RNA binding motif single stranded interacting

Overview
NameRNA binding motif single stranded interacting
Smed IDSMED30012856
Length (bp)1259
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA binding motif single stranded interacting (SMED30012856) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA binding motif single stranded interacting (SMED30012856) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA binding motif single stranded interacting (SMED30012856) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA binding motif single stranded interacting (SMED30012856) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012856

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30012856h1SMcG0010534 dd_Smed_v4_7710_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012856h1SMcG0010534 dd_Smed_v4_11402_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30012856h1SMcG0010534 dd_Smed_v4_11402_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30012856h1SMcG0010534 dd_Smed_v4_7710_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30012856h1SMcG0010534 dd_Smed_v4_7710_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30012856h1SMcG0010534 dd_Smed_v4_7710_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA binding motif single stranded interacting vs. Ensembl Human
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:9907])

HSP 1 Score: 101.293 bits (251), Expect = 4.733e-23
Identity = 65/175 (37.14%), Postives = 97/175 (55.43%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLE----KNKTILSECGLPLEAKYAD 738
            ++SKTNLYI+GLP H  D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++ ++  + GVGF R  S    E  I        K    +S    PL  K+AD
Sbjct:   25 QLSKTNLYIRGLPPHTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKA--SGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFAD 192          

HSP 2 Score: 50.8322 bits (120), Expect = 2.904e-6
Identity = 28/73 (38.36%), Postives = 41/73 (56.16%), Query Frame = 1
Query:  469 NEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKN 687
            ++  KTNLYI  +P   T  D   L ++   YG++ S   + +KTTNK  G GFV F S   A+KA+  L+ +
Sbjct:   24 DQLSKTNLYIRGLPPHTTDQD---LVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKAS 93          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Human
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:9907])

HSP 1 Score: 101.293 bits (251), Expect = 4.733e-23
Identity = 65/175 (37.14%), Postives = 97/175 (55.43%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLE----KNKTILSECGLPLEAKYAD 738
            ++SKTNLYI+GLP H  D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++ ++  + GVGF R  S    E  I        K    +S    PL  K+AD
Sbjct:   25 QLSKTNLYIRGLPPHTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKA--SGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFAD 192          

HSP 2 Score: 50.8322 bits (120), Expect = 2.904e-6
Identity = 28/73 (38.36%), Postives = 41/73 (56.16%), Query Frame = 1
Query:  469 NEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKN 687
            ++  KTNLYI  +P   T  D   L ++   YG++ S   + +KTTNK  G GFV F S   A+KA+  L+ +
Sbjct:   24 DQLSKTNLYIRGLPPHTTDQD---LVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKAS 93          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Human
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:9907])

HSP 1 Score: 101.293 bits (251), Expect = 4.733e-23
Identity = 65/175 (37.14%), Postives = 97/175 (55.43%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLE----KNKTILSECGLPLEAKYAD 738
            ++SKTNLYI+GLP H  D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++ ++  + GVGF R  S    E  I        K    +S    PL  K+AD
Sbjct:   25 QLSKTNLYIRGLPPHTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKA--SGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFAD 192          

HSP 2 Score: 50.8322 bits (120), Expect = 2.904e-6
Identity = 28/73 (38.36%), Postives = 41/73 (56.16%), Query Frame = 1
Query:  469 NEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKN 687
            ++  KTNLYI  +P   T  D   L ++   YG++ S   + +KTTNK  G GFV F S   A+KA+  L+ +
Sbjct:   24 DQLSKTNLYIRGLPPHTTDQD---LVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKAS 93          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Human
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:9907])

HSP 1 Score: 101.293 bits (251), Expect = 6.112e-23
Identity = 65/175 (37.14%), Postives = 97/175 (55.43%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLE----KNKTILSECGLPLEAKYAD 738
            ++SKTNLYI+GLP H  D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++ ++  + GVGF R  S    E  I        K    +S    PL  K+AD
Sbjct:   38 QLSKTNLYIRGLPPHTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKA--SGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFAD 205          

HSP 2 Score: 50.8322 bits (120), Expect = 2.667e-6
Identity = 28/73 (38.36%), Postives = 41/73 (56.16%), Query Frame = 1
Query:  469 NEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKN 687
            ++  KTNLYI  +P   T  D   L ++   YG++ S   + +KTTNK  G GFV F S   A+KA+  L+ +
Sbjct:   37 DQLSKTNLYIRGLPPHTTDQD---LVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKAS 106          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Human
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:HGNC Symbol;Acc:HGNC:9907])

HSP 1 Score: 100.908 bits (250), Expect = 8.887e-23
Identity = 65/175 (37.14%), Postives = 97/175 (55.43%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLE----KNKTILSECGLPLEAKYAD 738
            ++SKTNLYI+GLP H  D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++ ++  + GVGF R  S    E  I        K    +S    PL  K+AD
Sbjct:   58 QLSKTNLYIRGLPPHTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKA--SGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFAD 225          

HSP 2 Score: 50.447 bits (119), Expect = 3.411e-6
Identity = 28/73 (38.36%), Postives = 41/73 (56.16%), Query Frame = 1
Query:  469 NEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKN 687
            ++  KTNLYI  +P   T  D   L ++   YG++ S   + +KTTNK  G GFV F S   A+KA+  L+ +
Sbjct:   57 DQLSKTNLYIRGLPPHTTDQD---LVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKAS 126          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 90.8929 bits (224), Expect = 2.239e-20
Identity = 62/172 (36.05%), Postives = 89/172 (51.74%), Query Frame = 1
Query:  238 SKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELK-CKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNK-TILSECGLPLEAKYADKHK 747
            S TNLYI+GL  + NDDLL ++      + S KA MD     CKGYGF+DF + Q A  A   + T      +   ++ E+D TNLYI N+P ++T      L+   +K+G V S  I++    N++ GVGF R  S+   E  I  L   +   +S+ G  L  K AD  +
Sbjct:  105 SSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTEGVQAQMAKLQQQEQDPTNLYIANLPLDFT---EQMLETELNKFGMVISTRILRTP-DNQSRGVGFARMDSKEKCEVIISALNGGRFDTMSKEGPALLIKQADTGR 272          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 90.8929 bits (224), Expect = 2.239e-20
Identity = 62/172 (36.05%), Postives = 89/172 (51.74%), Query Frame = 1
Query:  238 SKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELK-CKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNK-TILSECGLPLEAKYADKHK 747
            S TNLYI+GL  + NDDLL ++      + S KA MD     CKGYGF+DF + Q A  A   + T      +   ++ E+D TNLYI N+P ++T      L+   +K+G V S  I++    N++ GVGF R  S+   E  I  L   +   +S+ G  L  K AD  +
Sbjct:  105 SSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTEGVQAQMAKLQQQEQDPTNLYIANLPLDFT---EQMLETELNKFGMVISTRILRTP-DNQSRGVGFARMDSKEKCEVIISALNGGRFDTMSKEGPALLIKQADTGR 272          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 90.8929 bits (224), Expect = 5.044e-20
Identity = 62/173 (35.84%), Postives = 90/173 (52.02%), Query Frame = 1
Query:  235 ISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELK-CKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNK-TILSECGLPLEAKYADKHK 747
            +S TNLYI+GL  + NDDLL ++      + S KA MD     CKGYGF+DF + Q A  A   + T      +   ++ E+D TNLYI N+P ++T      L+   +K+G V S  I++    N++ GVGF R  S+   E  I  L   +   +S+ G  L  K AD  +
Sbjct:   78 LSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTEGVQAQMAKLQQQEQDPTNLYIANLPLDFT---EQMLETELNKFGMVISTRILR-TPDNQSRGVGFARMDSKEKCEVIISALNGGRFDTMSKEGPALLIKQADTGR 246          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 90.8929 bits (224), Expect = 5.044e-20
Identity = 62/173 (35.84%), Postives = 90/173 (52.02%), Query Frame = 1
Query:  235 ISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELK-CKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNK-TILSECGLPLEAKYADKHK 747
            +S TNLYI+GL  + NDDLL ++      + S KA MD     CKGYGF+DF + Q A  A   + T      +   ++ E+D TNLYI N+P ++T      L+   +K+G V S  I++    N++ GVGF R  S+   E  I  L   +   +S+ G  L  K AD  +
Sbjct:   78 LSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTEGVQAQMAKLQQQEQDPTNLYIANLPLDFT---EQMLETELNKFGMVISTRILR-TPDNQSRGVGFARMDSKEKCEVIISALNGGRFDTMSKEGPALLIKQADTGR 246          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Celegans
Match: sup-26 (SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8])

HSP 1 Score: 90.8929 bits (224), Expect = 5.044e-20
Identity = 62/173 (35.84%), Postives = 90/173 (52.02%), Query Frame = 1
Query:  235 ISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELK-CKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNK-TILSECGLPLEAKYADKHK 747
            +S TNLYI+GL  + NDDLL ++      + S KA MD     CKGYGF+DF + Q A  A   + T      +   ++ E+D TNLYI N+P ++T      L+   +K+G V S  I++    N++ GVGF R  S+   E  I  L   +   +S+ G  L  K AD  +
Sbjct:   78 LSSTNLYIRGLMPNTNDDLLREMCSKYGNIASTKAIMDKATNNCKGYGFVDFESPQAAAAAVDGLNTEGVQAQMAKLQQQEQDPTNLYIANLPLDFT---EQMLETELNKFGMVISTRILR-TPDNQSRGVGFARMDSKEKCEVIISALNGGRFDTMSKEGPALLIKQADTGR 246          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Fly
Match: shep (gene:FBgn0052423 transcript:FBtr0077172)

HSP 1 Score: 95.9005 bits (237), Expect = 5.294e-21
Identity = 64/188 (34.04%), Postives = 95/188 (50.53%), Query Frame = 1
Query:  235 ISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSY 795
            +SKTNLYI+GL     D  L  +      + S KA +D    KCKGYGF+DF    FAE A   ++        + AK+ E+D TNLYI N+P  +   D   L+ +  KYG+V S  I++++  N + GVGF R  S    E+ I+    N   +     PL  K+AD    +    ++ D N +++
Sbjct:  228 LSKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGKGVQ--AQMAKQQEQDPTNLYIANLPPHFKETD---LEAMLSKYGQVVSTRILRDQQMN-SKGVGFARMESREKCEQIIQMFNGN--TIPGAKDPLLVKFADGGPKKKNLFKTPDPNARAW 407          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Fly
Match: shep (gene:FBgn0052423 transcript:FBtr0308859)

HSP 1 Score: 95.9005 bits (237), Expect = 5.332e-21
Identity = 64/188 (34.04%), Postives = 94/188 (50.00%), Query Frame = 1
Query:  235 ISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSY 795
            +SKTNLYI+GL     D  L  +      + S KA +D    KCKGYGF+DF    FAE A   ++        + AK+ E+D TNLYI N+P     F    L+ +  KYG+V S  I++++  N + GVGF R  S    E+ I+    N   +     PL  K+AD    +    ++ D N +++
Sbjct:  240 LSKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGKGVQ--AQMAKQQEQDPTNLYIANLPPH---FKETDLEAMLSKYGQVVSTRILRDQQMN-SKGVGFARMESREKCEQIIQMFNGN--TIPGAKDPLLVKFADGGPKKKNLFKTPDPNARAW 419          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Fly
Match: shep (gene:FBgn0052423 transcript:FBtr0301599)

HSP 1 Score: 88.1965 bits (217), Expect = 6.534e-19
Identity = 68/222 (30.63%), Postives = 105/222 (47.30%), Query Frame = 1
Query:  235 ISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEA-----KIYIETNYSTYPV----KFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYPLTVTNHRAPLFADSDIFPNSLLFN 870
            +SKTNLYI+GL     D  L  +      + S KA +D    KCKGYGF+DF    FAE A        ++   +   +    + A + E+D TNLYI N+P  +   D   L+ +  KYG+V S  I++++  N + GVGF R  S    E+ I+    N   +     PL  K+AD    +    ++ D N +++   V+    P+  D  +  N +  N
Sbjct:   18 LSKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGKGVQAQMAKVGIWVLHRPAIQQEQDPTNLYIANLPPHFKETD---LEAMLSKYGQVVSTRILRDQQMN-SKGVGFARMESREKCEQIIQMFNGN--TIPGAKDPLLVKFADGGPKKKNLFKTPDPNARAW-RDVSAEGIPVAYDPTMQQNGVSVN 232          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Fly
Match: shep (gene:FBgn0052423 transcript:FBtr0333287)

HSP 1 Score: 88.1965 bits (217), Expect = 6.534e-19
Identity = 68/222 (30.63%), Postives = 105/222 (47.30%), Query Frame = 1
Query:  235 ISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEA-----KIYIETNYSTYPV----KFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYPLTVTNHRAPLFADSDIFPNSLLFN 870
            +SKTNLYI+GL     D  L  +      + S KA +D    KCKGYGF+DF    FAE A        ++   +   +    + A + E+D TNLYI N+P  +   D   L+ +  KYG+V S  I++++  N + GVGF R  S    E+ I+    N   +     PL  K+AD    +    ++ D N +++   V+    P+  D  +  N +  N
Sbjct:   18 LSKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGKGVQAQMAKVGIWVLHRPAIQQEQDPTNLYIANLPPHFKETD---LEAMLSKYGQVVSTRILRDQQMN-SKGVGFARMESREKCEQIIQMFNGN--TIPGAKDPLLVKFADGGPKKKNLFKTPDPNARAW-RDVSAEGIPVAYDPTMQQNGVSVN 232          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Fly
Match: shep (gene:FBgn0052423 transcript:FBtr0333289)

HSP 1 Score: 87.0409 bits (214), Expect = 1.686e-18
Identity = 69/222 (31.08%), Postives = 103/222 (46.40%), Query Frame = 1
Query:  235 ISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKEN---------EKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYPLTVTNHRAPLFADSDIFPNSLLFN 870
            +SKTNLYI+GL     D  L  +      + S KA +D    KCKGYGF+DF    FAE A   ++        + AK           E+D TNLYI N+P  +   D   L+ +  KYG+V S  I++++  N + GVGF R  S    E+ I+    N   +     PL  K+AD    +    ++ D N +++   V+    P+  D  +  N +  N
Sbjct:   18 LSKTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAVKGLQGK--GVQAQMAKVGIWVLHRPAIEQDPTNLYIANLPPHFKETD---LEAMLSKYGQVVSTRILRDQQMN-SKGVGFARMESREKCEQIIQMFNGN--TIPGAKDPLLVKFADGGPKKKNLFKTPDPNARAW-RDVSAEGIPVAYDPTMQQNGVSVN 230          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Zebrafish
Match: rbms1a (RNA binding motif, single stranded interacting protein 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4967])

HSP 1 Score: 102.834 bits (255), Expect = 1.028e-23
Identity = 69/187 (36.90%), Postives = 104/187 (55.61%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRS 771
            ++SKTNLYI+GLP    D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++TN      + AK+ E+D TNLY++N+P    S D  +L+ +   +G+V S  I+++ T   + GVGF R  S    +  I      K I S  G+     PL  K+AD  +   +KR+S
Sbjct:   53 QLSKTNLYIRGLPPGTTDHDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPVSAQKAVAALKTNGVQ--AQMAKQQEQDPTNLYLSNLP---VSMDEQELENLLKPFGQVVSTRILRD-TNGMSRGVGFARMESTEKCDAVISHFN-GKFIKSSSGMLGASEPLLCKFADGGQ---KKRQS 228          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Zebrafish
Match: rbms1b (RNA binding motif, single stranded interacting protein 1b [Source:ZFIN;Acc:ZDB-GENE-100812-3])

HSP 1 Score: 93.5893 bits (231), Expect = 1.018e-21
Identity = 57/148 (38.51%), Postives = 87/148 (58.78%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAI 669
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++T  S    + AK+ E+D TNLYI+N+P    + D  +L+ +   +G+V S  I+++ T   + GVGF R  S    E  I
Sbjct:   53 QLSKTNLYIRGLLPSTTDHDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKT--SGVQAQMAKQQEQDPTNLYISNLP---LTMDEQELEAMLKPFGQVVSTRILRD-TNGASRGVGFARMESTEKCEAVI 193          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Zebrafish
Match: rbms2a (RNA binding motif, single stranded interacting protein 2a [Source:ZFIN;Acc:ZDB-GENE-030912-2])

HSP 1 Score: 95.9005 bits (237), Expect = 2.480e-21
Identity = 65/195 (33.33%), Postives = 106/195 (54.36%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDGNIKSY 795
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   +++  +    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++     + GVGF R  S    E  I+     K I +  G+     PL  K+AD  + + + +     N +S+
Sbjct:   51 QLSKTNLYIRGLHPGTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVTALKS--TGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELEAMLKSFGQVISTRILRD-ANGTSRGVGFARMESTEKCEAIIQHFN-GKYIKTPPGVPVPTEPLLCKFADGGQKKRQNQNKYLQNGRSW 237          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Zebrafish
Match: rbms2a (RNA binding motif, single stranded interacting protein 2a [Source:ZFIN;Acc:ZDB-GENE-030912-2])

HSP 1 Score: 95.9005 bits (237), Expect = 2.702e-21
Identity = 65/195 (33.33%), Postives = 106/195 (54.36%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDGNIKSY 795
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   +++  +    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++     + GVGF R  S    E  I+     K I +  G+     PL  K+AD  + + + +     N +S+
Sbjct:   49 QLSKTNLYIRGLHPGTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVTALKS--TGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELEAMLKSFGQVISTRILRD-ANGTSRGVGFARMESTEKCEAIIQHFN-GKYIKTPPGVPVPTEPLLCKFADGGQKKRQNQNKYLQNGRSW 235          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Zebrafish
Match: rbms3 (RNA binding motif, single stranded interacting protein [Source:ZFIN;Acc:ZDB-GENE-060929-244])

HSP 1 Score: 95.1301 bits (235), Expect = 5.454e-21
Identity = 64/196 (32.65%), Postives = 104/196 (53.06%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIE-----FLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYP 798
            ++SKTNLYI+GLP    D DL++   P+  K+ S KA +D    +CKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G V S  I+++     + GVGF R  S    +  I+     FL+    + +    PL  K+AD  + + + +     N + +P
Sbjct:   46 QLSKTNLYIRGLPPGTTDQDLIKLCQPY-GKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVASLKA--SGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELENMLKPFGHVISTRILRD-ANGVSRGVGFARMESTEKCDVVIQHFNGKFLKTPPGVPAPT-EPLLCKFADGGQKKRQSQSKYPQNGRPWP 233          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Xenopus
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:NCBI gene;Acc:100495159])

HSP 1 Score: 98.9821 bits (245), Expect = 2.019e-22
Identity = 67/190 (35.26%), Postives = 102/190 (53.68%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDG 780
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++  +  + GVGF R  S    E  I      K I +  G+     PL  K+AD      +K+R   G
Sbjct:   29 QLSKTNLYIRGLHPSTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPGAAQKAVTALKA--SGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELESLLKPFGQVISTRILRD-ASGTSRGVGFARMESTEKCEAVISHFN-GKYIKTPPGVPAPQEPLLCKFADG----GQKKRQTQG 206          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Xenopus
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:NCBI gene;Acc:100495159])

HSP 1 Score: 98.9821 bits (245), Expect = 2.246e-22
Identity = 67/190 (35.26%), Postives = 102/190 (53.68%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDG 780
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++  +  + GVGF R  S    E  I      K I +  G+     PL  K+AD      +K+R   G
Sbjct:   28 QLSKTNLYIRGLHPSTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPGAAQKAVTALKA--SGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELESLLKPFGQVISTRILRD-ASGTSRGVGFARMESTEKCEAVISHFN-GKYIKTPPGVPAPQEPLLCKFADG----GQKKRQTQG 205          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Xenopus
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:NCBI gene;Acc:100495159])

HSP 1 Score: 98.5969 bits (244), Expect = 2.340e-22
Identity = 67/190 (35.26%), Postives = 102/190 (53.68%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDG 780
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++  +  + GVGF R  S    E  I      K I +  G+     PL  K+AD      +K+R   G
Sbjct:   23 QLSKTNLYIRGLHPSTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPGAAQKAVTALKA--SGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELESLLKPFGQVISTRILRD-ASGTSRGVGFARMESTEKCEAVISHFN-GKYIKTPPGVPAPQEPLLCKFADG----GQKKRQTQG 200          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Xenopus
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:NCBI gene;Acc:100495159])

HSP 1 Score: 98.5969 bits (244), Expect = 2.475e-22
Identity = 67/190 (35.26%), Postives = 102/190 (53.68%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDG 780
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++  +  + GVGF R  S    E  I      K I +  G+     PL  K+AD      +K+R   G
Sbjct:   23 QLSKTNLYIRGLHPSTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPGAAQKAVTALKA--SGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELESLLKPFGQVISTRILRD-ASGTSRGVGFARMESTEKCEAVISHFN-GKYIKTPPGVPAPQEPLLCKFADG----GQKKRQTQG 200          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Xenopus
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:NCBI gene;Acc:100495159])

HSP 1 Score: 98.9821 bits (245), Expect = 2.848e-22
Identity = 67/190 (35.26%), Postives = 102/190 (53.68%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDG 780
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++  +  + GVGF R  S    E  I      K I +  G+     PL  K+AD      +K+R   G
Sbjct:   43 QLSKTNLYIRGLHPSTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPGAAQKAVTALKA--SGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELESLLKPFGQVISTRILRD-ASGTSRGVGFARMESTEKCEAVISHFN-GKYIKTPPGVPAPQEPLLCKFADG----GQKKRQTQG 220          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Mouse
Match: Rbms1 (RNA binding motif, single stranded interacting protein 1 [Source:MGI Symbol;Acc:MGI:1861774])

HSP 1 Score: 99.7525 bits (247), Expect = 1.413e-22
Identity = 77/255 (30.20%), Postives = 125/255 (49.02%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLE----KNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYP------LTVTNHRAPLFADSDIFPNSLLFNTMKQQDLLSLYPILLSSGHNLMSTFQNQFP 960
            ++SKTNLYI+GLP +  D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++ N      + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  ++++ ++  + GVGF R  S    E  I        K    +S    PL  K+AD  + + +       N + +P      +T+T         +  +P+     T +     SL P + S     +S +Q Q P
Sbjct:   58 QLSKTNLYIRGLPPNTTDQDLVKLCQPY-GKIVSTKAILDKATNKCKGYGFVDFDSPAAAQKAVSALKANGVQ--AQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRVLRD-SSGASRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWPRDGEAGMTLTYDPTTAALHNGFYPSPYSIATNRMITQTSLTPYIASP----VSAYQVQSP 301          

HSP 2 Score: 50.447 bits (119), Expect = 2.476e-6
Identity = 28/73 (38.36%), Postives = 40/73 (54.79%), Query Frame = 1
Query:  469 NEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKN 687
            ++  KTNLYI  +P   T  D   L ++   YG++ S   + +K TNK  G GFV F S   A+KA+  L+ N
Sbjct:   57 DQLSKTNLYIRGLPPNTTDQD---LVKLCQPYGKIVSTKAILDKATNKCKGYGFVDFDSPAAAQKAVSALKAN 126          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Mouse
Match: Rbms2 (RNA binding motif, single stranded interacting protein 2 [Source:MGI Symbol;Acc:MGI:1861776])

HSP 1 Score: 98.5969 bits (244), Expect = 1.935e-22
Identity = 67/196 (34.18%), Postives = 106/196 (54.08%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDGNIKSYP 798
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++ T+  + GVGF R  S    E  I      K I +  G+     PL  K+AD    + + +     N +++P
Sbjct:   26 QLSKTNLYIRGLQPGTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPSSAQKAVTALKA--SGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELEGMLKPFGQVISTRILRD-TSGASRGVGFARMESTEKCEAIITHFN-GKYIKTPPGVAAPSDPLLCKFADGGPKKRQSQGRYVQNGRAWP 213          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Mouse
Match: Rbms2 (RNA binding motif, single stranded interacting protein 2 [Source:MGI Symbol;Acc:MGI:1861776])

HSP 1 Score: 98.9821 bits (245), Expect = 2.052e-22
Identity = 67/196 (34.18%), Postives = 106/196 (54.08%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDGNIKSYP 798
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++ T+  + GVGF R  S    E  I      K I +  G+     PL  K+AD    + + +     N +++P
Sbjct:   26 QLSKTNLYIRGLQPGTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPSSAQKAVTALKA--SGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELEGMLKPFGQVISTRILRD-TSGASRGVGFARMESTEKCEAIITHFN-GKYIKTPPGVAAPSDPLLCKFADGGPKKRQSQGRYVQNGRAWP 213          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Mouse
Match: Rbms2 (RNA binding motif, single stranded interacting protein 2 [Source:MGI Symbol;Acc:MGI:1861776])

HSP 1 Score: 98.9821 bits (245), Expect = 2.616e-22
Identity = 67/196 (34.18%), Postives = 106/196 (54.08%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDGNIKSYP 798
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++ T+  + GVGF R  S    E  I      K I +  G+     PL  K+AD    + + +     N +++P
Sbjct:   54 QLSKTNLYIRGLQPGTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPSSAQKAVTALKA--SGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELEGMLKPFGQVISTRILRD-TSGASRGVGFARMESTEKCEAIITHFN-GKYIKTPPGVAAPSDPLLCKFADGGPKKRQSQGRYVQNGRAWP 241          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Mouse
Match: Rbms1 (RNA binding motif, single stranded interacting protein 1 [Source:MGI Symbol;Acc:MGI:1861774])

HSP 1 Score: 98.5969 bits (244), Expect = 3.089e-22
Identity = 65/195 (33.33%), Postives = 104/195 (53.33%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLE----KNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYP 798
            ++SKTNLYI+GLP +  D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++ N      + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  ++++ ++  + GVGF R  S    E  I        K    +S    PL  K+AD  + + +       N + +P
Sbjct:   25 QLSKTNLYIRGLPPNTTDQDLVKLCQPY-GKIVSTKAILDKATNKCKGYGFVDFDSPAAAQKAVSALKANGVQ--AQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRVLRD-SSGASRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWP 212          
BLAST of RNA binding motif single stranded interacting vs. UniProt/SwissProt
Match: sp|P29558|RBMS1_HUMAN (RNA-binding motif, single-stranded-interacting protein 1 OS=Homo sapiens OX=9606 GN=RBMS1 PE=1 SV=3)

HSP 1 Score: 100.908 bits (250), Expect = 4.268e-22
Identity = 65/175 (37.14%), Postives = 97/175 (55.43%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLE----KNKTILSECGLPLEAKYAD 738
            ++SKTNLYI+GLP H  D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++ ++  + GVGF R  S    E  I        K    +S    PL  K+AD
Sbjct:   58 QLSKTNLYIRGLPPHTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVSALKA--SGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRILRD-SSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFAD 225          
BLAST of RNA binding motif single stranded interacting vs. UniProt/SwissProt
Match: sp|Q91W59|RBMS1_MOUSE (RNA-binding motif, single-stranded-interacting protein 1 OS=Mus musculus OX=10090 GN=Rbms1 PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 9.886e-22
Identity = 77/255 (30.20%), Postives = 125/255 (49.02%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLE----KNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYP------LTVTNHRAPLFADSDIFPNSLLFNTMKQQDLLSLYPILLSSGHNLMSTFQNQFP 960
            ++SKTNLYI+GLP +  D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++ N      + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  ++++ ++  + GVGF R  S    E  I        K    +S    PL  K+AD  + + +       N + +P      +T+T         +  +P+     T +     SL P + S     +S +Q Q P
Sbjct:   58 QLSKTNLYIRGLPPNTTDQDLVKLCQPY-GKIVSTKAILDKATNKCKGYGFVDFDSPAAAQKAVSALKANGVQ--AQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRVLRD-SSGASRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWPRDGEAGMTLTYDPTTAALHNGFYPSPYSIATNRMITQTSLTPYIASP----VSAYQVQSP 301          
BLAST of RNA binding motif single stranded interacting vs. UniProt/SwissProt
Match: sp|Q8VC70|RBMS2_MOUSE (RNA-binding motif, single-stranded-interacting protein 2 OS=Mus musculus OX=10090 GN=Rbms2 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.830e-21
Identity = 67/196 (34.18%), Postives = 106/196 (54.08%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDGNIKSYP 798
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++ T+  + GVGF R  S    E  I      K I +  G+     PL  K+AD    + + +     N +++P
Sbjct:   54 QLSKTNLYIRGLQPGTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPSSAQKAVTALKA--SGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELEGMLKPFGQVISTRILRD-TSGASRGVGFARMESTEKCEAIITHFN-GKYIKTPPGVAAPSDPLLCKFADGGPKKRQSQGRYVQNGRAWP 241          
BLAST of RNA binding motif single stranded interacting vs. UniProt/SwissProt
Match: sp|Q15434|RBMS2_HUMAN (RNA-binding motif, single-stranded-interacting protein 2 OS=Homo sapiens OX=9606 GN=RBMS2 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.874e-21
Identity = 67/196 (34.18%), Postives = 106/196 (54.08%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDGNIKSYP 798
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++ T+  + GVGF R  S    E  I      K I +  G+     PL  K+AD    + + +     N +++P
Sbjct:   52 QLSKTNLYIRGLQPGTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKAVTALKA--SGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELEGMLKPFGQVISTRILRD-TSGTSRGVGFARMESTEKCEAIITHFN-GKYIKTPPGVPAPSDPLLCKFADGGPKKRQNQGKFVQNGRAWP 239          
BLAST of RNA binding motif single stranded interacting vs. UniProt/SwissProt
Match: sp|Q5PQP1|RBMS1_RAT (RNA-binding motif, single-stranded-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Rbms1 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.640e-21
Identity = 77/255 (30.20%), Postives = 125/255 (49.02%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLE----KNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYP------LTVTNHRAPLFADSDIFPNSLLFNTMKQQDLLSLYPILLSSGHNLMSTFQNQFP 960
            ++SKTNLYI+GLP +  D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++   S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  ++++ ++  + GVGF R  S    E  I        K    +S    PL  K+AD  + + +       N + +P      +T+T         +  +P+     T +     SL P + S     +S +Q Q P
Sbjct:   58 QLSKTNLYIRGLPPNTTDQDLVKLCQPY-GKIVSTKAILDKATNKCKGYGFVDFDSPAAAQKAVSALKA--SGVQAQMAKQQEQDPTNLYISNLP---LSMDEQELENMLKPFGQVISTRVLRD-SSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWPREGEAGMTLTYDPTTAALHNGFYPSPYSIATNRMITQTSLTPYIASP----VSAYQVQSP 301          
BLAST of RNA binding motif single stranded interacting vs. TrEMBL
Match: A0A4S2M5S3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002489 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 6.346e-71
Identity = 114/214 (53.27%), Postives = 157/214 (73.36%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRR---------SVDGNIKSYPLTVTNHRAPLFADSDI 846
            ++S+TNLYIKGLP  FNDD L  L P  +++KSVKAA DD+ KC+GYGFIDFI+++ A EA  +I   Y  + +KFAKENEKDKTNLY+TN+PK WT+ DSD+LK +F+++G +QSAF+M E++TN+TTGVGFVRF++E DA  A+++++ N  IL EC  P+EAK+ADKH  ++R+RR         S   ++  YPLT+  H APL +   I
Sbjct:  104 KMSRTNLYIKGLPDSFNDDKLWNLPPQGDQIKSVKAATDDDGKCRGYGFIDFISQEAANEALQHIRDTYPAFTIKFAKENEKDKTNLYVTNLPKSWTTKDSDQLKMVFERFGPIQSAFVMMERSTNRTTGVGFVRFANERDALAALDYIKSNPIILPECNNPVEAKFADKHNPDTRRRRYPMSTLLNNSAVNSLIGYPLTL-GHGAPLSSQDAI 316          
BLAST of RNA binding motif single stranded interacting vs. TrEMBL
Match: A0A074ZGD5 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_14362 PE=4 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 3.765e-70
Identity = 113/214 (52.80%), Postives = 156/214 (72.90%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRR---------SVDGNIKSYPLTVTNHRAPLFADSDI 846
            ++S+TNLYIKGLP  FNDD L  L P  +++KSVKAA DD+ KC+GYGFIDFI+++ A EA  +I   Y  + +KFAKENEKDKTNLY+TN+PK WT+ DSD+LK +F+++G +QSAF+M E++TN+TTGVGFVRF++E DA  A+++++    IL EC  P+EAK+ADKH  ++R+RR         S   ++  YPLT+  H APL +   I
Sbjct:  104 KMSRTNLYIKGLPDSFNDDKLWNLPPQSDQIKSVKAATDDDGKCRGYGFIDFISQEAANEALQHIRDTYPAFTIKFAKENEKDKTNLYVTNLPKSWTTKDSDQLKMVFERFGPIQSAFVMMERSTNRTTGVGFVRFANERDALAALDYIKSTPIILPECNNPVEAKFADKHNPDTRRRRYPMSTLLNNSAVNSLIGYPLTL-GHGAPLSSQDAI 316          
BLAST of RNA binding motif single stranded interacting vs. TrEMBL
Match: A0A4Z2DT17 (RNA-binding motif, single-stranded-interacting protein OS=Schistosoma japonicum OX=6182 GN=EWB00_006577 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 9.366e-66
Identity = 106/191 (55.50%), Postives = 145/191 (75.92%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYPLT 804
            ++S+TNLYIKGLP +F+DD L QL P   K+KSVKAA D++ KC+GYGFIDF++E  A EA   I+  Y ++ +KFAKENEKDKTNLY+TN+P+ WT+ DSD+LK +F+++G +QSAF+M E+ TNKTTGVGFVRF +E DA  A+E L+ +   L +C +P+EAK+ADKH  ++R+RR        YP+T
Sbjct:  116 KMSRTNLYIKGLPENFDDDHLWQLPPDQTKIKSVKAATDEDTKCRGYGFIDFVSEDAANEALQQIKETYPSFTIKFAKENEKDKTNLYVTNLPRTWTTKDSDQLKAVFERFGHIQSAFVMMERLTNKTTGVGFVRFVNEQDAMNALESLKLHPLTLPDCSVPIEAKFADKHNPDTRRRR--------YPVT 298          
BLAST of RNA binding motif single stranded interacting vs. TrEMBL
Match: A0A4E0RJ17 (RNA binding motif single stranded interacting OS=Fasciola hepatica OX=6192 GN=D915_001041 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.023e-64
Identity = 106/209 (50.72%), Postives = 151/209 (72.25%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRR----------SVDGNIKSYPLTVTNHRAPL 828
            ++S+TNLYIKGLP  F+D+ L  L P   ++KSVKAA DD+ KC+GYGFIDF+NE  A +A  +I+  Y  + +KFAKENEKDKTNLY+T++PK WT+ DS++LK +F+++G +QSAF+M E++TN+TTGVGFVRF++E DA  A++ +  N  +L EC  P+EAK+ADKH  ++R+RR          S   N+  YPL + +  AP+
Sbjct:  147 KVSRTNLYIKGLPDSFSDEKLWNLPPDQTQIKSVKAATDDDGKCRGYGFIDFVNETAAIDALKHIKETYPAFTIKFAKENEKDKTNLYVTHLPKSWTTKDSEQLKSVFERFGPIQSAFVMMERSTNRTTGVGFVRFANERDALAALDSIRTNPIMLPECTEPVEAKFADKHNPDTRRRRYPATTSVLQASNMSNLFGYPLALGHAGAPV 355          
BLAST of RNA binding motif single stranded interacting vs. TrEMBL
Match: A0A1S8X6S0 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_01674 PE=4 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 4.496e-64
Identity = 113/240 (47.08%), Postives = 155/240 (64.58%), Query Frame = 1
Query:  235 ISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKG---------------------------YGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRR---------SVDGNIKSYPLTVTNHRAPLFADSDI 846
            +S+TNLYIKGLP  FNDD L  L P  +++KSVKAA DD+ KC+G                           YGFIDFI+++ A EA  +I   Y  + +KFAKENEKDKTNLY+TN+PK WT+ DSD+LK +F+++G +QSAF+M E++TN+TTGVGFVRF++E DA  A+++++    IL EC  P+EAK+ADKH  ++R+RR         S   ++  YPLT+  H APL +   I
Sbjct:    1 MSRTNLYIKGLPDSFNDDKLWNLPPQSDQIKSVKAATDDDGKCRGCELDAEGILVFAESLDNVSVVKATKAGYGFIDFISQEAANEALQHIRDTYPAFTIKFAKENEKDKTNLYVTNLPKSWTTKDSDQLKMVFERFGPIQSAFVMMERSTNRTTGVGFVRFANERDALAALDYIKSTPIILPECNNPVEAKFADKHNPDTRRRRYPMSTLLNNSAVNSLIGYPLTL-GHGAPLSSQDAI 239          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Cavefish
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:NCBI gene;Acc:103030356])

HSP 1 Score: 98.9821 bits (245), Expect = 1.839e-22
Identity = 66/187 (35.29%), Postives = 104/187 (55.61%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAI-----EFLEKNKTILSECGLPLEAKYADKHKSESRKRRS 771
            ++SKTNLYI+GLP    D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++TN      + AK+ E+D TNLYI+N+P    + D   L+ +   +G+V S  I+++     + GVGF R  S    +  I     +FL+    +++    PL  K+AD  +   +KR+S
Sbjct:   58 QLSKTNLYIRGLPPATTDHDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVNALKTNGVQ--AQMAKQQEQDPTNLYISNLP---LTMDEQDLESMLKPFGQVVSTRILRD-ANGASRGVGFARMESTEKCDAVISHFNGKFLKMPAGVMAPS-EPLLCKFADGGQ---KKRQS 233          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Cavefish
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:NCBI gene;Acc:103030356])

HSP 1 Score: 98.9821 bits (245), Expect = 1.905e-22
Identity = 66/187 (35.29%), Postives = 104/187 (55.61%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAI-----EFLEKNKTILSECGLPLEAKYADKHKSESRKRRS 771
            ++SKTNLYI+GLP    D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++TN      + AK+ E+D TNLYI+N+P    + D   L+ +   +G+V S  I+++     + GVGF R  S    +  I     +FL+    +++    PL  K+AD  +   +KR+S
Sbjct:   52 QLSKTNLYIRGLPPATTDHDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVNALKTNGVQ--AQMAKQQEQDPTNLYISNLP---LTMDEQDLESMLKPFGQVVSTRILRD-ANGASRGVGFARMESTEKCDAVISHFNGKFLKMPAGVMAPS-EPLLCKFADGGQ---KKRQS 227          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Cavefish
Match: RBMS1 (RNA binding motif single stranded interacting protein 1 [Source:NCBI gene;Acc:103030356])

HSP 1 Score: 98.5969 bits (244), Expect = 1.963e-22
Identity = 66/187 (35.29%), Postives = 104/187 (55.61%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAI-----EFLEKNKTILSECGLPLEAKYADKHKSESRKRRS 771
            ++SKTNLYI+GLP    D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++TN      + AK+ E+D TNLYI+N+P    + D   L+ +   +G+V S  I+++     + GVGF R  S    +  I     +FL+    +++    PL  K+AD  +   +KR+S
Sbjct:   26 QLSKTNLYIRGLPPATTDHDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVNALKTNGVQ--AQMAKQQEQDPTNLYISNLP---LTMDEQDLESMLKPFGQVVSTRILRD-ANGASRGVGFARMESTEKCDAVISHFNGKFLKMPAGVMAPS-EPLLCKFADGGQ---KKRQS 201          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Cavefish
Match: rbms2a (RNA-binding motif, single-stranded-interacting protein 2-like [Source:NCBI gene;Acc:103040012])

HSP 1 Score: 98.2117 bits (243), Expect = 3.825e-22
Identity = 66/190 (34.74%), Postives = 103/190 (54.21%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEA-----KYADKHKSESRKRRSVDG 780
            ++SKTNLYI+GL P   + DL++   PF  K+ S KA +D    KCKGYGF+DF +   A++A   +++       + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  ++++     + GVGF R  S    E  I+     K I +  G+P+ A     K+AD      +K+R   G
Sbjct:   54 QLSKTNLYIRGLHPGTTDQDLVKLCQPF-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVTALKSG--GVQAQMAKQQEQDPTNLYISNLP---VSMDEQELEAMLKSFGQVVSTRVLRD-ANGTSRGVGFARMESTEKCEAIIQHFN-GKYIKTPPGVPVPAEPLLCKFADG----GQKKRQNHG 231          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Cavefish
Match: rbms1a (RNA-binding motif, single-stranded-interacting protein 1 [Source:NCBI gene;Acc:103034850])

HSP 1 Score: 96.2857 bits (238), Expect = 1.658e-21
Identity = 64/176 (36.36%), Postives = 96/176 (54.55%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYAD 738
            ++SKTNLYI+GLP    D DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   ++ N      + AK+ E+D TNLY++N+P    S D  +L+ +   +G+V S  I+++     + GVGF R  S    +  I      K I S  G+     PL  K+AD
Sbjct:   52 QLSKTNLYIRGLPPSTTDHDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPVSAQKAVAALKNNGVQ--AQMAKQQEQDPTNLYLSNLP---VSMDEQELENLLKPFGQVISTRILRD-AHGVSRGVGFARMESTEKCDAVISHFN-GKFIKSASGMLGASEPLLCKFAD 219          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008168.1 (pep scaffold:Pmarinus_7.0:GL476829:41182:80090:-1 gene:ENSPMAG00000007358.1 transcript:ENSPMAT00000008168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 4.466e-22
Identity = 63/176 (35.80%), Postives = 96/176 (54.55%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYAD 738
            ++SKTNLYI+GLP    D DL++   P+  K+ S KA +D    +CKGYGF+DF     A++A   ++   S    + AK+ E+D TNLYI+N+P    + D  +L+ +  ++G V S  I+++     + GVGF R  S    E  I+     K + S  G+     PL  K+AD
Sbjct:   31 QLSKTNLYIRGLPPGTTDQDLVKLCQPY-GKIVSTKAILDKTTNQCKGYGFVDFDGPSAAQKAVTALKA--SGIQAQMAKQQEQDPTNLYISNLP---VTIDEQELEGMLKQFGHVISTRILRD-IVGTSRGVGFARMESTEKCEAVIQRF-NGKFLTSPPGVPVPSEPLLCKFAD 198          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Sea Lamprey
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:9909])

HSP 1 Score: 95.9005 bits (237), Expect = 5.716e-22
Identity = 76/254 (29.92%), Postives = 121/254 (47.64%), Query Frame = 1
Query:  223 MSGRISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDGNIKSYPLTVTNHRA----PLFADSDIFPNSLLFNTMKQQDLLSLYPILLSSGHNLMSTFQNQ 954
            ++  +SKTNLYI+GLP    D  L +L     K+ S KA +D    +CKGYGF+ F +   A++A   ++ N      + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++     + GVGF R  S    E  I+     K I    G+     PL  K+AD  + + + +     N +++P       A    P    +  +P+     T +     S+ P L S     +ST+Q Q
Sbjct:   51 LADHLSKTNLYIRGLPPGTTDQDLTKLCQPYGKIVSTKAILDKNTNQCKGYGFVHFDSPAAAQKAVTALKANGVQ--AQMAKQQEQDPTNLYISNLP---LSMDEQELEGMLKPFGQVISTRILRD-ANGTSRGVGFARMESTEKCEAVIQHF-NGKFIQIPPGVPAPSEPLLCKFADGGQKKRQSQSKYTQNGRAWPREGETGIAVTYDPTAIQNGFYPSPYSIATNRMIAQTSMTPYLASP----VSTYQVQ 293          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Sea Lamprey
Match: RBMS2 (RNA binding motif single stranded interacting protein 2 [Source:HGNC Symbol;Acc:HGNC:9909])

HSP 1 Score: 64.6994 bits (156), Expect = 8.203e-12
Identity = 36/102 (35.29%), Postives = 56/102 (54.90%), Query Frame = 1
Query:  367 GYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIE 672
            GYGF+DF +   A++A   ++ N      + AK+ E+D TNLYI+N+P    S D  +L+ +   YG+V S  I+++     + GVGF R  S    E  I+
Sbjct:    1 GYGFVDFDSPAAAQKAVSALKAN--GVQAQMAKQQEQDPTNLYISNLP---MSMDEQELEGMLKPYGQVISTRILRD-ANGTSRGVGFARMESTEKCEAVIQ 96          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007448.1 (pep scaffold:Pmarinus_7.0:GL479027:131562:138944:-1 gene:ENSPMAG00000006727.1 transcript:ENSPMAT00000007448.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 1.259e-9
Identity = 29/61 (47.54%), Postives = 40/61 (65.57%), Query Frame = 1
Query:  235 ISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEA 414
            +SKTNLYI+GLP H +D  L +L     K+ S KA +D    +CKGYGF+DF +   A++A
Sbjct:   52 LSKTNLYIRGLPPHTSDQDLVKLCHPYGKIVSTKAILDKTTNQCKGYGFVDFDSPTAAQKA 112          

HSP 2 Score: 45.4394 bits (106), Expect = 1.877e-6
Identity = 26/67 (38.81%), Postives = 38/67 (56.72%), Query Frame = 1
Query:  481 KTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLE 681
            KTNLYI  +P   +  D   L ++   YG++ S   + +KTTN+  G GFV F S   A+KA+  L+
Sbjct:   54 KTNLYIRGLPPHTSDQD---LVKLCHPYGKIVSTKAILDKTTNQCKGYGFVDFDSPTAAQKAVTALK 117          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 54.6842 bits (130), Expect = 2.142e-8
Identity = 53/184 (28.80%), Postives = 83/184 (45.11%), Query Frame = 1
Query:  244 TNLYIKGLPVHFNDDL--------LEQLVPFPEKVKSVKAAMDDELKCKGYGFIDFINEQFAEEAKIYIET----NYSTYPVKFAKENEK-------------------DKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILS 702
            TN+YIK    +F DD+         EQ V    K  SVK  MD+  K KG+GF+ F   + A++A   + T      + Y  +  K+ E+                      NLY+ N+     + + ++L + F  +G + SA +M E+   ++ G GFV FSS  +A KA+   E N  I+ 
Sbjct:   51 TNVYIK----NFGDDMDDERLREYFEQYV---GKTLSVKVMMDEGGKSKGFGFVSFERHEDAQKAVDEMNTKELNGRAIYVGRAQKKAERQTELKRKFEMLKQERMSKYQGVNLYVKNLD---DNINDERLWKEFSPFGTITSAKVMMEE--GRSRGFGFVCFSSPEEATKAV--TEMNGRIIG 220          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 55.8398 bits (133), Expect = 5.735e-9
Identity = 53/191 (27.75%), Postives = 87/191 (45.55%), Query Frame = 1
Query:  244 TNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKGYGFIDFINEQFAEEA------------KIYI-------------ETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADK 741
            TNLY+K +     D+  ++L      + S     D + K KG+GF+++   + A +A            K+Y+             +  Y  Y  +  K  +    NL++ N+     S D +KL+  F  YG + SA +M+ +   K+ G GFV FS+  +A KAI   EKN+ I++  G PL    A +
Sbjct:  219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAY--RLEKMAKYQGVNLFVKNLD---DSVDDEKLEEEFAPYGTITSAKVMRTE-NGKSKGFGFVCFSTPEEATKAI--TEKNQQIVA--GKPLYVAIAQR 399          

HSP 2 Score: 55.8398 bits (133), Expect = 6.151e-9
Identity = 48/157 (30.57%), Postives = 72/157 (45.86%), Query Frame = 1
Query:  247 NLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKGYGFIDFINEQFAEEA------------KIYIETNYSTYPVKFAKENEKDK-TNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFL 678
            N++IK L    ++  L         + S K A D+  K KG+GF+ F  E  A+EA            +IY+  + S        E  K   TNLY+ NI  E T    ++ + +F K+G + SA  +++    K  G GFV +    DA KA+E L
Sbjct:  127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRKERDSQLEETKAHYTNLYVKNINSETT---DEQFQELFAKFGPIVSA-SLEKDADGKLKGFGFVNYEKHEDAVKAVEAL 279          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 47.3654 bits (111), Expect = 2.408e-6
Identity = 38/128 (29.69%), Postives = 63/128 (49.22%), Query Frame = 1
Query:  358 KCKGYGFIDFINEQFAEEAKIYIET--------NYSTYPVKFAKENEKDKT----------NLYITNIPKEWTSF--DSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLE 681
            + +GYG++DF N+ +AE+A   ++         N      K A  N++ K            L++ N+     SF  D D +  +F K+GEV S  I     T +  G G+V+FS+  DA+KA++ L+
Sbjct:  207 RSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNL-----SFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQ 329          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 46.9802 bits (110), Expect = 3.405e-6
Identity = 41/172 (23.84%), Postives = 75/172 (43.60%), Query Frame = 1
Query:  250 LYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKGYGFIDFINEQFAEEA-----KIYIETNYSTYPVKF-AKENEKDKT-NLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKH 744
            LY+  L     +D+L+Q       + ++K  +D   K   Y F+++     A  A        IE N       F ++++  D T NL++ ++     + D + L+  F  +    S  +M +  T  + G GFV F+S+ DA+ A++ ++         G PL   +A K 
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMIDKNNKNVNYAFVEYHQSHDANIALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLN---VNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDL----NGRPLRINWAAKR 241          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Nematostella
Match: EDO49588 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGR7])

HSP 1 Score: 93.9745 bits (232), Expect = 1.437e-22
Identity = 66/175 (37.71%), Postives = 96/175 (54.86%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELK-CKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILS-----ECGLPLEAKYAD 738
            ++SKTNLYI+GL  +  DD L +L      + S KA +D +   CKGYGF+DF +   A++A   +         + AK+ E+D TNLYI N+P+   + D   L+ +F KYG+V S  I+++K TN + GVGF R  S    E+ I+    NK +L       C   L  K+AD
Sbjct:   11 KLSKTNLYIRGLKANTTDDDLVRLCHKYGTIISTKAILDKDTNLCKGYGFVDFESPISAQKAVAALVN--KGIQAQMAKQQEQDPTNLYIQNLPQ---NCDEAMLENMFSKYGKVISTRILRDKDTN-SKGVGFARMESAEKCEQVIKDF--NKKMLPGEVSLRCIQELVVKFAD 177          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Nematostella
Match: EDO42417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1S3])

HSP 1 Score: 56.9954 bits (136), Expect = 4.879e-9
Identity = 58/219 (26.48%), Postives = 101/219 (46.12%), Query Frame = 1
Query:  226 SGRISKTN----LYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKC-KGYGFIDFINEQFAEEA-KIYIETNYSTYPVKFAKENEKDK-----TNLYITNIPKEWTSFDSDKLKRIFDKYGEV-QSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSY--PLTVTNHRAPLFADS 840
            +G I++ N    +Y+ GL    ++ L+ +L      V +V    D   +  +GYGF++F+ E+ A+ A K+         P++  K +  +K      NL+I N+  E    D   L   F  +G + Q+  IM++  T  + G  F+ F+S   ++ AIE +  N   L  C  P+   YA K +S+  +  S    + +   PL   +    LFAD+
Sbjct:    3 AGPIAERNQDATIYVGGLDEKVSEALIWELFLQSGPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAHNKNLDVGANLFIGNLDTE---VDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAM--NGQYL--CNRPITVSYAFKKESKGERHGSAAERLLAAQNPLAQADRPHQLFADA 214          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Nematostella
Match: EDO42673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S105])

HSP 1 Score: 53.9138 bits (128), Expect = 4.213e-8
Identity = 35/141 (24.82%), Postives = 70/141 (49.65%), Query Frame = 1
Query:  367 GYGFIDFINEQFAEEAKIYIET---NYSTYPVKFAKENEKD--KTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSV 774
            G+GF+D+   + A++A   +           V F++    +    NLY+ NIPK+       + ++ F+ YG + +  ++++K+T    G GFV +  + +A+ AI  L  + T      + L+ +YAD + ++ R   +V
Sbjct:   47 GFGFVDYNTTEDAQKAIDKLNGFTIGNKVLKVAFSRPGGDNTKGANLYVCNIPKQ---LPEAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLYDKKAEAQAAISSL--SGTFFPGSTMGLQIRYADDNSAKVRPPNNV 182          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Nematostella
Match: EDO34879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN30])

HSP 1 Score: 49.2914 bits (116), Expect = 1.325e-6
Identity = 48/179 (26.82%), Postives = 89/179 (49.72%), Query Frame = 1
Query:  241 KTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYS-----TYPVKFAKEN--EKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSE 753
            +TNL I  +P   + + ++++      V S K   D    +  GY F+++ N   A +A    E N +     T  V FA+ +  E    NLYI+ +PK+      ++++ +F  +G++ ++ ++++  + +  G GFVRF    +A+ AI+ L  NKT L    + L  K+A+   S 
Sbjct:    9 RTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKA--VREMNGARLQNKTLKVSFARPSSTEIKNANLYISGLPKD---MKEEEVEALFKPFGKIITSKVLKD-VSGEGRGTGFVRFDKRCEAQTAIDDLN-NKT-LPGTNVKLTVKFANPPNSR 179          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Nematostella
Match: EDO32492 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUY1])

HSP 1 Score: 47.3654 bits (111), Expect = 3.678e-6
Identity = 32/131 (24.43%), Postives = 65/131 (49.62%), Query Frame = 1
Query:  310 FPEKVKSVKAAMDDELKCKG-YGFIDFINEQFAEEAKIYIE----------TNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAI 669
            F +  K V+  M + +  KG Y F++F     A+EAK  ++           N++T      + +  +  ++++ ++ +   + D+  L++ F+ +GE+    ++++   NK+ G GFV F    DA KAI
Sbjct:   18 FNKIAKVVRCKMINSVSYKGPYCFVEFETHADAQEAKFRMDQRTVMDKKLKVNWATNHPGMKRGDTNNHFHIFVGDLAE---NVDNALLRKTFEPFGEISEVRVVKDPAKNKSKGFGFVSFVRREDAAKAI 145          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Medaka
Match: rbms2a (RNA-binding motif, single-stranded-interacting protein 2 [Source:NCBI gene;Acc:101164552])

HSP 1 Score: 98.5969 bits (244), Expect = 2.159e-22
Identity = 81/251 (32.27%), Postives = 123/251 (49.00%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDGNIKSYPLTVTNHRAPLFADSDIFPNSLLFNTMKQQDLLSLYPILLSSGHNLMSTFQNQFPY 963
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   +++  S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++     + GVGF R  S    E  I+     K I +  G+     PL  K+AD      +K+R   G        + N R P   D D    +L ++    Q+    YP   S   N M    +  PY
Sbjct:   21 QLSKTNLYIRGLHPGTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVTALKS--SGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELESMLKPFGQVISTRILRD-ANGTSRGVGFARMESTEKCEAIIQHF-NGKFIKTPPGVPAPTEPLLCKFADG----GQKKRQSQGKY------LQNGR-PWVRDGDTGGMTLAYDPAALQN--GFYPSPYSLAPNRMIAQTSLSPY 250          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Medaka
Match: rbms2a (RNA-binding motif, single-stranded-interacting protein 2 [Source:NCBI gene;Acc:101164552])

HSP 1 Score: 98.2117 bits (243), Expect = 3.299e-22
Identity = 81/251 (32.27%), Postives = 123/251 (49.00%), Query Frame = 1
Query:  232 RISKTNLYIKGL-PVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-----PLEAKYADKHKSESRKRRSVDGNIKSYPLTVTNHRAPLFADSDIFPNSLLFNTMKQQDLLSLYPILLSSGHNLMSTFQNQFPY 963
            ++SKTNLYI+GL P   + DL++   P+  K+ S KA +D    KCKGYGF+DF +   A++A   +++  S    + AK+ E+D TNLYI+N+P    S D  +L+ +   +G+V S  I+++     + GVGF R  S    E  I+     K I +  G+     PL  K+AD      +K+R   G        + N R P   D D    +L ++    Q+    YP   S   N M    +  PY
Sbjct:   39 QLSKTNLYIRGLHPGTTDQDLVKLCQPY-GKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAVTALKS--SGVQAQMAKQQEQDPTNLYISNLP---VSMDEQELESMLKPFGQVISTRILRD-ANGTSRGVGFARMESTEKCEAIIQHF-NGKFIKTPPGVPAPTEPLLCKFADG----GQKKRQSQGKY------LQNGR-PWVRDGDTGGMTLAYDPAALQN--GFYPSPYSLAPNRMIAQTSLSPY 268          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Medaka
Match: rbms1a (RNA-binding motif, single-stranded-interacting protein 1 [Source:NCBI gene;Acc:101157928])

HSP 1 Score: 97.4413 bits (241), Expect = 4.045e-22
Identity = 68/202 (33.66%), Postives = 105/202 (51.98%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL----PLEAKYAD----KHKSESRKRRSVDGNIKSYPLTVT 810
            ++SKTNLYI+GLP    D  L +L     K++S KA +D    KCKGYGF+DF +   A +A   ++T  S    + AK+ E+D TNLYI+N+P    S D  +L+++   +G+V S  I+++ + N + GVGF R  +       I         L+   L    PL  K+AD    KH        +  G+++   +T+T
Sbjct:   37 QLSKTNLYIRGLPPATTDLDLVKLCHQYGKIQSAKAILDKTTNKCKGYGFVDFDSPAAALKAVHALKT--SGIQAQMAKQQEQDPTNLYISNLP---LSVDEKELEKMLQPFGQVVSTRILRDYSGN-SRGVGFARMDTTEQCNGVISHFNGKFLKLASGSLAPSQPLLCKFADSQRKKHGHSGITPSAQTGDLRLGAMTLT 232          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Medaka
Match: rbms1a (RNA-binding motif, single-stranded-interacting protein 1 [Source:NCBI gene;Acc:101157928])

HSP 1 Score: 97.4413 bits (241), Expect = 5.958e-22
Identity = 68/202 (33.66%), Postives = 105/202 (51.98%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL----PLEAKYAD----KHKSESRKRRSVDGNIKSYPLTVT 810
            ++SKTNLYI+GLP    D  L +L     K++S KA +D    KCKGYGF+DF +   A +A   ++T  S    + AK+ E+D TNLYI+N+P    S D  +L+++   +G+V S  I+++ + N + GVGF R  +       I         L+   L    PL  K+AD    KH        +  G+++   +T+T
Sbjct:   37 QLSKTNLYIRGLPPATTDLDLVKLCHQYGKIQSAKAILDKTTNKCKGYGFVDFDSPAAALKAVHALKT--SGIQAQMAKQQEQDPTNLYISNLP---LSVDEKELEKMLQPFGQVVSTRILRDYSGN-SRGVGFARMDTTEQCNGVISHFNGKFLKLASGSLAPSQPLLCKFADSQRKKHGHSGITPSAQTGDLRLGAMTLT 232          
BLAST of RNA binding motif single stranded interacting vs. Ensembl Medaka
Match: RBMS3 (RNA binding motif single stranded interacting protein 3 [Source:NCBI gene;Acc:101166080])

HSP 1 Score: 95.1301 bits (235), Expect = 5.407e-21
Identity = 65/187 (34.76%), Postives = 102/187 (54.55%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFND-DLLEQLVPFPEKVKSVKAAMDDEL-KCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIE-----FLEKNKTILSECGLPLEAKYADKHKSESRKRRS 771
            ++SKTNLYI+GLP    D DL++   P+  K+ S KA +D    +CKGYGF+DF +   A++A   ++ N      + AK+ E+D TNLYI+N+P    S D  +L+ +   +G V S  I+++     + GVGF R  S    +  I+     FL K    ++    PL  K+AD  +   +KR++
Sbjct:   57 QLSKTNLYIRGLPPGTTDQDLIKLCQPY-GKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVASLKAN--GVQAQMAKQQEQDPTNLYISNLP---VSMDEQELENMLKPFGHVISTRILRD-ANGLSRGVGFARMESTEKCDVVIQNFNGKFL-KTPPGMTAPAEPLLCKFADGGQ---KKRQT 232          
BLAST of RNA binding motif single stranded interacting vs. Planmine SMEST
Match: SMESG000002786.1 (SMESG000002786.1)

HSP 1 Score: 555.829 bits (1431), Expect = 0.000e+0
Identity = 272/279 (97.49%), Postives = 273/279 (97.85%), Query Frame = 1
Query:  343 MDDELKCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYPLTVTNHRAPLFADSDIFPNSLLFNTMKQQDLLSLYPILLSSGHNLMSTFQNQFPYQLMNLNNQVTNTAGQWNIPFIMNDFFSSPIQNIQSADFNSAINSLSLPVNNLQLLGNFSNPNYVYNNHHITD 1179
            M+ E  C GYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYPLTVTNHR PLFADSDIFPNSLLFNTMKQQDLLSLYPILLSSGHNLMSTFQNQFPYQLMNLNNQVTNTAGQWNIPFIMNDFFSSPIQNIQSADFNSAINSLSLPVNNLQLLGN SNPNYVYNNHHITD
Sbjct:   68 MEPEYPC-GYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYPLTVTNHRTPLFADSDIFPNSLLFNTMKQQDLLSLYPILLSSGHNLMSTFQNQFPYQLMNLNNQVTNTAGQWNIPFIMNDFFSSPIQNIQSADFNSAINSLSLPVNNLQLLGNLSNPNYVYNNHHITD 345          
BLAST of RNA binding motif single stranded interacting vs. Planmine SMEST
Match: SMESG000028681.1 (SMESG000028681.1)

HSP 1 Score: 236.884 bits (603), Expect = 7.049e-74
Identity = 126/245 (51.43%), Postives = 172/245 (70.20%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYPLTVTNHRAPLFADSDIFPNSLLFNTMKQQDLLSLY--PILLSSGHNLMSTFQNQFP 960
            R SKTNLYIKGLP +FND+ LE LVP   K+KS+KAA++++ KCKGYGFIDF+ E+ A++A  YI+T    +  K+AKENEKDKTNLY+TNIPKEWTS DSDKLK  F+K+G +QSAFIM EK+TNKT GVGFVRF  E  A +A+E L++ +  L +C  P+EAK+ADKH  E+RKRR+    + S    +++ R+    +  + P + L N +      SLY  P+LL +  N++++  +Q P
Sbjct:   51 RQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDS----LSSVRSLNVGNCLLNPTAALANNL----CGSLYNQPLLLRN-QNVLASAASQVP 286          
BLAST of RNA binding motif single stranded interacting vs. Planmine SMEST
Match: SMESG000028681.1 (SMESG000028681.1)

HSP 1 Score: 235.728 bits (600), Expect = 3.614e-73
Identity = 126/245 (51.43%), Postives = 172/245 (70.20%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYPLTVTNHRAPLFADSDIFPNSLLFNTMKQQDLLSLY--PILLSSGHNLMSTFQNQFP 960
            R SKTNLYIKGLP +FND+ LE LVP   K+KS+KAA++++ KCKGYGFIDF+ E+ A++A  YI+T    +  K+AKENEKDKTNLY+TNIPKEWTS DSDKLK  F+K+G +QSAFIM EK+TNKT GVGFVRF  E  A +A+E L++ +  L +C  P+EAK+ADKH  E+RKRR+    + S    +++ R+    +  + P + L N +      SLY  P+LL +  N++++  +Q P
Sbjct:   74 RQSKTNLYIKGLPENFNDESLESLVPDKTKIKSLKAALEEDFKCKGYGFIDFLTEEDAKDALTYIQTKNPGFNAKYAKENEKDKTNLYVTNIPKEWTSKDSDKLKSYFEKFGPIQSAFIMMEKSTNKTVGVGFVRFVYELHAYEALEKLQRGEDYLLDCDKPIEAKFADKHNPETRKRRNPSHQVDS----LSSVRSLNVGNCLLNPTAALANNL----CGSLYNQPLLLRN-QNVLASAASQVP 309          
BLAST of RNA binding motif single stranded interacting vs. Planmine SMEST
Match: SMESG000005941.1 (SMESG000005941.1)

HSP 1 Score: 211.46 bits (537), Expect = 1.330e-64
Identity = 109/182 (59.89%), Postives = 133/182 (73.08%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-PLEAKYADKHKSESRKRRSV 774
            + S+TNLYIKGL  +F D+ + QL P    VKSVKAA++D+ KCKGYGFIDF+  + A     YI+  +  + +KFAKENEKDKTNLYITN+PK WTS DS+KLK IF+KYGE+QSAFIM EK  NK  GVGFVRF  E  A+ AI  LE N  ILSE    PLEAKYADKH ++SR++ S+
Sbjct:   21 KTSRTNLYIKGLHSNFTDEDILQLAPDQSLVKSVKAAIEDDKKCKGYGFIDFLTPEDAIIGLEYIQERHPNFTIKFAKENEKDKTNLYITNLPKSWTSKDSEKLKSIFEKYGEIQSAFIMLEKYANKPLGVGFVRFFHEESAQLAINDLESNHQILSEDSTGPLEAKYADKHNTDSRRKHSI 202          
BLAST of RNA binding motif single stranded interacting vs. Planmine SMEST
Match: SMESG000005941.1 (SMESG000005941.1)

HSP 1 Score: 211.46 bits (537), Expect = 1.887e-64
Identity = 109/182 (59.89%), Postives = 133/182 (73.08%), Query Frame = 1
Query:  232 RISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKGYGFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWTSFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIEFLEKNKTILSECGL-PLEAKYADKHKSESRKRRSV 774
            + S+TNLYIKGL  +F D+ + QL P    VKSVKAA++D+ KCKGYGFIDF+  + A     YI+  +  + +KFAKENEKDKTNLYITN+PK WTS DS+KLK IF+KYGE+QSAFIM EK  NK  GVGFVRF  E  A+ AI  LE N  ILSE    PLEAKYADKH ++SR++ S+
Sbjct:   35 KTSRTNLYIKGLHSNFTDEDILQLAPDQSLVKSVKAAIEDDKKCKGYGFIDFLTPEDAIIGLEYIQERHPNFTIKFAKENEKDKTNLYITNLPKSWTSKDSEKLKSIFEKYGEIQSAFIMLEKYANKPLGVGFVRFFHEESAQLAINDLESNHQILSEDSTGPLEAKYADKHNTDSRRKHSI 216          
The following BLAST results are available for this feature:
BLAST of RNA binding motif single stranded interacting vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBMS14.733e-2337.14RNA binding motif single stranded interacting prot... [more]
RBMS14.733e-2337.14RNA binding motif single stranded interacting prot... [more]
RBMS14.733e-2337.14RNA binding motif single stranded interacting prot... [more]
RBMS16.112e-2337.14RNA binding motif single stranded interacting prot... [more]
RBMS18.887e-2337.14RNA binding motif single stranded interacting prot... [more]
back to top
BLAST of RNA binding motif single stranded interacting vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sup-262.239e-2036.05SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
sup-262.239e-2036.05SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
sup-265.044e-2035.84SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
sup-265.044e-2035.84SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
sup-265.044e-2035.84SUPpressor [Source:UniProtKB/TrEMBL;Acc:D5MCQ8][more]
back to top
BLAST of RNA binding motif single stranded interacting vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
shep5.294e-2134.04gene:FBgn0052423 transcript:FBtr0077172[more]
shep5.332e-2134.04gene:FBgn0052423 transcript:FBtr0308859[more]
shep6.534e-1930.63gene:FBgn0052423 transcript:FBtr0301599[more]
shep6.534e-1930.63gene:FBgn0052423 transcript:FBtr0333287[more]
shep1.686e-1831.08gene:FBgn0052423 transcript:FBtr0333289[more]
back to top
BLAST of RNA binding motif single stranded interacting vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbms1a1.028e-2336.90RNA binding motif, single stranded interacting pro... [more]
rbms1b1.018e-2138.51RNA binding motif, single stranded interacting pro... [more]
rbms2a2.480e-2133.33RNA binding motif, single stranded interacting pro... [more]
rbms2a2.702e-2133.33RNA binding motif, single stranded interacting pro... [more]
rbms35.454e-2132.65RNA binding motif, single stranded interacting pro... [more]
back to top
BLAST of RNA binding motif single stranded interacting vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBMS22.019e-2235.26RNA binding motif single stranded interacting prot... [more]
RBMS22.246e-2235.26RNA binding motif single stranded interacting prot... [more]
RBMS22.340e-2235.26RNA binding motif single stranded interacting prot... [more]
RBMS22.475e-2235.26RNA binding motif single stranded interacting prot... [more]
RBMS22.848e-2235.26RNA binding motif single stranded interacting prot... [more]
back to top
BLAST of RNA binding motif single stranded interacting vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbms11.413e-2230.20RNA binding motif, single stranded interacting pro... [more]
Rbms21.935e-2234.18RNA binding motif, single stranded interacting pro... [more]
Rbms22.052e-2234.18RNA binding motif, single stranded interacting pro... [more]
Rbms22.616e-2234.18RNA binding motif, single stranded interacting pro... [more]
Rbms13.089e-2233.33RNA binding motif, single stranded interacting pro... [more]
back to top
BLAST of RNA binding motif single stranded interacting vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P29558|RBMS1_HUMAN4.268e-2237.14RNA-binding motif, single-stranded-interacting pro... [more]
sp|Q91W59|RBMS1_MOUSE9.886e-2230.20RNA-binding motif, single-stranded-interacting pro... [more]
sp|Q8VC70|RBMS2_MOUSE1.830e-2134.18RNA-binding motif, single-stranded-interacting pro... [more]
sp|Q15434|RBMS2_HUMAN1.874e-2134.18RNA-binding motif, single-stranded-interacting pro... [more]
sp|Q5PQP1|RBMS1_RAT2.640e-2130.20RNA-binding motif, single-stranded-interacting pro... [more]
back to top
BLAST of RNA binding motif single stranded interacting vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M5S36.346e-7153.27Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZGD53.765e-7052.80Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A4Z2DT179.366e-6655.50RNA-binding motif, single-stranded-interacting pro... [more]
A0A4E0RJ171.023e-6450.72RNA binding motif single stranded interacting OS=F... [more]
A0A1S8X6S04.496e-6447.08Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
back to top
BLAST of RNA binding motif single stranded interacting vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBMS11.839e-2235.29RNA binding motif single stranded interacting prot... [more]
RBMS11.905e-2235.29RNA binding motif single stranded interacting prot... [more]
RBMS11.963e-2235.29RNA binding motif single stranded interacting prot... [more]
rbms2a3.825e-2234.74RNA-binding motif, single-stranded-interacting pro... [more]
rbms1a1.658e-2136.36RNA-binding motif, single-stranded-interacting pro... [more]
back to top
BLAST of RNA binding motif single stranded interacting vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008168.14.466e-2235.80pep scaffold:Pmarinus_7.0:GL476829:41182:80090:-1 ... [more]
RBMS25.716e-2229.92RNA binding motif single stranded interacting prot... [more]
RBMS28.203e-1235.29RNA binding motif single stranded interacting prot... [more]
ENSPMAT00000007448.11.259e-947.54pep scaffold:Pmarinus_7.0:GL479027:131562:138944:-... [more]
pabpc42.142e-828.80poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
back to top
BLAST of RNA binding motif single stranded interacting vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PAB15.735e-927.75Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NSR12.408e-629.69Nucleolar protein that binds nuclear localization ... [more]
PUB13.405e-623.84Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
back to top
BLAST of RNA binding motif single stranded interacting vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495881.437e-2237.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424174.879e-926.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426734.213e-824.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348791.325e-626.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324923.678e-624.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA binding motif single stranded interacting vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbms2a2.159e-2232.27RNA-binding motif, single-stranded-interacting pro... [more]
rbms2a3.299e-2232.27RNA-binding motif, single-stranded-interacting pro... [more]
rbms1a4.045e-2233.66RNA-binding motif, single-stranded-interacting pro... [more]
rbms1a5.958e-2233.66RNA-binding motif, single-stranded-interacting pro... [more]
RBMS35.407e-2134.76RNA binding motif single stranded interacting prot... [more]
back to top
BLAST of RNA binding motif single stranded interacting vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002786.10.000e+097.49SMESG000002786.1[more]
SMESG000028681.17.049e-7451.43SMESG000028681.1[more]
SMESG000028681.13.614e-7351.43SMESG000028681.1[more]
SMESG000005941.11.330e-6459.89SMESG000005941.1[more]
SMESG000005941.11.887e-6459.89SMESG000005941.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012856 ID=SMED30012856|Name=RNA binding motif single stranded interacting|organism=Schmidtea mediterranea sexual|type=transcript|length=1259bp
GAAAATCAGCGCTGCAAGGCAACCGCACAAATCAAACAGTTGGTGCATGA
CTAGCACAACGAATTTATTCCAGCCAATAGCAAATCAATTCTGTGGAATC
GATCAAAATGGAATTATTAGCTTTTCTATTTTGTTGATCGGTTGTAAATA
ATATTTTTGGAGTTTTTGAATATTAAATATCAGAACACTCTCAAAAAGAA
TAATTCAAGCATCTCAAAAATTATGTCAGGGAGAATTTCTAAAACAAATC
TTTATATCAAAGGTCTACCGGTACATTTCAATGATGACCTACTTGAACAG
TTAGTTCCATTTCCGGAAAAGGTCAAATCGGTCAAAGCAGCAATGGATGA
TGAATTGAAATGCAAAGGATACGGATTCATTGACTTTATCAACGAACAAT
TTGCCGAAGAAGCTAAAATATACATAGAAACTAATTATTCTACGTATCCT
GTAAAATTTGCCAAGGAAAATGAAAAGGACAAAACGAATTTATACATAAC
AAATATTCCAAAGGAATGGACCAGTTTTGATAGTGATAAGCTGAAAAGGA
TTTTTGACAAGTATGGAGAGGTTCAGTCAGCCTTCATTATGCAAGAAAAG
ACAACAAATAAAACGACAGGAGTTGGATTCGTCAGGTTTTCCAGTGAGCA
TGATGCAGAGAAAGCAATAGAATTTCTAGAGAAAAACAAAACAATTTTAT
CGGAATGTGGCTTGCCATTGGAAGCCAAATATGCCGACAAGCACAAATCA
GAATCAAGAAAACGTCGAAGTGTTGATGGAAACATCAAGTCATATCCTCT
AACTGTAACAAATCACAGGGCCCCCCTATTTGCTGATTCAGATATCTTCC
CTAACAGTTTATTATTCAATACCATGAAACAACAGGATTTGCTCTCTCTT
TACCCAATACTTCTCTCTTCGGGACATAACCTTATGTCGACGTTTCAAAA
CCAATTCCCTTATCAACTTATGAACTTGAACAATCAAGTTACTAATACGG
CTGGTCAGTGGAATATTCCTTTTATTATGAATGACTTCTTCTCTTCTCCT
ATCCAAAATATTCAAAGTGCAGACTTCAACAGTGCGATCAACTCCTTGTC
TTTGCCAGTAAATAACCTTCAGCTACTGGGCAATTTCTCCAACCCAAACT
ATGTTTATAATAATCACCATATCACAGATTAATTCGAGGCTTTTTATTCT
TTGTTTTAATGAAACCACAGAAAATGTGACTAAATGTTGATAATAATAAT
AATAATAAT
back to top

protein sequence of SMED30012856-orf-1

>SMED30012856-orf-1 ID=SMED30012856-orf-1|Name=SMED30012856-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
MSGRISKTNLYIKGLPVHFNDDLLEQLVPFPEKVKSVKAAMDDELKCKGY
GFIDFINEQFAEEAKIYIETNYSTYPVKFAKENEKDKTNLYITNIPKEWT
SFDSDKLKRIFDKYGEVQSAFIMQEKTTNKTTGVGFVRFSSEHDAEKAIE
FLEKNKTILSECGLPLEAKYADKHKSESRKRRSVDGNIKSYPLTVTNHRA
PLFADSDIFPNSLLFNTMKQQDLLSLYPILLSSGHNLMSTFQNQFPYQLM
NLNNQVTNTAGQWNIPFIMNDFFSSPIQNIQSADFNSAINSLSLPVNNLQ
LLGNFSNPNYVYNNHHITD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 89..169
e-value: 3.7E-13
score: 59.7
coord: 9..80
e-value: 5.7E-5
score: 32.5
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 90..154
e-value: 2.0E-13
score: 49.9
coord: 10..65
e-value: 3.6E-6
score: 26.7
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 88..173
score: 16.5
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 8..73
score: 10.309
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 82..183
e-value: 1.0E-21
score: 79.0
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 3..81
e-value: 7.3E-9
score: 37.5
NoneNo IPR availablePANTHERPTHR24012RNA BINDING PROTEINcoord: 7..274
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 8..100
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 76..182