +L+DI  +++  L   +  + R+  L GK++  + DFF  DD FIA G
Sbjct:  194 IKPKLVTVIR-SGSKPRKAVRILLNKKTAHSFEQVLTDITEAIK--LDSGV--VKRLCTLDGKQVTCLQDFFGEDDVFIACG 270          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Xenopus
Match: DCLK2 (doublecortin like kinase 2 [Source:NCBI gene;Acc:100487296])

HSP 1 Score: 82.0333 bits (201), Expect = 3.858e-15
Identity = 33/97 (34.02%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPW 508
            RK  ++RF+ NGD++F G   ++   R++++D L+ ELT  +  +V LP G+R ++T    ++I  + +L+ G  YVCA NE Y+ + Y +     W
Sbjct:   69 RKAKKVRFYRNGDRYFKGLPYAVSAERFRSLDALLMELTRSLSDNVSLPQGVRCIYTLDGNKKIGSLEELQEGESYVCASNEPYRKVDYNRNVSPNW 165          

HSP 2 Score: 63.1586 bits (152), Expect = 2.372e-9
Identity = 34/82 (41.46%), Postives = 53/82 (64.63%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +KPK++TV+R S  K +  VRILLNK++  S+E +L+DI  +++  L   +  + R+  L GK++  + DFF  DD FIA G
Sbjct:  194 IKPKLVTVIR-SGSKPRKAVRILLNKKTAHSFEQVLTDITEAIK--LDSGV--VKRLCTLDGKQVTCLQDFFGEDDVFIACG 270          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Xenopus
Match: DCLK2 (doublecortin like kinase 2 [Source:NCBI gene;Acc:100487296])

HSP 1 Score: 82.0333 bits (201), Expect = 3.941e-15
Identity = 33/97 (34.02%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPW 508
            RK  ++RF+ NGD++F G   ++   R++++D L+ ELT  +  +V LP G+R ++T    ++I  + +L+ G  YVCA NE Y+ + Y +     W
Sbjct:   69 RKAKKVRFYRNGDRYFKGLPYAVSAERFRSLDALLMELTRSLSDNVSLPQGVRCIYTLDGNKKIGSLEELQEGESYVCASNEPYRKVDYNRNVSPNW 165          

HSP 2 Score: 63.5438 bits (153), Expect = 2.015e-9
Identity = 34/82 (41.46%), Postives = 53/82 (64.63%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +KPK++TV+R S  K +  VRILLNK++  S+E +L+DI  +++  L   +  + R+  L GK++  + DFF  DD FIA G
Sbjct:  194 IKPKLVTVIR-SGSKPRKAVRILLNKKTAHSFEQVLTDITEAIK--LDSGV--VKRLCTLDGKQVTCLQDFFGEDDVFIACG 270          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Xenopus
Match: DCLK2 (doublecortin like kinase 2 [Source:NCBI gene;Acc:100487296])

HSP 1 Score: 81.6481 bits (200), Expect = 4.003e-15
Identity = 33/97 (34.02%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPW 508
            RK  ++RF+ NGD++F G   ++   R++++D L+ ELT  +  +V LP G+R ++T    ++I  + +L+ G  YVCA NE Y+ + Y +     W
Sbjct:   69 RKAKKVRFYRNGDRYFKGLPYAVSAERFRSLDALLMELTRSLSDNVSLPQGVRCIYTLDGNKKIGSLEELQEGESYVCASNEPYRKVDYNRNVSPNW 165          

HSP 2 Score: 62.7734 bits (151), Expect = 2.651e-9
Identity = 34/82 (41.46%), Postives = 53/82 (64.63%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +KPK++TV+R S  K +  VRILLNK++  S+E +L+DI  +++  L   +  + R+  L GK++  + DFF  DD FIA G
Sbjct:  194 IKPKLVTVIR-SGSKPRKAVRILLNKKTAHSFEQVLTDITEAIK--LDSGV--VKRLCTLDGKQVTCLQDFFGEDDVFIACG 270          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Mouse
Match: Dcx (doublecortin [Source:MGI Symbol;Acc:MGI:1277171])

HSP 1 Score: 97.0561 bits (240), Expect = 6.697e-21
Identity = 69/281 (24.56%), Postives = 120/281 (42.70%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +K  ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  ++ LP G+R ++T    R+I  +++LE G  YVC+ +  +K + Y K     W                      + NV  + N K                    A QS  + N     A        PKL+                 I+   VKP+               VR+LLNK++  S+E +L+DI  +++     +   + +++ L GK++  + DFF +DD FIA G
Sbjct:   50 KKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNW----------------------SVNVKTSANMK--------------------APQSLASSNSAQ--ARENKDFVRPKLVT----------------IIRSGVKPRKA-------------VRVLLNKKTAHSFEQVLTDITEAIK----LETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG 253          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Mouse
Match: Dcx (doublecortin [Source:MGI Symbol;Acc:MGI:1277171])

HSP 1 Score: 97.0561 bits (240), Expect = 6.920e-21
Identity = 69/281 (24.56%), Postives = 120/281 (42.70%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +K  ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  ++ LP G+R ++T    R+I  +++LE G  YVC+ +  +K + Y K     W                      + NV  + N K                    A QS  + N     A        PKL+                 I+   VKP+               VR+LLNK++  S+E +L+DI  +++     +   + +++ L GK++  + DFF +DD FIA G
Sbjct:   50 KKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNW----------------------SVNVKTSANMK--------------------APQSLASSNSAQ--ARENKDFVRPKLVT----------------IIRSGVKPRKA-------------VRVLLNKKTAHSFEQVLTDITEAIK----LETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG 253          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Mouse
Match: Dcx (doublecortin [Source:MGI Symbol;Acc:MGI:1277171])

HSP 1 Score: 97.0561 bits (240), Expect = 7.623e-21
Identity = 69/281 (24.56%), Postives = 120/281 (42.70%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +K  ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  ++ LP G+R ++T    R+I  +++LE G  YVC+ +  +K + Y K     W                      + NV  + N K                    A QS  + N     A        PKL+                 I+   VKP+               VR+LLNK++  S+E +L+DI  +++     +   + +++ L GK++  + DFF +DD FIA G
Sbjct:   50 KKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNW----------------------SVNVKTSANMK--------------------APQSLASSNSAQ--ARENKDFVRPKLVT----------------IIRSGVKPRKA-------------VRVLLNKKTAHSFEQVLTDITEAIK----LETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG 253          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Mouse
Match: Dcx (doublecortin [Source:MGI Symbol;Acc:MGI:1277171])

HSP 1 Score: 97.0561 bits (240), Expect = 7.623e-21
Identity = 69/281 (24.56%), Postives = 120/281 (42.70%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +K  ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  ++ LP G+R ++T    R+I  +++LE G  YVC+ +  +K + Y K     W                      + NV  + N K                    A QS  + N     A        PKL+                 I+   VKP+               VR+LLNK++  S+E +L+DI  +++     +   + +++ L GK++  + DFF +DD FIA G
Sbjct:   50 KKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNW----------------------SVNVKTSANMK--------------------APQSLASSNSAQ--ARENKDFVRPKLVT----------------IIRSGVKPRKA-------------VRVLLNKKTAHSFEQVLTDITEAIK----LETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG 253          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Mouse
Match: Dclk3 (doublecortin-like kinase 3 [Source:MGI Symbol;Acc:MGI:3039580])

HSP 1 Score: 78.5666 bits (192), Expect = 3.559e-14
Identity = 44/101 (43.56%), Postives = 66/101 (65.35%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYP 1117
            +KP+V+TVV+   +  +    +LLN+RSVQ++E LLSDI  +L      K   + ++F L G+E+KSV DFFR  D FIA+G  E L +K I+  +++LYP
Sbjct:   94 LKPRVVTVVKLGGQPLRKAT-LLLNRRSVQTFEQLLSDISEAL-GFPRWKNDRVRKLFTLKGREVKSVSDFFREGDAFIAMG-KEPLTLKSIQLAMEELYP 191          
BLAST of serine/threonine-protein kinase DCLK1 vs. UniProt/SwissProt
Match: sp|B4GXC2|DCLK_DROPE (Serine/threonine-protein kinase GL21140 OS=Drosophila persimilis OX=7234 GN=GL21140 PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 1.513e-21
Identity = 81/286 (28.32%), Postives = 134/286 (46.85%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAG-NENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNG----IHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            RK  RI+F+ NGD+F+PG  I +   RY++ + L  +LT  +  +V +P  +R ++    G++I+ + +LE G+ YVC+  NEN+K + Y              N S  P L  L LA         NN +   H           +  RPA      KNG    I    + G + A          P+N+   +    +    V P+++T++RN   K +  +R+LLNKR+  S++ +L+ I   +R    +    + ++F L G  +  + DFF +DD F A G
Sbjct:  154 RKAHRIKFYRNGDRFYPGITIPVSNERYRSFESLYEDLTRLLEENVKIPGAVRTIY-DMVGKKITALEELEDGQSYVCSCNNENFKKVDY--------------NTSSQP-LANLTLA---------NNSRTSSHRL--------AKLQRPASP---LKNGVPNSIAPVPVGGGAAA-------NGSPLNTSRFSERDSV----VHPRIVTLIRNG-TKPRRIIRLLLNKRNSPSFDHVLTAITQVVRLDTGY----VRKVFTLSGVSVLQLSDFFGSDDVFFAYG 387          
BLAST of serine/threonine-protein kinase DCLK1 vs. UniProt/SwissProt
Match: sp|B5DK35|DCLK_DROPS (Serine/threonine-protein kinase GA29083 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA29083 PE=3 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.663e-21
Identity = 83/297 (27.95%), Postives = 137/297 (46.13%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGN-ENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNG----IHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIK 1093
            RK  RI+F+ NGD+F+PG  I +   RY++ + L  +LT  +  +V +P  +R ++    G++I+ + +LE G+ YVC+ N EN+K + Y              N S  P L  L LA         NN +   H           +  RPA      KNG    I    + G + A          P+N+   +    +    V P+++T++RN   K +  +R+LLNKR+  S++ +L+ I   +R    +    + ++F L G  +  + DFF +DD F A G      V+  K
Sbjct:  154 RKAHRIKFYRNGDRFYPGITIPVSNERYRSFESLYEDLTRLLEENVKIPGAVRTIY-DMVGKKITALEELEDGQSYVCSCNNENFKKVDY--------------NTSSQP-LANLTLA---------NNSRTSSHRL--------AKLQRPASP---LKNGVLNSIAPVPVGGGAAA-------NGSPLNTSRFSERDSV----VHPRIVTLIRNG-TKPRRIIRLLLNKRNSPSFDHVLTAITQVVRLDTGY----VRKVFTLSGVSVLQLSDFFGSDDVFFAYGTERVNTVEDFK 398          
BLAST of serine/threonine-protein kinase DCLK1 vs. UniProt/SwissProt
Match: sp|B4IT27|DCLK_DROYA (Serine/threonine-protein kinase GE16371 OS=Drosophila yakuba OX=7245 GN=GE16371 PE=3 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 5.996e-21
Identity = 83/285 (29.12%), Postives = 137/285 (48.07%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAG-NENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNN---NQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            RK LRI+F+ NGD+F+PG  I +   RY++ + L  +LT  +  +V +P  +R ++ +  G++I+ +++LE G+ YVC+  NEN+K + Y                   P   PL    +N  +  N+   NQ+L  H     + A P +     G S L   G       G +     LI  KS    S  V          V P+++T++R S  K +  +R+LLNKR+  S++ +L+ I   +R    +    + ++F L G  +  + DFF +DD F A G
Sbjct:  156 RKALRIKFYRNGDRFYPGVTIPVSNERYRSFERLFEDLTRLLEENVKIPGAVRTIY-NMCGKKITSLDELEDGQSYVCSCNNENFKKVEYN------------------PGSQPL----SNLTLTNNSRPYNQRLAKH-----RPASPLKNGLLVGSSPLAVCG-------GGTGNGSPLIASKS----SDRVTV--------VHPRIVTLIR-SGTKPRRIMRLLLNKRNSPSFDHVLTAITQVVRLDTGY----VRKVFTLSGISVVQLSDFFESDDVFFAYG 388          
BLAST of serine/threonine-protein kinase DCLK1 vs. UniProt/SwissProt
Match: sp|B3NKK1|DCLK_DROER (Serine/threonine-protein kinase GG21441 OS=Drosophila erecta OX=7220 GN=GG21441 PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 3.750e-20
Identity = 79/283 (27.92%), Postives = 135/283 (47.70%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAG-NENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLG-LAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            RK LRI+F+ NGD+F+PG  I +   RY++ + L  +LT  +  +V +P  +R ++ +  G++I+ +++LE G+ YVC+  NEN+K + Y    +                  PL  L  TN +   +NNQ+L    C         R   P     LT  GI      G              P+ +  ++    +    V P+++T++R S  K +  +R+LLNKR+  S++ +L+ I   +R    +    + ++F L G  +  + DFF +DD F A G
Sbjct:  156 RKALRIKFYRNGDRFYPGITIPVSNERYRSFERLYEDLTRLLEENVKIPGAVRTIY-NMCGKKITSLDELEDGQSYVCSCNNENFKKVEYNTGSQ------------------PLSNLTLTNNS--RSNNQRL--AKC---------RPASPLKNGLLT--GISPLPASGGGTG-------NGSPLIASRLSDRVSV----VHPRIVTLIR-SGTKPRRIMRLLLNKRNSPSFDHVLTAITQVVRLDTGY----VRKVFTLSGISVVQLSDFFGSDDVFFAYG 388          
BLAST of serine/threonine-protein kinase DCLK1 vs. UniProt/SwissProt
Match: sp|O43602|DCX_HUMAN (Neuronal migration protein doublecortin OS=Homo sapiens OX=9606 GN=DCX PE=1 SV=4)

HSP 1 Score: 97.0561 bits (240), Expect = 4.976e-20
Identity = 69/281 (24.56%), Postives = 120/281 (42.70%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +K  ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  ++ LP G+R ++T    R+I  +++LE G  YVC+ +  +K + Y K     W                      + NV  + N K                    A QS  + N     A        PKL+                 I+   VKP+               VR+LLNK++  S+E +L+DI  +++     +   + +++ L GK++  + DFF +DD FIA G
Sbjct:   50 KKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNW----------------------SVNVKTSANMK--------------------APQSLASSNSAQ--ARENKDFVRPKLVT----------------IIRSGVKPRKA-------------VRVLLNKKTAHSFEQVLTDITEAIK----LETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG 253          
BLAST of serine/threonine-protein kinase DCLK1 vs. TrEMBL
Match: A0A0B6ZP38 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF70237 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 8.073e-48
Identity = 108/320 (33.75%), Postives = 173/320 (54.06%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQ-NAF-PTRFYRPAGQSYLTKNGIHQFA-----MHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNET-LGVKQIKDILDDLYPDHPQTSHVLKYW 1153
            R+P ++RF+ NGD++F GKKI +  +RY N+++L+++LT K+P ++ LP G+RQ+FT   GR+I DI  L  G  YVCAG E +K I YG+ E++PW                  LA + QN      Q++   + + G  NAF P R++R + QSY  +    ++A     + GAS+A                        +   +PK IT++R S  K +  +++LLN+R++ SYE LL+DI  +       K   + +++   GKE+  V DFFR DD+F+A G +ET +   +I  IL++++PD      +L  W
Sbjct:   37 RRPRKLRFYVNGDRYFRGKKIHVTSNRYSNLNDLLSDLTGKLPSNLNLPYGVRQIFTPGRGRKILDIEDLMDGETYVCAGFEGFKMIKYGRSEREPW-----------------SLAHSQQNPMAEQEQEITGSNRFTGSINAFHPGRYFRTS-QSYPQRRWPDRYAPTPRGIFGASLA------------------------DTVERPKTITIIR-SGVKPRSSIKVLLNRRAIHSYERLLADISEAF--GFKTKSNSVRKLYTAHGKEVLGVSDFFRTDDYFVAFGADETEISEAEIMSILEEIFPDVSIVRTLLVDW 311          
BLAST of serine/threonine-protein kinase DCLK1 vs. TrEMBL
Match: A0A2T7PQW2 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_02783 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 7.834e-47
Identity = 143/436 (32.80%), Postives = 215/436 (49.31%), Query Frame = 2
Query:  269 GKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSC-YAG--QNAF-PTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSL-HGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVXXXXXXXXXXXXXVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKAR 1561
            GKK+ I  H+Y N ++L+N+LT K+P  + LP G+RQ+FT   GRRISDI+ L+ G  YVCAG E +K I YG+ E +PW  G+P        + PL       ++DG    +L   S  Y G   NAF P R+YR  G      N          +  +P        P+ + +           +KPKVIT+VRN  +     V+ILLN+RSVQS+E LL+DI  +       +   + ++F   G+E+K V DFFR +D FIAVG +E L  + + DI+++LYPD      +LK W           D+QR H     L +  +   DKRDSGF +          S+TN N   E      P   +++    K+       V    +++ S  ++         SP ++   + +   +R+R++ +ER+KAR
Sbjct:    8 GKKLYITPHKYYNFNDLLNDLTGKLPSSINLPYGVRQIFTPVGGRRISDIDDLQDGETYVCAGFEGFKTIKYGRTELEPWSVGKP--------MRPL------NSLDGELGAELSYGSYKYRGYVANAFHPGRYYRGNGN---PPNRRWPGGFASTNQRFP--AGLLGGPMEAGH-----------LKPKVITIVRNGSQPLSN-VKILLNRRSVQSFEQLLADINEAFGSKW--RKNRVCKMFTTHGREVKGVADFFREEDCFIAVG-SEGLSERDVADIIEELYPDSAYAKVLLKDW-----------DKQRRHNNKGGLTNRESEQGDKRDSGFVD---------GSDTNSNSHREQDYASPPAPRQSRLRRSKRAAAAALMVSAEPDSSASFEAI---------SPHNDHHFLNKIEKERLRVSNDERDKAR 380          
BLAST of serine/threonine-protein kinase DCLK1 vs. TrEMBL
Match: A0A267GXX3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006197g1 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 5.579e-45
Identity = 107/321 (33.33%), Postives = 169/321 (52.65%), Query Frame = 2
Query:  230 RIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAF-PTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSK----------------NVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHV 1141
            RI  F NGD FF GKK+SI  +RY + ++L+ +LT +MP ++YLPNG+RQLF+ S+GRR+  I+ L  G  YVCAGNE +K + YG  E  PW KG                A ++ N D  +       S +AG NAF P+RF +         +G  Q          P+ ++ K  P +S+                  +    I     +PKVITV+++  ++ +  V+ILLN+R VQS++ LL+DI  S             R++++ G++++ VGD FR+++ F+     E + + ++ D+LD+LYP  P++S  
Sbjct:   31 RIVIFCNGDIFFKGKKVSITPNRYVSYNDLLQDLTYRMPQNLYLPNGVRQLFSPSSGRRLGSISDLRDGGAYVCAGNETFKPVKYGAAELLPWGKG----------------AQSSGNFD--SAIYTGSSSQFAGYNAFPPSRFLK------RQHHGQQQ----------PQALQLKHPPESSRFAALRGSRGHEAGSGAGADASAGIGGAPRQPKVITVIKDG-QRPRQVVKILLNRRGVQSFQQLLADISDSFGGGRRGGRL--RRLWSIAGRDVRDVGDLFRDEEIFVGSSGEEAMTLDRVSDLLDELYPGTPKSSRC 314          
BLAST of serine/threonine-protein kinase DCLK1 vs. TrEMBL
Match: A0A1S3IYX7 (trichohyalin OS=Lingula unguis OX=7574 GN=LOC106168775 PE=4 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 5.420e-43
Identity = 112/315 (35.56%), Postives = 157/315 (49.84%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVD---GNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYW 1153
            R+P +IRFF+NGD+FF GKK+ I  +RY    +L+++LT K+P    LP G+RQ+FT   G++I DI  L+ G  YVC G E +K + YGK +   W  GR                A  QN+    G +N  +  H  +      P R      Q+Y           +GA   Y            ++     Q   N  +KPKVITVVR  P   +  VRILLN+RSVQSYE L+ DI  S       + Q I ++++L GKE+  V DFFR+DD FIA    E + +   +DI+++ Y D      +L  W
Sbjct:   35 RRPRKIRFFSNGDRFFKGKKVYITPNRYVTFQDLLDDLTKKLPTLTSLPYGVRQIFTPGGGKKIRDIEDLKDGESYVCGGFETFKPMKYGKEDLKTWHSGR--------------TQAKEQNIYSHFGYDNPGVYSHGAFQ-----PNRLR----QTYPRGRVGPPPVGYGAQGGY------------ARPSYLLQSHDNVPMKPKVITVVRYGPPGPRTTVRILLNRRSVQSYEQLMGDIAESFGSRW--RGQRIVKLYSLRGKEVNGVSDFFRDDDVFIATS-QEMIPLSDAQDIIEEYYNDRQSVQDLLAGW 311          
BLAST of serine/threonine-protein kinase DCLK1 vs. TrEMBL
Match: A0A267FFZ5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021886g2 PE=4 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.988e-42
Identity = 113/365 (30.96%), Postives = 187/365 (51.23%), Query Frame = 2
Query:  230 RIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAF-PTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGST--------------MSVDKRDSGFEEQNF 1279
            RI  F NGD FF GKK+SI  HRY + ++L+ +LT +MP H++LPNG+RQLF+ ++GRR++D+  L+ G  YVCAGNE +K ++YG  E  PW +GR  + +                            S +AG NAF P+R+ +        + G  Q +         K     S     +     Q     Q +P+++T+V+  P + +  V++LLN+R +QS+  LLSDI  S       + + + +IF + G+EI+ VGD FR+DD F+   ++  + + Q++D+L++LYP +P    +L  W  +       + + + H +   LH                 ++ D+RDSG++E + 
Sbjct:   40 RIIVFCNGDIFFKGKKVSITPHRYLSYNDLLQDLTARMPQHLHLPNGVRQLFSPTSGRRLADVADLKDGGVYVCAGNETFKPVTYGATEVTPWARGRRDSQASQ--------KQQPWLQRPQPPPPPQPQSLFAGYNAFPPSRYLK-------HQRGKQQQSAQQLQQQQQKQKPSLSLARRLQPQQQQQQQQPVQRQPRLVTIVKEGP-RPRQVVKMLLNRRGIQSFAQLLSDISDSFGGS-RGRRERLKKIFTIAGREIRDVGDLFRDDDLFVGCVED-AIEIAQVEDLLEELYPGNPGVRDLLNDWERRLKRRQMRRQQMQQHRQQPRLHQQKQQQQQQKQPQQQQRLATDERDSGYDESDL 386          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Cavefish
Match: ENSAMXT00000018326.2 (doublecortin [Source:NCBI gene;Acc:103035707])

HSP 1 Score: 110.538 bits (275), Expect = 1.299e-25
Identity = 74/281 (26.33%), Postives = 125/281 (44.48%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +K  ++RF+ NGD++F G   ++   R++  D L+ +LT  +  H+ LP G+R +FT     +I+ +++LE G  YVCA    YK + Y K                              NV  N N  ++  +C   +NA      RP  +    K+ +                                       +PK++TV+R+  +  K  VR+LLNK++  S+E +L+DI  +++  L   +  + RI+ L GK++  + DFF +DD FIA G
Sbjct:   50 KKAKKVRFYRNGDRYFKGIVYAVANDRFRTFDALLADLTRSLSDHINLPQGVRFIFTIDGAHKITSLDELEEGESYVCASENYYKKVDYTK------------------------------NV--NPNWSVNVKACAGQRNAMCVSGGRPGAEPRENKDFV---------------------------------------RPKLVTVMRSGVKPRKA-VRVLLNKKTAHSFEQVLTDITEAIK--LESGV--VKRIYTLDGKQVTCLQDFFGDDDVFIACG 254          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Cavefish
Match: ENSAMXT00000045750.1 (doublecortin [Source:NCBI gene;Acc:103035707])

HSP 1 Score: 102.834 bits (255), Expect = 7.584e-22
Identity = 73/282 (25.89%), Postives = 122/282 (43.26%), Query Frame = 2
Query:  230 RIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQG--IGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNE 1069
            ++RF+ NGD++F G   ++   R++  D L+ +LT  +  H+ LP G+R +FT     +I+ +++LE G  YVCA    YK + Y K                              NV  N N  ++  +C   +NA      RP  +    K+ +            PKL+                 ++   VKP             +  VR+LLNK++  S+E +L+DI  ++      K++   + RI+ L GK++  + DFF +DD FIA G  +
Sbjct:   54 KVRFYRNGDRYFKGIVYAVANDRFRTFDALLADLTRSLSDHINLPQGVRFIFTIDGAHKITSLDELEEGESYVCASENYYKKVDYTK------------------------------NV--NPNWSVNVKACAGQRNAMCVSGGRPGAEPRENKDFV-----------RPKLV----------------TVMRSGVKP-------------RKAVRVLLNKKTAHSFEQVLTDITEAI------KLESGVVKRIYTLDGKQVTCLQDFFGDDDVFIACGPEK 257          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Cavefish
Match: ENSAMXT00000055723.1 (doublecortin [Source:NCBI gene;Acc:103035707])

HSP 1 Score: 102.834 bits (255), Expect = 7.584e-22
Identity = 73/282 (25.89%), Postives = 122/282 (43.26%), Query Frame = 2
Query:  230 RIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQG--IGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNE 1069
            ++RF+ NGD++F G   ++   R++  D L+ +LT  +  H+ LP G+R +FT     +I+ +++LE G  YVCA    YK + Y K                              NV  N N  ++  +C   +NA      RP  +    K+ +            PKL+                 ++   VKP             +  VR+LLNK++  S+E +L+DI  ++      K++   + RI+ L GK++  + DFF +DD FIA G  +
Sbjct:   54 KVRFYRNGDRYFKGIVYAVANDRFRTFDALLADLTRSLSDHINLPQGVRFIFTIDGAHKITSLDELEEGESYVCASENYYKKVDYTK------------------------------NV--NPNWSVNVKACAGQRNAMCVSGGRPGAEPRENKDFV-----------RPKLV----------------TVMRSGVKP-------------RKAVRVLLNKKTAHSFEQVLTDITEAI------KLESGVVKRIYTLDGKQVTCLQDFFGDDDVFIACGPEK 257          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Cavefish
Match: ENSAMXT00000031379.1 (doublecortin [Source:NCBI gene;Acc:103035707])

HSP 1 Score: 102.834 bits (255), Expect = 7.584e-22
Identity = 73/282 (25.89%), Postives = 122/282 (43.26%), Query Frame = 2
Query:  230 RIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQG--IGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNE 1069
            ++RF+ NGD++F G   ++   R++  D L+ +LT  +  H+ LP G+R +FT     +I+ +++LE G  YVCA    YK + Y K                              NV  N N  ++  +C   +NA      RP  +    K+ +            PKL+                 ++   VKP             +  VR+LLNK++  S+E +L+DI  ++      K++   + RI+ L GK++  + DFF +DD FIA G  +
Sbjct:   54 KVRFYRNGDRYFKGIVYAVANDRFRTFDALLADLTRSLSDHINLPQGVRFIFTIDGAHKITSLDELEEGESYVCASENYYKKVDYTK------------------------------NV--NPNWSVNVKACAGQRNAMCVSGGRPGAEPRENKDFV-----------RPKLV----------------TVMRSGVKP-------------RKAVRVLLNKKTAHSFEQVLTDITEAI------KLESGVVKRIYTLDGKQVTCLQDFFGDDDVFIACGPEK 257          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Cavefish
Match: ENSAMXT00000043405.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:8818577:8831816:1 gene:ENSAMXG00000040052.1 transcript:ENSAMXT00000043405.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 3.246e-16
Identity = 32/87 (36.78%), Postives = 57/87 (65.52%), Query Frame = 2
Query:  230 RIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGK 490
            ++RF+ NGD++F G   ++   R++++D L+ ELT  +   ++LP G+R ++T    ++IS +++L  G  YVCA NE+YK + Y K
Sbjct:   76 KVRFYRNGDRYFTGLLYAVSADRFRSLDTLLAELTRSLADSLHLPQGVRAIYTVDGAKKISSLDELVEGESYVCASNESYKKVDYTK 162          

HSP 2 Score: 63.1586 bits (152), Expect = 1.417e-9
Identity = 31/82 (37.80%), Postives = 54/82 (65.85%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +KPK++TV+R+  +  K  VRILLNK++  S++ +L+DI  +++         + +++ L GK++ S+ DFF +DD FIA G
Sbjct:  194 IKPKLVTVIRSGVKPRKA-VRILLNKKTAHSFDQVLADITEAIK----LDSGAVKKLYTLDGKQLTSLQDFFGDDDVFIACG 270          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007117.1 (pep scaffold:Pmarinus_7.0:GL477366:363732:368225:-1 gene:ENSPMAG00000006438.1 transcript:ENSPMAT00000007117.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 1.388e-16
Identity = 34/110 (30.91%), Postives = 63/110 (57.27%), Query Frame = 2
Query:  179 YKSNSEKSVHLHGRKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPW 508
            Y++ + +++    R   ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  +V LP G+R ++T    RR+  +++L  G  YVCA NE Y+ + Y K     W
Sbjct:   42 YRTRTLRALSTEKRAK-KVRFYRNGDRYFRGIVYAVSPDRFRSFDALLEDLTRTLTDNVNLPQGVRAIYTCDGSRRMLTLDELVEGESYVCASNEPYRRLDYTKTLNPNW 150          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007114.1 (pep scaffold:Pmarinus_7.0:GL477366:299514:356138:-1 gene:ENSPMAG00000006368.1 transcript:ENSPMAT00000007114.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 7.988e-15
Identity = 32/93 (34.41%), Postives = 55/93 (59.14%), Query Frame = 2
Query:  230 RIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPW 508
            ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  +V LP G+R ++T    RR+  +++L  G  YVCA NE Y+ + Y K     W
Sbjct:   62 KVRFYRNGDRYFRGIVYAVSPDRFRSFDALLEDLTRTLTDNVNLPQGVRAIYTCDGSRRMLTLDELVEGESYVCASNEPYRRLDYTKTLNPNW 154          

HSP 2 Score: 62.7734 bits (151), Expect = 3.705e-10
Identity = 31/82 (37.80%), Postives = 52/82 (63.41%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            ++PK++TV+R+  +  K  VRILLNK++  S++ +L+DI     D +      + R++ L GK++  + DFF +DD FIA G
Sbjct:  189 IRPKLVTVIRSGVKPRKA-VRILLNKKTAHSFDQVLTDIT----DAIKLDTGVVKRLYTLDGKQVTCLQDFFGDDDVFIACG 265          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010548.1 (pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-1 gene:ENSPMAG00000009555.1 transcript:ENSPMAT00000010548.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 3.641e-11
Identity = 30/88 (34.09%), Postives = 53/88 (60.23%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRIS-DINQLESGRDYVCAGNENYKNI 478
            R+P  +RF+ NGD++F  + + I  HRY +  EL+ +L+  +P    LP G+R+L+T   G  ++  ++ L  G  YVCA  E ++++
Sbjct:    1 RRPKVVRFYRNGDRYFRARTLHITPHRYVSWPELLADLSRAVP----LPYGVRRLYTPLGGSPVAGSVDALRDGEAYVCASFEPFRSV 84          

HSP 2 Score: 61.6178 bits (148), Expect = 7.463e-10
Identity = 36/84 (42.86%), Postives = 51/84 (60.71%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSL---RDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAV 1057
             +PKVITVVR      +  + +LLN+R+ QS+E LL DI  +L   R   +H    + R++ L G+E +SV DFFR DD F+A 
Sbjct:  126 ARPKVITVVRVGGRGPRRRITLLLNRRAAQSFEELLGDISEALGLPRWRTNH----VRRLYTLRGREARSVSDFFRGDDVFLAA 205          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009748.1 (pep scaffold:Pmarinus_7.0:GL478245:10970:15566:-1 gene:ENSPMAG00000008812.1 transcript:ENSPMAT00000009748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 6.718e-9
Identity = 29/95 (30.53%), Postives = 50/95 (52.63%), Query Frame = 2
Query:  230 RIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEK--DPW 508
            R+ F+ +GD  F G K++I+   ++  D L++ L+ +MP    LP G+R + T      + D+ QLE G+ YVC+     K +   +  +   PW
Sbjct:   43 RVYFYKSGDPQFGGLKVAINNRTFKTFDALLDNLSRRMP----LPFGVRTVSTPRGLHAVRDLEQLEDGKAYVCSDRRRAKPLDLEQASRRPQPW 133          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Nematostella
Match: EDO44490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP9])

HSP 1 Score: 65.855 bits (159), Expect = 3.494e-12
Identity = 32/103 (31.07%), Postives = 54/103 (52.43%), Query Frame = 2
Query:  230 RIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWF-----KGRP 523
            +I F+ NGD+FF G K+++   RY+  D L+ EL+ K+         +R +F S  G  + D+ +L+ G  YVC+ + +++ I  G     P +     KG P
Sbjct:    3 QIMFYRNGDRFFSGLKLAVSSERYKEFDSLLTELSAKIDLQT---GAVRYIFNSETGNEVQDVTELQYGVSYVCSSSNHFQRIEGGYRNNQPQWALTSAKGNP 102          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Nematostella
Match: EDO42432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C2])

HSP 1 Score: 58.9214 bits (141), Expect = 7.749e-9
Identity = 31/86 (36.05%), Postives = 49/86 (56.98%), Query Frame = 2
Query:  239 FFANGDKF--FPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGK 490
            F+ NGD F  +P   ++I   +Y++ D L+ EL+ K      LP G+R L     G ++ +I  L+ G++YVCA N   K ++YGK
Sbjct:   10 FYKNGDVFSKYP---VTITPRKYRSFDILLAELSMK----TELPQGVRYLLDKENGAQVKNIEDLQDGKEYVCASNARLKRLAYGK 88          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Nematostella
Match: EDO26163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCQ2])

HSP 1 Score: 50.0618 bits (118), Expect = 9.565e-8
Identity = 24/82 (29.27%), Postives = 45/82 (54.88%), Query Frame = 2
Query:  233 IRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNI 478
            +  + NG+  FPGKK+ ++  + +N+D  ++++T +M     L    R L T + G +I  + ++E G  YV  G E +K +
Sbjct:    6 VTIYKNGEPKFPGKKVVVNPRQVRNMDACLDKITREMK----LKTAARSLKTPTGGHKIDKLEKIEPGGQYVVCGLEAFKRL 83          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Nematostella
Match: EDO46255 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ95])

HSP 1 Score: 54.299 bits (129), Expect = 1.708e-7
Identity = 25/88 (28.41%), Postives = 50/88 (56.82%), Query Frame = 2
Query:  233 IRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLE 496
            +  + NG+  FPGKK+ ++  + +N+D  ++++T +M     L    R L T + G +I  + ++E G  YV  G E +K ++Y +++
Sbjct:    6 VTIYKNGEPKFPGKKVVVNPRQVRNMDACLDKITREM----KLKTAARSLKTPTGGHKIDKLEKIEPGGQYVVCGLEAFKRLNYMEIK 89          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Medaka
Match: ENSORLT00000033772.1 (doublecortin [Source:NCBI gene;Acc:101157476])

HSP 1 Score: 81.2629 bits (199), Expect = 8.244e-16
Identity = 34/91 (37.36%), Postives = 56/91 (61.54%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGK 490
            +K  ++RF+ NGD++F G   ++   R+++ D L+ +LT  +  H+ LP G+R +FT    R+IS +++LE G  YVCA    YK + Y K
Sbjct:   50 KKAKKVRFYRNGDRYFKGIVYAVASDRFRSFDSLLADLTRSLSDHINLPQGVRFIFTIDGSRKISTLDELEEGESYVCASENFYKKVDYTK 140          

HSP 2 Score: 65.4698 bits (158), Expect = 1.120e-10
Identity = 32/82 (39.02%), Postives = 54/82 (65.85%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            V+PK++TV+R+  +  K  VR+LLNK++  S+E +L+DI  +++     +   + RI+ L GK++  + DFF +DD FIA G
Sbjct:  177 VRPKLVTVMRSGVKPRKA-VRVLLNKKTAHSFEQVLTDITEAIK----LESGAVKRIYTLDGKQVTCLQDFFGDDDVFIACG 253          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Medaka
Match: ENSORLT00000003850.2 (serine/threonine-protein kinase DCLK2 [Source:NCBI gene;Acc:101173659])

HSP 1 Score: 79.7221 bits (195), Expect = 1.016e-14
Identity = 30/97 (30.93%), Postives = 60/97 (61.86%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPW 508
            R+  ++RF+ NGD++F G   ++   R+++ D L+ ELT  +  +++LP G+R ++T    ++I+ +++L  G  YVCA N+ ++ + Y K+    W
Sbjct:   72 RRAKKVRFYRNGDRYFKGLVYAVSSDRFRSYDALLMELTRSLADNLHLPQGVRSIYTIDGSKKITSMDELVEGECYVCASNQPFRKVDYTKISVPSW 168          

HSP 2 Score: 61.6178 bits (148), Expect = 3.780e-9
Identity = 29/82 (35.37%), Postives = 53/82 (64.63%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +KPK++TV+R+  +  K  VR+LLNK++  S++ +L+DI  +++         + R++ L GK++  + DFF +DD F+A G
Sbjct:  216 IKPKLVTVIRSGVKPRKA-VRVLLNKKTAHSFDQVLADITEAIK----LDSGAVKRLYTLDGKQLTCLQDFFGDDDVFMACG 292          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Medaka
Match: ENSORLT00000031333.1 (serine/threonine-protein kinase DCLK2 [Source:NCBI gene;Acc:101173659])

HSP 1 Score: 79.7221 bits (195), Expect = 1.016e-14
Identity = 30/97 (30.93%), Postives = 60/97 (61.86%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPW 508
            R+  ++RF+ NGD++F G   ++   R+++ D L+ ELT  +  +++LP G+R ++T    ++I+ +++L  G  YVCA N+ ++ + Y K+    W
Sbjct:   72 RRAKKVRFYRNGDRYFKGLVYAVSSDRFRSYDALLMELTRSLADNLHLPQGVRSIYTIDGSKKITSMDELVEGECYVCASNQPFRKVDYTKISVPSW 168          

HSP 2 Score: 61.6178 bits (148), Expect = 3.780e-9
Identity = 29/82 (35.37%), Postives = 53/82 (64.63%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +KPK++TV+R+  +  K  VR+LLNK++  S++ +L+DI  +++         + R++ L GK++  + DFF +DD F+A G
Sbjct:  216 IKPKLVTVIRSGVKPRKA-VRVLLNKKTAHSFDQVLADITEAIK----LDSGAVKRLYTLDGKQLTCLQDFFGDDDVFMACG 292          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Medaka
Match: dclk1a (serine/threonine-protein kinase DCLK1 [Source:NCBI gene;Acc:101167140])

HSP 1 Score: 77.0258 bits (188), Expect = 2.035e-14
Identity = 35/111 (31.53%), Postives = 62/111 (55.86%), Query Frame = 2
Query:  176 VYKSNSEKSVHLHGRKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPW 508
            +Y++ + K++    R   ++RF+ NGD++F G   +I   R++  D L+ +LT  +  +V LP G+R ++     ++IS ++QL  G  YVC+  E YK + Y K     W
Sbjct:   34 LYRTRTLKTLSAEKRAK-KVRFYRNGDRYFNGIVYAISADRFRTFDALLADLTRSLSDNVNLPQGVRTIYALDGSKKISSVDQLVEGGSYVCSSTEAYKKLDYTKNVNPNW 143          

HSP 2 Score: 62.3882 bits (150), Expect = 9.636e-10
Identity = 33/82 (40.24%), Postives = 51/82 (62.20%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            ++PK++TVVR S  K +  VRILLNK++  SYE +L+DI     D +      + +I+ L GK +  + DFF ++D F+A G
Sbjct:  177 IRPKLVTVVR-SGVKPRKAVRILLNKKTAHSYEQVLTDIT----DAIKLDSGVVKKIYTLEGKLVSCLQDFFGDEDIFVACG 253          
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Medaka
Match: DCLK2 (doublecortin like kinase 2 [Source:NCBI gene;Acc:101175053])

HSP 1 Score: 78.5666 bits (192), Expect = 2.341e-14
Identity = 33/100 (33.00%), Postives = 60/100 (60.00%), Query Frame = 2
Query:  218 RKPLRIRFFANGDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKG 517
            +K  ++RF+ NGD++F G   ++   R++++D L+ ELT  +  +V LP G+R L+T    R+++ +++L  G  YVCA NE ++ + Y +     W  G
Sbjct:   64 KKARKVRFYRNGDRYFKGLVYAVSSDRFRSLDALLMELTRSLSDNVNLPQGVRTLYTLDGSRKVTGLDELVEGESYVCASNEPFRRVDYSRNVNPNWSLG 163          

HSP 2 Score: 66.6254 bits (161), Expect = 1.315e-10
Identity = 35/82 (42.68%), Postives = 51/82 (62.20%), Query Frame = 2
Query:  815 VKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVG 1060
            +KPK++TV+R+   K +  VRILLNK++  S E +L+DI     D +      + R++ L GK+I S+ DFF  DD FIA G
Sbjct:  190 IKPKLVTVIRSG-VKPRKAVRILLNKKTAHSLEQVLADIT----DAIKLDSGAVRRLYTLEGKQITSLQDFFGEDDVFIACG 266          
BLAST of serine/threonine-protein kinase DCLK1 vs. Planmine SMEST
Match: SMESG000078466.1 (SMESG000078466.1)

HSP 1 Score: 1268.06 bits (3280), Expect = 0.000e+0
Identity = 677/677 (100.00%), Postives = 677/677 (100.00%), Query Frame = 2
Query:  341 MPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVXXXXXXXXXXXXXVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIXXXXXXXXXXXXXXXSVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEKPVLXXXXXXXXXXXXXXXXXXXXXXXETKEIKDLPAIDLPANKIFAISQNDNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMTSETNHFLTEQSKTSKVENDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNVLADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDSEIQIKSD 2371
            MPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVSLPKPKLSKTKPSVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIQIQEQLKLERKKLEESVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEKPVLNFSTSINNIDNSSISFSSSINDIETKEIKDLPAIDLPANKIFAISQNDNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMTSETNHFLTEQSKTSKVENDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNVLADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDSEIQIKSD
Sbjct:    1 MPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVSLPKPKLSKTKPSVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIQIQEQLKLERKKLEESVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEKPVLNFSTSINNIDNSSISFSSSINDIETKEIKDLPAIDLPANKIFAISQNDNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMTSETNHFLTEQSKTSKVENDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNVLADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDSEIQIKSD 677          
BLAST of serine/threonine-protein kinase DCLK1 vs. Planmine SMEST
Match: SMESG000078466.1 (SMESG000078466.1)

HSP 1 Score: 1239.56 bits (3206), Expect = 0.000e+0
Identity = 667/684 (97.51%), Postives = 668/684 (97.66%), Query Frame = 2
Query:  320 MNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVXXXXXXXXXXXXXVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIXXXXXXXXXXXXXXXSVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEKPVLXXXXXXXXXXXXXXXXXXXXXXXETKEIKDLPAIDLPANKIFAISQNDNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMTSETNHFLTEQSKTSKVENDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNVLADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDSEIQIKSD 2371
            MNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVSLPKPKLSKTKPSVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIQIQEQLKLERKKLEESVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEKPVLNFSTSINNIDNSSISFSSSINDIETKEIKDLPAIDLPANKIFAISQNDNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMT                +NDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNVLADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDSEIQIKSD
Sbjct:    1 MNELTNKMPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVSLPKPKLSKTKPSVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIQIQEQLKLERKKLEESVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEKPVLNFSTSINNIDNSSISFSSSINDIETKEIKDLPAIDLPANKIFAISQNDNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMT----------------KNDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNVLADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDSEIQIKSD 668          
BLAST of serine/threonine-protein kinase DCLK1 vs. Planmine SMEST
Match: SMESG000078466.1 (SMESG000078466.1)

HSP 1 Score: 1224.92 bits (3168), Expect = 0.000e+0
Identity = 660/677 (97.49%), Postives = 661/677 (97.64%), Query Frame = 2
Query:  341 MPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVXXXXXXXXXXXXXVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIXXXXXXXXXXXXXXXSVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEKPVLXXXXXXXXXXXXXXXXXXXXXXXETKEIKDLPAIDLPANKIFAISQNDNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMTSETNHFLTEQSKTSKVENDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNVLADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDSEIQIKSD 2371
            MPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVSLPKPKLSKTKPSVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIQIQEQLKLERKKLEESVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEKPVLNFSTSINNIDNSSISFSSSINDIETKEIKDLPAIDLPANKIFAISQNDNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMT                +NDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNVLADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDSEIQIKSD
Sbjct:    1 MPPHVYLPNGIRQLFTSSAGRRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVSLPKPKLSKTKPSVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIQIQEQLKLERKKLEESVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEKPVLNFSTSINNIDNSSISFSSSINDIETKEIKDLPAIDLPANKIFAISQNDNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMT----------------KNDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNVLADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDSEIQIKSD 661          
BLAST of serine/threonine-protein kinase DCLK1 vs. Planmine SMEST
Match: SMESG000078466.1 (SMESG000078466.1)

HSP 1 Score: 1138.25 bits (2943), Expect = 0.000e+0
Identity = 618/618 (100.00%), Postives = 618/618 (100.00%), Query Frame = 2
Query:  518 RPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVXXXXXXXXXXXXXVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIXXXXXXXXXXXXXXXSVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEKPVLXXXXXXXXXXXXXXXXXXXXXXXETKEIKDLPAIDLPANKIFAISQNDNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMTSETNHFLTEQSKTSKVENDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNVLADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDSEIQIKSD 2371
            RPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVSLPKPKLSKTKPSVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIQIQEQLKLERKKLEESVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEKPVLNFSTSINNIDNSSISFSSSINDIETKEIKDLPAIDLPANKIFAISQNDNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMTSETNHFLTEQSKTSKVENDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNVLADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDSEIQIKSD
Sbjct:   34 RPHNFSRYPHLLPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGIHQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNSPEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFGKEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKYWTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFNSNTNVNDSSETVSLPKPKLSKTKPSVRKKNQKIQQNVPNIQNTTESISSLDLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIQIQEQLKLERKKLEESVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEKPVLNFSTSINNIDNSSISFSSSINDIETKEIKDLPAIDLPANKIFAISQNDNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMTSETNHFLTEQSKTSKVENDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNVLADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDSEIQIKSD 651          
BLAST of serine/threonine-protein kinase DCLK1 vs. Planmine SMEST
Match: SMESG000079382.1 (SMESG000079382.1)

HSP 1 Score: 192.971 bits (489), Expect = 4.241e-55
Identity = 113/278 (40.65%), Postives = 165/278 (59.35%), Query Frame = 3
Query: 2526 VYNCADDSKMMNSKFRNIASMKGYAYHVTNVDCCGKTDENILKIDWDKNLAKINVELDPGETPAKDEGNPREPLISGELQINDTENNSMKDVENRTDQIQKKTV-----LKAFEIKETSRN---QVVKGVFLSTDLHHEQLPDRTVYPLDKLDYPVDHFYQRISIKFEEISEKYPKCQFWYLRNYQIHYICYDEDGKIENIKR-------INLPDDFQLYNNIGESEISKLNIRKEGATKEILPLLQNNHSKGDYFCTILVLGDVEISQNAKIDIVQK 3314
            +Y+C  D  M +  FRN     GYAYHVTN+DCCG+T  N+ KI+W +N     VE               + ++SGE Q N     + +D+    DQ+    +     L+ FEI++++ +   + V+GVF++T L+   LPD TVYP  K    VDH+YQRISIKF++ISEKYP+C+FW +++ Q HYICY  + KI+N  +       I   +DFQ      +SE+  + I+KEGATK+ILP LQN++ K +YF  +++LG +EI  +A IDI  K
Sbjct:    4 IYHCIKDKNMED--FRNKDPANGYAYHVTNIDCCGRTKLNMKKINWIRNRVDERVE-------------SIKSILSGESQPNQPNQPNQQDMTGLADQLAAINLNEDLELRPFEIRKSNYHPAVEGVEGVFMNTTLYDGHLPDWTVYPFGKPQCQVDHYYQRISIKFDKISEKYPQCKFWCIKDKQRHYICYKSESKIKNFNKTKSATAGIKFSEDFQ------DSELEVMGIKKEGATKDILPYLQNDYKKEEYFNNLVLLGGIEILGDAIIDIAHK 260          
The following BLAST results are available for this feature:
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DCX8.730e-2124.56doublecortin [Source:HGNC Symbol;Acc:HGNC:2714][more]
DCX8.730e-2124.56doublecortin [Source:HGNC Symbol;Acc:HGNC:2714][more]
DCX8.730e-2124.56doublecortin [Source:HGNC Symbol;Acc:HGNC:2714][more]
DCX9.273e-2124.56doublecortin [Source:HGNC Symbol;Acc:HGNC:2714][more]
DCX1.036e-2024.56doublecortin [Source:HGNC Symbol;Acc:HGNC:2714][more]
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zyg-87.464e-1922.79Serine/threonine-protein kinase zyg-8 [Source:Uni... [more]
zyg-88.954e-1922.79Serine/threonine-protein kinase zyg-8 [Source:Uni... [more]
W07G1.19.895e-731.40pep chromosome:WBcel235:II:13937995:13939631:-1 ge... [more]
F27C1.137.155e-626.97pep chromosome:WBcel235:I:5443878:5446855:-1 gene:... [more]
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG175288.173e-2026.60gene:FBgn0261387 transcript:FBtr0111274[more]
CG175288.173e-2026.60gene:FBgn0261387 transcript:FBtr0111277[more]
DCX-EMAP7.152e-637.78gene:FBgn0259099 transcript:FBtr0331181[more]
DCX-EMAP7.398e-637.78gene:FBgn0259099 transcript:FBtr0299509[more]
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dclk2b6.714e-1825.10doublecortin-like kinase 2b [Source:ZFIN;Acc:ZDB-G... [more]
dclk31.775e-1536.84doublecortin-like kinase 3 [Source:ZFIN;Acc:ZDB-GE... [more]
dclk2a4.207e-1536.26doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
dclk2a4.586e-1536.26doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
dclk2a4.639e-1535.05doublecortin-like kinase 2a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ovch11.581e-1542.86ovochymase 1 [Source:Xenbase;Acc:XB-GENE-6449526][more]
DCLK23.711e-1534.02doublecortin like kinase 2 [Source:NCBI gene;Acc:1... [more]
DCLK23.858e-1534.02doublecortin like kinase 2 [Source:NCBI gene;Acc:1... [more]
DCLK23.941e-1534.02doublecortin like kinase 2 [Source:NCBI gene;Acc:1... [more]
DCLK24.003e-1534.02doublecortin like kinase 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dcx6.697e-2124.56doublecortin [Source:MGI Symbol;Acc:MGI:1277171][more]
Dcx6.920e-2124.56doublecortin [Source:MGI Symbol;Acc:MGI:1277171][more]
Dcx7.623e-2124.56doublecortin [Source:MGI Symbol;Acc:MGI:1277171][more]
Dcx7.623e-2124.56doublecortin [Source:MGI Symbol;Acc:MGI:1277171][more]
Dclk33.559e-1443.56doublecortin-like kinase 3 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4GXC2|DCLK_DROPE1.513e-2128.32Serine/threonine-protein kinase GL21140 OS=Drosoph... [more]
sp|B5DK35|DCLK_DROPS1.663e-2127.95Serine/threonine-protein kinase GA29083 OS=Drosoph... [more]
sp|B4IT27|DCLK_DROYA5.996e-2129.12Serine/threonine-protein kinase GE16371 OS=Drosoph... [more]
sp|B3NKK1|DCLK_DROER3.750e-2027.92Serine/threonine-protein kinase GG21441 OS=Drosoph... [more]
sp|O43602|DCX_HUMAN4.976e-2024.56Neuronal migration protein doublecortin OS=Homo sa... [more]
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B6ZP388.073e-4833.75Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A2T7PQW27.834e-4732.80Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A267GXX35.579e-4533.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3IYX75.420e-4335.56trichohyalin OS=Lingula unguis OX=7574 GN=LOC10616... [more]
A0A267FFZ51.988e-4230.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000018326.21.299e-2526.33doublecortin [Source:NCBI gene;Acc:103035707][more]
ENSAMXT00000045750.17.584e-2225.89doublecortin [Source:NCBI gene;Acc:103035707][more]
ENSAMXT00000055723.17.584e-2225.89doublecortin [Source:NCBI gene;Acc:103035707][more]
ENSAMXT00000031379.17.584e-2225.89doublecortin [Source:NCBI gene;Acc:103035707][more]
ENSAMXT00000043405.13.246e-1636.78pep primary_assembly:Astyanax_mexicanus-2.0:15:881... [more]
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000007117.11.388e-1630.91pep scaffold:Pmarinus_7.0:GL477366:363732:368225:-... [more]
ENSPMAT00000007114.17.988e-1534.41pep scaffold:Pmarinus_7.0:GL477366:299514:356138:-... [more]
ENSPMAT00000010548.13.641e-1134.09pep scaffold:Pmarinus_7.0:GL477749:266235:284843:-... [more]
ENSPMAT00000009748.16.718e-930.53pep scaffold:Pmarinus_7.0:GL478245:10970:15566:-1 ... [more]
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO444903.494e-1231.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424327.749e-936.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261639.565e-829.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO462551.708e-728.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033772.18.244e-1637.36doublecortin [Source:NCBI gene;Acc:101157476][more]
ENSORLT00000003850.21.016e-1430.93serine/threonine-protein kinase DCLK2 [Source:NCBI... [more]
ENSORLT00000031333.11.016e-1430.93serine/threonine-protein kinase DCLK2 [Source:NCBI... [more]
dclk1a2.035e-1431.53serine/threonine-protein kinase DCLK1 [Source:NCBI... [more]
DCLK22.341e-1433.00doublecortin like kinase 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of serine/threonine-protein kinase DCLK1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078466.10.000e+0100.00SMESG000078466.1[more]
SMESG000078466.10.000e+097.51SMESG000078466.1[more]
SMESG000078466.10.000e+097.49SMESG000078466.1[more]
SMESG000078466.10.000e+0100.00SMESG000078466.1[more]
SMESG000079382.14.241e-5540.65SMESG000079382.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012858 ID=SMED30012858|Name=serine/threonine-protein kinase DCLK1|organism=Schmidtea mediterranea sexual|type=transcript|length=3457bp
CTTTTTGAAATAAAGAATTTCATTTAATAAAGCATTTTGCCAAATCATAA
CTTTAAAATTTGAAACATTTTCGTAAAAGTATGAAATTTCTTTACTTCAA
ATGAATCTTGCTGTGACTGAAAAGTTAAACCTCAACGGAATCAAAAATAT
CAATGACATTGATTTTCAAGATGGTGTTTATAAATCGAATTCGGAAAAAA
GCGTCCATCTTCATGGAAGGAAACCGTTAAGAATTAGGTTTTTTGCTAAC
GGAGATAAATTTTTTCCTGGCAAAAAAATTTCAATTCATTTGCACAGGTA
TCAAAATATCGACGAGTTAATGAATGAATTGACAAACAAAATGCCACCTC
ATGTTTACCTTCCAAATGGAATACGACAATTATTTACGTCTTCTGCAGGT
AGAAGAATAAGTGATATAAATCAATTGGAAAGTGGAAGAGATTATGTGTG
TGCTGGAAATGAGAACTACAAAAATATTTCTTATGGAAAACTGGAAAAGG
ATCCTTGGTTTAAAGGACGTCCTCACAATTTTTCCCGATATCCTCATTTA
CTCCCACTGGGGTTAGCTGCAACGAATCAAAATGTTGATGGGAACAATAA
CCAAAAATTAGACGACCACAGTTGTTATGCTGGACAAAATGCATTTCCTA
CCAGATTTTATCGGCCAGCCGGCCAGTCTTATTTAACAAAAAACGGAATC
CATCAATTCGCAATGCACGGAGCTTCAGTGGCTTATCCTAAATTAATTAA
ATTTAAATCAAAACCTATTAATAGCAAAAATGTAAATTACTATCAGGATA
TATTAAATCAACAAGTCAAACCAAAAGTAATTACAGTTGTTAGAAATAGT
CCGGAAAAATCTAAAGGTTTTGTTAGAATATTGTTGAATAAAAGAAGTGT
CCAGTCATATGAAACTCTTTTATCTGACATTGAGACATCTCTAAGAGATC
ATTTACATCATAAAATGCAGGGAATTGGTCGGATTTTCAATTTATTTGGA
AAGGAAATTAAGTCAGTTGGAGACTTTTTTCGAAATGACGACTTTTTTAT
CGCAGTAGGGGATAATGAAACTTTAGGTGTTAAGCAAATTAAGGATATTC
TCGATGATTTGTATCCAGACCATCCTCAAACTTCTCATGTTTTAAAGTAT
TGGACTTCTAAAAAAGTTGATGAATTACCTGCCAAAGATGAACAACGAGA
TCATGAAAAATTAAAAAGTTTACATGGTTCTACTATGTCTGTTGATAAAA
GAGACAGTGGCTTCGAGGAACAGAATTTTTTTAAAGACCATGACTTTAAT
TCTAATACTAATGTTAATGATTCCTCTGAAACAGTTTCGTTGCCGAAACC
AAAGCTCTCAAAAACTAAACCCTCAGTTCGAAAGAAAAATCAAAAGATTC
AGCAAAATGTTCCAAATATTCAGAACACAACCGAATCCATCAGTTCGCTA
GATTTGGATAAATCCAATAGTCGAGCTAGTCCAATTAGTAATCAAAAATC
CGTTCAGGAAAGAAATTCTGACCGTATTAGAATTGCGTATGAGGAACGAG
AAAAGGCGCGAATTCAAATTCAAGAGCAGTTGAAATTAGAAAGGAAAAAA
CTTGAAGAGAGTGTAATTAGTAATTCAAACATCTATTCACAATATGTTAG
AAAGTCATTGAATGAACGAGGATCTATTGATGTGTTTAAAAGAATGGATG
AAGCTAGTCAAGAAGCAAAAAAGCAGAAACTGAGAGAAAAATTGGAAAAA
CCTGTTCTAAATTTCTCGACCAGTATAAACAATATTGATAATAGTTCAAT
TTCTTTTTCCTCTTCAATAAATGATATAGAAACAAAAGAAATCAAAGATT
TACCAGCAATAGACCTACCAGCGAATAAAATATTTGCAATTTCGCAAAAC
GACAATAACAATAATGTTGCTACTGTGAAGTTAAAACCACCCAATTACAA
TGTCTCACCTCCTGTTGGAAAGTTAAATAAAATTAATGAAGATCCAAGTG
AATATAATGCAGACAATAAAGAAATAATGACTAGTGAGACTAACCATTTT
CTTACAGAACAATCTAAAACATCAAAAGTAGAAAATGATCAAAAACTTCA
TTCTAAAAAAATCAAAGGCGCTCAAGGAAAACATCTCTCAAATGAGGAAA
ATATCAAAACGTCTTACGCAACGAATAATGTAAAAAATATAACTAATGTA
TTAGCTGATCCACCAACTGAAGCAATAAATGTTAGCCAAGCTGAAAATAA
TCAACCTGAAGAAATTCATGCAACAGAAGATGATAAGTTAAATCCAACTG
AACACATAGAAATTGTTGAAAGGCCAGATTTAAAACATATTCCAGACTCT
GAAATACAAATCAAATCAGATTCTTCTATTTCTGAATCAAAAAACGCCCA
AAGTTCATCAAATAATAATAATATTAATAATAATTATAGTTATAATTTTT
GTATGCAGAAAACCAAATAAGCCCAAAGAAAACGATCCACTCAAATATCC
AGTCAAAGTTCCAGATAACGAACATGTATATAACTGTGCCGATGACTCGA
AAATGATGAATTCAAAGTTTCGGAATATTGCCTCAATGAAAGGCTATGCT
TACCACGTAACCAATGTCGACTGCTGCGGAAAAACAGACGAAAACATACT
TAAGATTGATTGGGATAAAAACCTAGCAAAAATTAATGTAGAATTAGATC
CTGGCGAAACCCCAGCTAAAGACGAAGGAAACCCCAGAGAACCTTTAATT
AGTGGGGAATTGCAAATAAATGACACAGAAAACAACAGTATGAAGGATGT
AGAAAATAGAACCGACCAAATACAAAAGAAAACTGTATTAAAAGCGTTCG
AAATAAAAGAAACTAGCAGAAATCAAGTTGTGAAGGGCGTATTTCTAAGC
ACGGATTTGCATCATGAGCAATTGCCCGATAGGACTGTCTATCCGCTTGA
TAAACTGGATTATCCGGTTGATCATTTCTATCAAAGAATTTCCATTAAAT
TTGAGGAAATATCTGAAAAATATCCGAAATGCCAATTTTGGTATCTTAGG
AATTATCAAATTCATTATATTTGCTATGACGAGGACGGGAAAATCGAGAA
TATAAAAAGAATTAATCTACCCGACGACTTTCAGTTATATAACAACATTG
GGGAAAGTGAAATTTCGAAACTGAATATTAGGAAAGAAGGAGCAACCAAA
GAAATATTGCCTCTTCTACAAAATAATCACAGTAAAGGTGATTATTTTTG
TACTATCTTAGTGCTAGGAGATGTCGAGATTTCCCAGAATGCTAAAATTG
ATATTGTACAAAAACAATATAAAAAATTTTGATCATAAATATTTACTTAC
AATCCGAGTTGCAAATTTTTCTGAAATTAAATTTTTGTTTTAATTTTTCA
TGTTAATCAATTTTTTAAGGTCATTAATCTTTTGGCTCACTTTATTATCG
TTTTTGC
back to top

protein sequence of SMED30012858-orf-1

>SMED30012858-orf-1 ID=SMED30012858-orf-1|Name=SMED30012858-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=790bp
MNLAVTEKLNLNGIKNINDIDFQDGVYKSNSEKSVHLHGRKPLRIRFFAN
GDKFFPGKKISIHLHRYQNIDELMNELTNKMPPHVYLPNGIRQLFTSSAG
RRISDINQLESGRDYVCAGNENYKNISYGKLEKDPWFKGRPHNFSRYPHL
LPLGLAATNQNVDGNNNQKLDDHSCYAGQNAFPTRFYRPAGQSYLTKNGI
HQFAMHGASVAYPKLIKFKSKPINSKNVNYYQDILNQQVKPKVITVVRNS
PEKSKGFVRILLNKRSVQSYETLLSDIETSLRDHLHHKMQGIGRIFNLFG
KEIKSVGDFFRNDDFFIAVGDNETLGVKQIKDILDDLYPDHPQTSHVLKY
WTSKKVDELPAKDEQRDHEKLKSLHGSTMSVDKRDSGFEEQNFFKDHDFN
SNTNVNDSSETVSLPKPKLSKTKPSVRKKNQKIQQNVPNIQNTTESISSL
DLDKSNSRASPISNQKSVQERNSDRIRIAYEEREKARIQIQEQLKLERKK
LEESVISNSNIYSQYVRKSLNERGSIDVFKRMDEASQEAKKQKLREKLEK
PVLNFSTSINNIDNSSISFSSSINDIETKEIKDLPAIDLPANKIFAISQN
DNNNNVATVKLKPPNYNVSPPVGKLNKINEDPSEYNADNKEIMTSETNHF
LTEQSKTSKVENDQKLHSKKIKGAQGKHLSNEENIKTSYATNNVKNITNV
LADPPTEAINVSQAENNQPEEIHATEDDKLNPTEHIEIVERPDLKHIPDS
EIQIKSDSSISESKNAQSSSNNNNINNNYSYNFCMQKTK*
back to top

protein sequence of SMED30012858-orf-2

>SMED30012858-orf-2 ID=SMED30012858-orf-2|Name=SMED30012858-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
MMNSKFRNIASMKGYAYHVTNVDCCGKTDENILKIDWDKNLAKINVELDP
GETPAKDEGNPREPLISGELQINDTENNSMKDVENRTDQIQKKTVLKAFE
IKETSRNQVVKGVFLSTDLHHEQLPDRTVYPLDKLDYPVDHFYQRISIKF
EEISEKYPKCQFWYLRNYQIHYICYDEDGKIENIKRINLPDDFQLYNNIG
ESEISKLNIRKEGATKEILPLLQNNHSKGDYFCTILVLGDVEISQNAKID
IVQKQYKKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0035556intracellular signal transduction
GO:0016310phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036572Doublecortin_dom_sf
IPR003533Doublecortin_dom
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003533Doublecortin domainSMARTSM00537doub1_11coord: 164..257
e-value: 5.4E-4
score: 25.1
IPR003533Doublecortin domainPFAMPF03607DCXcoord: 1..49
e-value: 5.0E-11
score: 42.5
coord: 188..249
e-value: 1.2E-6
score: 28.5
IPR003533Doublecortin domainPROSITEPS50309DCcoord: 169..250
score: 14.716
IPR003533Doublecortin domainPROSITEPS50309DCcoord: 1..56
score: 14.682
IPR036572Doublecortin domain superfamilyGENE3DG3DSA:3.10.20.230coord: 1..70
e-value: 2.0E-15
score: 58.4
IPR036572Doublecortin domain superfamilyGENE3DG3DSA:3.10.20.230coord: 160..252
e-value: 6.7E-20
score: 72.6
IPR036572Doublecortin domain superfamilySUPERFAMILYSSF89837Doublecortin (DC)coord: 1..69
IPR036572Doublecortin domain superfamilySUPERFAMILYSSF89837Doublecortin (DC)coord: 159..250
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 324..398
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 667..704
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 324..345
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 680..704
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 287..309
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 356..396
NoneNo IPR availablePANTHERPTHR44167:SF11SERINE/THREONINE-PROTEIN KINASE ZYG-8coord: 13..251
NoneNo IPR availablePANTHERPTHR44167FAMILY NOT NAMEDcoord: 13..251
NoneNo IPR availableCDDcd16109DCX1coord: 1..51
e-value: 9.47213E-10
score: 53.8414
NoneNo IPR availableCDDcd16111DCX_DCLK3coord: 167..247
e-value: 1.22924E-23
score: 93.2686