Spondin-1

Overview
NameSpondin-1
Smed IDSMED30012850
Length (bp)2699
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spondin-1 (SMED30012850) t-SNE clustered cells

Violin plots show distribution of expression levels for Spondin-1 (SMED30012850) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Spondin-1 (SMED30012850) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Spondin-1 (SMED30012850) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30012850

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30012850SMESG000009946.1 dd_Smed_v4_2400_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30012850SMESG000009946.1 Contig39681uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30012850SMESG000009946.1 Contig39681newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30012850SMESG000009946.1 dd_Smed_v6_2400_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30012850SMESG000009946.1 dd_Smed_v4_2400_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON1 (spondin 1 [Source:HGNC Symbol;Acc:HGNC:11252])

HSP 1 Score: 220.32 bits (560), Expect = 9.695e-60
Identity = 160/549 (29.14%), Postives = 259/549 (47.18%), Query Frame = 2
Query:  350 DRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHK---MIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPM-VKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEET--IKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIK---------PKHNWECTKMNAKQVKEFDE-----MNSNKNGNSQFDGSSLTKKRRHINK--KSPLD---------------DPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            D ++PG SYR+ L+ A     FR F++ A  E  +  + E H     I DE    F+ N         CP  +  +     T ++  WIAP     C+  +A +V+   + ++  G L K +C         E++        FD +T   + +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG +H+ +Y ++  GG AS+ V+ +   G    ++++  +++  +   +K+       W    +  + S   SV+RT H  SFLTMMGPSPDW  G++A D+C  +C W      DL P+DAG  +G TY  E+ ++  IP + IR + +    Q PF      +   VARV+ ++I          P +  +     A + K+ D+     + SN +  S    S+  K +R   +  K+ LD                P  ++     C  S W  W+ CS++CG+G   R R + +  +      LP  E+  C   +  C  S+ C +  W  W  C+ATC M G ++R RM 
Sbjct:   70 DFYKPGTSYRVTLSAAPPSY-FRGFTLIALRENREGDKEEDHAGTFQIIDEEETQFMSN---------CPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLC---------EQDST------FDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRAN--HWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPA-WQPLNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTY--ESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGMGMRSRERYVKQFPEDGSVCTLPTEETEKCTVNE-ECSPSS-CLMTEWGEWDECSATCGM-GMKKRHRMI 585          

HSP 2 Score: 53.9138 bits (128), Expect = 1.370e-6
Identity = 34/90 (37.78%), Postives = 44/90 (48.89%), Query Frame = 2
Query: 1598 TFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            T  C+ SPWSEW+ CSVTCG G   R R +   A+   C    L +   C   +   D    C L  WS+W  CN +C   G+  R+RM 
Sbjct:  612 TIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSLAELGDCNE-DLEQVEKCMLPECPID----CELTEWSQWSECNKSC-GKGHVIRTRMI 695          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON2 (spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253])

HSP 1 Score: 108.227 bits (269), Expect = 8.089e-25
Identity = 82/303 (27.06%), Postives = 129/303 (42.57%), Query Frame = 2
Query:  800 CCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPEN--SDRQDI------PDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCG-IGTEMRSR 1681
            C A  +A Y +TF G WS+   PK +P  +    W++L+GA H+ DY ++      S  ++     G++  L ++   E     L+S                 S  + V R H   SF+  + PSPDW  GV ++D+C  D  W++   +DL+P+DAG  +GFT+   N  +  QD         P    N+ Y  +    A  P+ARV   ++  + +       A  +   D        N   D +S+         ++PLD           C  S WS W  C   CG +GT+ R+R
Sbjct:   35 CSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEI--EAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGD-RWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPR--LKALPPIARVTLVRL--RQSPRAFIPPAPVLPSRD--------NEIVDSASV--------PETPLD-----------CEVSLWSSWGLCGGHCGRLGTKSRTR 303          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON2 (spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253])

HSP 1 Score: 108.227 bits (269), Expect = 8.089e-25
Identity = 82/303 (27.06%), Postives = 129/303 (42.57%), Query Frame = 2
Query:  800 CCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPEN--SDRQDI------PDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCG-IGTEMRSR 1681
            C A  +A Y +TF G WS+   PK +P  +    W++L+GA H+ DY ++      S  ++     G++  L ++   E     L+S                 S  + V R H   SF+  + PSPDW  GV ++D+C  D  W++   +DL+P+DAG  +GFT+   N  +  QD         P    N+ Y  +    A  P+ARV   ++  + +       A  +   D        N   D +S+         ++PLD           C  S WS W  C   CG +GT+ R+R
Sbjct:   35 CSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEI--EAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGD-RWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPR--LKALPPIARVTLVRL--RQSPRAFIPPAPVLPSRD--------NEIVDSASV--------PETPLD-----------CEVSLWSSWGLCGGHCGRLGTKSRTR 303          
BLAST of Spondin-1 vs. Ensembl Human
Match: SPON2 (spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253])

HSP 1 Score: 108.227 bits (269), Expect = 8.089e-25
Identity = 82/303 (27.06%), Postives = 129/303 (42.57%), Query Frame = 2
Query:  800 CCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPEN--SDRQDI------PDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCG-IGTEMRSR 1681
            C A  +A Y +TF G WS+   PK +P  +    W++L+GA H+ DY ++      S  ++     G++  L ++   E     L+S                 S  + V R H   SF+  + PSPDW  GV ++D+C  D  W++   +DL+P+DAG  +GFT+   N  +  QD         P    N+ Y  +    A  P+ARV   ++  + +       A  +   D        N   D +S+         ++PLD           C  S WS W  C   CG +GT+ R+R
Sbjct:   35 CSARALAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEI--EAAGEALQSVHAVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGD-RWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPR--LKALPPIARVTLVRL--RQSPRAFIPPAPVLPSRD--------NEIVDSASV--------PETPLD-----------CEVSLWSSWGLCGGHCGRLGTKSRTR 303          
BLAST of Spondin-1 vs. Ensembl Human
Match: TFPI (tissue factor pathway inhibitor [Source:HGNC Symbol;Acc:HGNC:11760])

HSP 1 Score: 67.3958 bits (163), Expect = 2.511e-11
Identity = 42/141 (29.79%), Postives = 66/141 (46.81%), Query Frame = 2
Query: 2009 CGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANK-----CRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC 2416
            C   + +YFY+     C  F+Y GC G++NNF +   C+  C    N       +    L   + S + +  K+P++        C      G    +     + R+YY++  G+CR FKY+GC GN NNF S   C++AC
Sbjct:  134 CRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQV--DNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRAN-----ENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRAC 267          

HSP 2 Score: 55.8398 bits (133), Expect = 1.616e-7
Identity = 42/138 (30.43%), Postives = 61/138 (44.20%), Query Frame = 2
Query: 2015 KPVMK-YFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANK---CRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC 2416
            K +MK +F++     C  F Y GC+G+ N F S   C+K C                     ++ N+++  K      K   C LE   G   C G +    RY+Y+N+  +C +FKY GC GN NNF +   C   C
Sbjct:   64 KAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMC---------------------TRDNANRIIKTTLQQEKPDFCFLEEDPG--ICRGYI---TRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNIC 175          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: spon-1 (SPONdin (Extracellular matrix glycoprotein) family [Source:UniProtKB/TrEMBL;Acc:Q19305])

HSP 1 Score: 255.758 bits (652), Expect = 1.483e-72
Identity = 206/800 (25.75%), Postives = 340/800 (42.50%), Query Frame = 2
Query:  344 MADRFEPGESYRIILNN--AMYGMD-FRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFL---TYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPF----TANVP-VARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCR-HLPLLESRTCEGRKRSCD----FSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF-----------ARFEEKEKCLKNKERRFKIFEEKRCK----KDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMP-----------DQI--DFMKTAPIKA-----CQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSE 2596
            ++  F PGE Y++ +      Y +  FR F + + +E   S              G + + K  G        R  G  +  L   T V   W AP     C+ F A V++  ++ +     L   +C            K  +I KP D+ +     CCAC +A Y + F G+WSK THPKD+P  + + H+T+++G++H+ +Y ++  GG ++  ++ I  +G++   K +   +     ++S     G+W  D    ++S F+ VN+ HHF S  TM GPSPDWC G+++V++C+ DCTW ++ T +L PFDAG  +G TY   N +  +  +PI  I T      PF    +  +P +A+VI ++           + + + K  D + +  +  +        K RR                    C+ + W  W+ CS TCG G  +RSR  +   K ++   H    E + C  +   C+    FS+ C + SW  WG C+  C  HG + R+R F              E K+ C+        +  +  CK     D + C     C EG+ + +        +FY   +  C+            N   K +C                  M   +   + NS++  +    A +C               G   RY+Y++   +C +F +TGC GN N F +   C + C+P           +Q+  DF  T          C+VS+W+ WG CS +CG G++ + R V++ A NGG  C E  + E
Sbjct:   59 ISKGFVPGEIYKVSIRGWRTQYTVKTFRGFVVSSLFEDNTSA-------------GSWQVVKGHGDARISPGCRQSGVSHANLKSKTSVHMMWKAPEVSSGCVVFRASVIETKYIWFTEAEGLTVKLCI----------QKGTQILKPVDDPSAT---CCACDIAQYDLEFTGIWSKNTHPKDYPTLEHLTHFTDMLGSSHSSNYSLWTIGGISTDGMKEIAEWGNT--YKAEAEAKAKASEVRSLMKVKGLWFPDVQGTTKSQFV-VNKYHHFVSLATMFGPSPDWCVGLSSVNLCLPDCTWAEERTFELQPFDAGTDSGPTYMSPN-EPTEPREPIHWITTKLNPLSPFYNSKSDTIPTLAKVILRR---------KNVTSSECKSDDILKAEAHNITNTSEDEEYKDRRE-------------------CMMTQWEPWSLCSATCGKGIRIRSRVYVFPIKAQVFHCHRQTTEKQFCNAKINECENSEAFSSKCQVSSWGSWGECSVQC-GHGMRSRNRTFLNPATKSGDCSVDLERKDICVGENGDDCNVTPDPLCKTTAWSDWSPCSAS--CDEGVRVRTRL------FFYSEHEKRCMHV----------NLQEKDTC-----------------VMQSCRRFIEINSEEICQEDKQAGQC--------------AGNFPRYWYNHEKTQCERFIFTGCKGNRNQFETEEECKQICLPGYEKSKSLIPNNQLLEDFGNTEVDDGGERVDCEVSKWTAWGSCSVSCGRGKKSRSRHVVKLARNGGHQCSEHLMQE 750          

HSP 2 Score: 53.5286 bits (127), Expect = 6.217e-7
Identity = 29/78 (37.18%), Postives = 40/78 (51.28%), Query Frame = 2
Query: 1607 CITSPWSEWTKCSVTCGIGTEMRSRDMLK---NAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATC 1831
            C  S W+ W  CSV+CG G + RSR ++K   N   +   H  L++   C  R R C     C +  WSRW PC+ +C
Sbjct:  706 CEVSKWTAWGSCSVSCGRGKKSRSRHVVKLARNGGHQCSEH--LMQELQC--RLRPCPVKLTCQVGPWSRWSPCSVSC 779          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: ZC84.1 (pep chromosome:WBcel235:III:9199450:9206285:-1 gene:WBGene00013846.1 transcript:ZC84.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC84.1)

HSP 1 Score: 83.1889 bits (204), Expect = 6.433e-16
Identity = 67/219 (30.59%), Postives = 97/219 (44.29%), Query Frame = 2
Query: 1829 CEMHGYQ---QRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDP--VIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALP-------QWRKDKMAHL-----------QFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC 2416
            CEM+  +   +R       EE ++C  N +          CK D  +C P    IC++ L +G  C + V +Y+Y+A    C  FEY GC+G+ NNF S M C+  C    NA+P       Q  KD   +             ++   +  +    PT A  C L     G+ C    G   +YYY+ +   C  F+Y GCDGNSNNF +  +C   C
Sbjct:  480 CEMYCARLQCERGSPLRIGEEAQRCQNNAQ----CPSSHECKADQGVCCPRKQTICAQPLRIGD-CTENVKRYWYNARTRQCQMFEYTGCQGNDNNFDSIMDCQNFCK---NAIPEPKCIQGQAYKDMFGNFVTCSNGMGCPANYECYFDGSQWGCCPTKAFTCSLNTD-SGIQCGA--GSTFKYYYNPQTQNCESFQYNGCDGNSNNFANRDACESYC 687          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: F30H5.3 (pep chromosome:WBcel235:III:505241:512217:-1 gene:WBGene00017937.1 transcript:F30H5.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F30H5.3)

HSP 1 Score: 80.8777 bits (198), Expect = 3.792e-15
Identity = 62/212 (29.25%), Postives = 92/212 (43.40%), Query Frame = 2
Query: 1937 RCKKDTALC--DPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTC--LAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMP----------------TMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC---------MPDQIDFMKTAPIKACQVSEWSH 2485
             C+ D  +C   P  ICS+ L +G  C + V +Y+Y+A   +C  F+Y GC+G+ NNF + + C+ TC  +      PQ    K     +   SNS      P                T A  C L   + G+ C    G   RYYY+++   C  ++Y GCDGNSNNF +   C   C          P++ +F +       QV   +H
Sbjct:  547 ECQSDHNVCCPRPQAICSQPLRLGD-CKQSVRRYWYNAVTRACEIFDYTGCQGNDNNFETLLECQNTCENIIPEPQCPQGDAYKDYQGNYYVCSNSGAGNSCPVNYECYFDGYVWGCCPTKAYTCTLS-PHKGVTCGS--GSSYRYYYNSQTQECESYQYNGCDGNSNNFATREDCEGYCGVGGCPNGGTPERNEFGQLMVCSTTQVCPGTH 754          

HSP 2 Score: 55.4546 bits (132), Expect = 1.968e-7
Identity = 42/138 (30.43%), Postives = 56/138 (40.58%), Query Frame = 2
Query: 2027 KYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTC--LAAVNALP------QWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC 2416
            +Y+YDA +  C+ F Y G  G+ NNF S   CE  C  L      P        R    A      +  SD     P     C   ++ G  +C  ++    RY+Y+     C  F YTGC GN NNF +   C   C
Sbjct:  481 RYYYDAEQGRCIAFTYNGALGNYNNFKSSADCELFCAKLQCKYGTPLKIGSSNQRCSASADCPSTHECQSDHNVCCPRPQAICSQPLRLG--DCKQSV---RRYWYNAVTRACEIFDYTGCQGNDNNFETLLECQNTC 613          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: ZC84.6 (pep chromosome:WBcel235:III:9192983:9199507:-1 gene:WBGene00013849.1 transcript:ZC84.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZC84.6)

HSP 1 Score: 78.9518 bits (193), Expect = 1.162e-14
Identity = 60/185 (32.43%), Postives = 84/185 (45.41%), Query Frame = 2
Query: 1937 RCKKDTALCDPVI--ICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWR-------KDKMAHL--------------QFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDI--RYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC 2416
             CK D A+C P +  IC++ L +G+ C + V +Y+Y AA   C  FEY GC+G+ NNF + + C+  C    NA P+ R       KD                    F+   + +     PT A  C L    G      T GP +  +Y+Y+ +   C  F+Y GCDGNSN F S   C   C
Sbjct:  440 ECKMDQAVCCPRMQTICTQPLRVGN-CDRSVRRYWYSAATRECQSFEYTGCQGNDNNFETLVDCQTFCR---NAAPEPRCPQGQAYKDNQGKFVTCTTNRQSSSCPANFECYFDGNMHGCCPTKAFTCSLSPSPG-----KTCGPGVSFKYHYNPQTQECESFEYLGCDGNSNTFASRAECENYC 615          

HSP 2 Score: 73.1738 bits (178), Expect = 8.620e-13
Identity = 52/169 (30.77%), Postives = 67/169 (39.64%), Query Frame = 2
Query: 1970 VIICSEGLIMGSSCGKPV-MKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTC-LAAVNALPQWRKDKMAHLQFQSQSNSD-----------------KRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACM 2419
               CS     G +CG  V  KY Y+     C  FEYLGC G+ N F S+  CE  C +          +D    LQ  S+ +                     +  PT    C L  + G   C G +    RYY++    +C  F Y GCDGN NNF S + C   CM
Sbjct:  560 AFTCSLSPSPGKTCGPGVSFKYHYNPQTQECESFEYLGCDGNSNTFASRAECENYCGVGGCANGGSPLRDSNGALQSCSERDGGCPSSHECYGVSLGPDMMSYRCCPTKTYICGLPPQQGSSLCSGGLTVVTRYYFNIVTRKCSPFVYNGCDGNPNNFASLNQCNNFCM 728          

HSP 3 Score: 67.0106 bits (162), Expect = 5.663e-11
Identity = 46/138 (33.33%), Postives = 60/138 (43.48%), Query Frame = 2
Query: 2027 KYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTC--LAAVNALPQWRKDKMAHLQFQSQSNSDKRKKM------PTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC 2416
            ++FYD     C PF YLG  G+ NNF S++ CE  C  L      P    D        +   S    KM      P M   C   ++ G  NCD ++    RY+Y      C+ F+YTGC GN NNF +   C   C
Sbjct:  374 RFFYDPQSGKCSPFTYLGAGGNYNNFLSRIDCELYCARLQCDRGNPLRIGDVTQSCASNNDCPSSHECKMDQAVCCPRMQTICTQPLRVG--NCDRSV---RRYWYSAATRECQSFEYTGCQGNDNNFETLVDCQTFC 506          
BLAST of Spondin-1 vs. Ensembl Celegans
Match: Y43F8B.3 (pep chromosome:WBcel235:V:19503108:19519950:1 gene:WBGene00012814.1 transcript:Y43F8B.3e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43F8B.3)

HSP 1 Score: 75.0998 bits (183), Expect = 2.043e-13
Identity = 68/270 (25.19%), Postives = 103/270 (38.15%), Query Frame = 2
Query: 1832 EMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEG--------------LIMGSSCGKPV---------MKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVN------ALPQWRKDKM-------AHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQI----DFM----------KTAPIKACQVSEWSHWG 2491
            E  G +  S  F   E  EK     +   KI E          C P  +C  G               + G  CG+P+          +++++     C+PF Y G KG+ NNF +K  C++TC    N      ALP              A++     +N D     P+  + C L +  G     G    D R+YY+ + G C+QF Y+G  GN NNF +  +C + C P+       F+           +A    C ++ W H G
Sbjct:  626 EYRGMKGNSNNFLTRENCEKRCPVFQNPCKIGEPHIQNNQYMQCSPQQVCPGGHYCHVGTEANYCCKALGGDPCGQPLDRGVGGSQLSRWYWNQQSQCCLPFSYCGQKGTQNNFLTKQDCDRTCYVFTNPCNQPIALPATLCSGTGSSDTCGANMWCHIGANQDSTVCCPSEGDPCSLPLARG----SGNQFMD-RFYYNQQTGSCQQFTYSGLHGNQNNFLTQQACEEQCGPNPCFEGRPFVGADGRTQTCSASANFNTCPLNHWCHIG 890          

HSP 2 Score: 63.929 bits (154), Expect = 4.513e-10
Identity = 55/206 (26.70%), Postives = 86/206 (41.75%), Query Frame = 2
Query: 1979 CSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTC------------LAAVNALP-QWRKDKMAHLQFQSQSNSDKRKKM--PTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSC-------IKACMPDQIDFM--------KTAPIKACQVSEWSHWGPCSTT 2506
            C E +  G      + +++YDA++  C+ F YLG KG+ NNF SK  CE TC            +  V   P Q  +       +      D    +   +  + C L VK G  N   +     R++Y++   +C+ F YTG  GN NNF     C       I AC   +   +         +A + +C ++ W H GP ++T
Sbjct:  281 CEEEMTQGEG-PSALTRFYYDASQRKCLAFNYLGLKGNRNNFQSKEHCESTCPVWTNPCAIGQPIMTVGQKPFQCHQGATCSTGYFCHLGYDDATTVCCQSEGDPCSLVVKEGSGNHHLS-----RWFYNSNTRQCQPFTYTGQGGNENNFLLREHCEATCPVWINACPSGEPYLLPNGKPQPCDSANVNSCPLTHWCHPGPDAST 480          

HSP 3 Score: 62.3882 bits (150), Expect = 1.471e-9
Identity = 48/187 (25.67%), Postives = 75/187 (40.11%), Query Frame = 2
Query: 2021 VMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAH---------------LQFQSQSNSDKRKKM--PTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQ-------------IDFMKTAPIKACQVSEWSHWG 2491
            + ++FY++    C PF Y G  G+ NNF  +  CE TC   +NA P      + +               L        D    M  P  A+ C   +  G    +G +    R+Y++ ++  C +F + G  GNSNNF+S   C KAC   Q                +  +  K+C   +W H+G
Sbjct:  398 LSRWFYNSNTRQCQPFTYTGQGGNENNFLLREHCEATCPVWINACPSGEPYLLPNGKPQPCDSANVNSCPLTHWCHPGPDASTTMCCPGKADPCTQTLAQG----EGPLS-VARFYFNAQSRTCDEFMFRGLKGNSNNFKSQEDCEKACPVQQNPCPITMSSLKHSAKLVPCSATKSCPSQQWCHYG 579          

HSP 4 Score: 60.8474 bits (146), Expect = 3.878e-9
Identity = 67/242 (27.69%), Postives = 92/242 (38.02%), Query Frame = 2
Query: 1943 KKDTALCDPV--IICSEGLIMGSSCGKPVM-KYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMP-------------------TMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMP--------------DQIDFMKTAPIKACQVSEWSHWG--PCSTTCGVGERFKWRSVLRPA 2554
             +D+ +C P     CS  L  GS  G   M +++Y+    SC  F Y G  G+ NNF ++ +CE+ C    N   + R    A  + Q+ S S      P                      N C L +  G    +G    D R+YYD +   CR F Y G  GN NNF S  +C  +C P               Q+ F       +C V+ W H G  P +T C  G        L P 
Sbjct:  787 NQDSTVCCPSEGDPCSLPLARGS--GNQFMDRFYYNQQTGSCQQFTYSGLHGNQNNFLTQQACEEQC--GPNPCFEGRPFVGADGRTQTCSASANFNTCPLNHWCHIGSDLSTTVCCPGASTNACNLPMSTG----EGNARLD-RFYYDQQTKTCRPFVYNGLKGNQNNFISLRACQLSCQPLDNPCIGQPATTAAGQVLFCSITNKDSCPVNFWCHIGATPETTVCCPGATNPCSVPLAPG 1019          

HSP 5 Score: 56.6102 bits (135), Expect = 9.794e-8
Identity = 44/155 (28.39%), Postives = 66/155 (42.58%), Query Frame = 2
Query: 2027 KYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVN-ALPQWRKDKMAHLQFQSQSNSDK---------------RKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMK 2443
            +++YD    +C PF Y G KG+ NNF S  +C+ +C    N  + Q        + F S +N D                    P   N C + +  G     G  G   RYYY+  + +C  F+Y G  GN NNF +   C + C P+Q+  + 
Sbjct:  922 RFYYDQQTKTCRPFVYNGLKGNQNNFISLRACQLSCQPLDNPCIGQPATTAAGQVLFCSITNKDSCPVNFWCHIGATPETTVCCPGATNPCSVPLAPG----TGNAG-LARYYYNPDDRQCLPFQYNGKRGNQNNFENQADCERTC-PEQLCLLS 1070          

HSP 6 Score: 54.299 bits (129), Expect = 4.919e-7
Identity = 41/142 (28.87%), Postives = 62/142 (43.66%), Query Frame = 2
Query: 2021 VMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNAL----PQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCD-----GTMGPDI-RYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC 2416
              ++ +D +   CVPFEY G KG+ NNF ++ +CEK C    N      P  + ++      Q          + T AN C   +  GG  C      G  G  + R+Y++ ++  C  F Y G  G  NNF +   C + C
Sbjct:  610 ATRWAFDGSARKCVPFEYRGMKGNSNNFLTRENCEKRCPVFQNPCKIGEPHIQNNQYMQCSPQQVCPGGHYCHVGTEANYCCKAL--GGDPCGQPLDRGVGGSQLSRWYWNQQSQCCLPFSYCGQKGTQNNFLTKQDCDRTC 749          
BLAST of Spondin-1 vs. Ensembl Fly
Match: fat-spondin (gene:FBgn0026721 transcript:FBtr0086975)

HSP 1 Score: 234.572 bits (597), Expect = 2.749e-65
Identity = 208/852 (24.41%), Postives = 342/852 (40.14%), Query Frame = 2
Query:  188 ILWMLLCLHWMIQESFAMNTRTNCFKMHKKTYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKT------------ELC-RHLPLLESRTCEGRKRSCD-----------------FSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKK------DTALCDPVIICSE---GLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDF-MKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPE-LFLSEPCFATTC 2617
            +L  L+ + W+         R      H +  +     D  +++++ D      + + PG++Y ++L  +   +  + F+ F       +         P   +G F + +      + +C N +   D++  T V+  W+AP +   C+   A V +     +   G L  VIC  K     ++                  KECCAC  A Y   F G+WS +THPKD+P    + H++++IGA+H  ++  +     A+   +S+  +G    L+ +       P L++    +G+W  + + Q+ S    V+R H   S ++M GPSPDW  G++ +D+C  DC+WK+    DLFP+DAG  +G +Y   NS+ Q    P R    T M  +P     P      +++ P       K+  ++ K       ++N + +F    L   +  ++  +   D T A      C    +S W+ CSV+CG G  MRSR  L  A              E+C   +P       + + R  D                  +  C    WS W  C+A+C + G   R+R F     +++C         I E+ +C +         L DP    S+        S+CG+ V            +    L     L N P K SC +          +  + K          N+++ K +   A             C GT    +RY YD +N  C  F Y GC GN NNF + + C+  C   +  +  +    +AC +S+WS W PCS +CGVG     R V+    NGG  C + L  S  C    C
Sbjct:    7 LLIRLIVVIWLTISMVTACPRAPTHLNHGRRTRG----DNGYKLIVADGP----NGYVPGKTYNLLLLGSRTHLKVQHFTHFTITAEAHTGARRPQAASPRR-VGRFQLFSDSLTQFNDRCVNTVSEADDLPKTEVQVMWVAPESGSGCVSLSAMVYEGPRAWFADDGNLSTVICERKPDAAAAQ------------------KECCACDEAKYSFVFEGIWSNETHPKDYPFAIWLTHFSDVIGASHESNFSFWGENHIATAGFRSLAEWGSPAALETELRAN--GPKLRTLIKAAGLWYPN-VNQNTSSKFRVDRKHPKVSLVSMFGPSPDWVVGISGLDLCTEDCSWKESMDFDLFPWDAGTDSGISYMSPNSETQ---PPERMYRITTM--YPEDPRAPFYNPKSREMTP-----LAKLYLRREKIV-----SRNCDDEF----LQALQLEVSDDAEEQD-TRAE-----CRVGDYSAWSPCSVSCGKGIRMRSRQYLYPAAADQNKCARQLVAKEMCVAAIPECADGPAQSKDRDDDEGENLANSQSLVGSNGEGAGLCKTSPWSVWSECSASCGI-GITMRTRTFVNHLGRKRC-----PHITIVEKNKCMRPDCTYEQVELPDPQCPTSQWSDWSPCSSTCGRGVT-----------IRTRLL----LLENGPDKESCTQRM--------ELHQQKECVNPIDCHINAEQAKDICVQAPD--------PGPCRGTY---MRYAYDPQNQHCYSFTYGGCRGNRNNFLTENDCLNTCNVLRSPYSSRVDQPRACVLSDWSVWSPCSVSCGVGVSESRRYVVTEPQNGGQPCSKRLVKSRSCAMPAC 763          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG17739 (gene:FBgn0033710 transcript:FBtr0087893)

HSP 1 Score: 195.282 bits (495), Expect = 2.120e-51
Identity = 199/836 (23.80%), Postives = 322/836 (38.52%), Query Frame = 2
Query:  356 FEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPD-EGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNP-INCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKP----------KHNWECTKMNAKQV---------KEFDEMNSNKNGNSQ-----FDGSSLTKKRRHINK----------------------KSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLP---LLESRTCE-----------------------------GRKRSC------------DFSAP-CSLLSWSRWGPCNATCEMHGYQQRSR------MFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVI--ICSEGLIMGSSCGKPVMKY-FYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRK----------DKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDG----NSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCG 2512
            + PG+ Y + L+ A  G+ F  F +        +L +ES     D   LG + I +        +CPN +   +    T V+  W+AP +P   CI   A V++   + +   G L K +C  ++  +              D    +V  CCAC  A Y++TF G WS+ THPKD+P       ++++IGA+HT DY  +  G  AS+ ++ +  +G +  L+ +  +++   H+++     G+   +   ++ + F  V+  HH  S ++M+ PSPDW  GV+ +++C+ +C+W ++   +L+P+DAG  +G +Y   +   Q  PD +R I     + FP     P       ++KP           +   C   +++QV           +DE  +      Q     F   +L  + R  N                         P   P+  +     C  S WSEW+ C+VTCG G   RSR  L     + C+      L E++ CE                               KRS             D+  P C +  WS + PC   C  HG +QR R            +     ++  R  K+ EE  C   +  CD ++   C + L         V  + +YD     C  +    C  + N F SK  CE+TC      LP+ ++          D +         N+           +     KYGG  C   +          R  RC    Y  CD     +   F      ++A  P+        P   C+ SEWS W PC+ TCG
Sbjct:   52 YVPGQRYNVSLS-AFSGLSFISFML--------ALDLESGDGDGDANALGTWEIADLAETRFSPRCPNLVENTNTNVKTRVDVFWVAPSSPGQGCILLRATVMQHRDVWFMDDGFLTKRMCEEEVDDI--------------DTQPSIVDPCCACDEAKYELTFEGKWSRHTHPKDFPANSWRTRFSDIIGASHTLDYRFWQYGELASEGLREVAEHGSTRTLESELKDQS--EHIRTIIKARGIAYPNVTGKTFAVF-RVDSNHHLISLVSMVDPSPDWIVGVSGLELCLPNCSWVENKVHNLYPWDAGTDSGPSYMSADQP-QVPPDVVRRIK----SNFPNDPRSPFYDPTGAQMKPLATLHINRRRLYEKNCESSDSEQVPPECATNSWSRWDECTTKCGPGKQYRIREFKNPALASRHRCNNALREEKNCVGHKCAGFNEETAEGGEPEVAPSPGSSDDPQCGLSDWSEWSSCTVTCGTGEMTRSRHYLNKKAKKKCQKASRARLHETKICEAMECGGDIENEGGAGEPEEEQAGGDGGGSAEKRSIFRNFESYSQHREDYIPPVCGVTPWSDFSPCMGPCGGHGKRQRIRKVWNNNQVYGVTDPNDDGQDPCRHIKLHEEVNCTNPS--CDTIVPGFCYDELTDSPCRDNDVANFWYYDHVSDQCAIYWSDRCDTNRNKFKSKEECEETC-----RLPRHKQELQHDGIPAIDCLVSDWVSHSCNASCGDGFQLRTRRVLRTPKYGGKPCPKHL---------VRLDRC----YQRCDDMYSISGRGFGERRHVVRAPQPE--------PQDECRYSEWSAWTPCTATCG 828          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG30046 (gene:FBgn0050046 transcript:FBtr0087895)

HSP 1 Score: 176.407 bits (446), Expect = 3.357e-45
Identity = 156/633 (24.64%), Postives = 262/633 (41.39%), Query Frame = 2
Query:  365 GESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF----IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNP-INCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDI-PDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCR----HLPLLESRTCEGR--------------------------KRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKK-----------DTALCDPVIICSEGLIMGSSCG---KPVMKYF--YDAAKHSCV-PFEYLGCKGSLNNF 2104
            G+ Y + LN A  G  +  F +        +L+ E+     ++ LG F    +I  +F      C N +   +    T++  TW+AP  P   C+   A V +   + +   G L K IC      + S+      +  P          CCAC  A Y++ F G+WS+  HPKD+P +     +  L+GA H+ DY  + +G  AS A++    +  S +L+++F+       +++     G  +   I       + V+  HH  SF + + PSPDW  GV  +++C+ +CTW ++  ++L+P+D G  +G TY   +SD+  + PD IR +     + FP     P   +    +KP        +  K+ + ++   ++++ N                     +DP +       C T PWS W+ CS  CG+G + R R      + EL R    +    E R C+G                           + S    A C L SW  W PC+ TC   GY+ R R +   + +  C      R ++ E ++C              T +  P    S G I G+  G   +P  + F  YD +++  V  FE    KG++ N+
Sbjct:   60 GQEYNVSLN-AFNGHRYISFIM--------ALENENGDFSYNDDLGRFELSDLIETRFSP---NCINMVENTNTNSKTHMHLTWVAPSEPGSGCVLIRATVQQHREVWHMDDGGLTKRICEEVTDDVESQPTAPAAVDVP----------CCACDEARYELIFEGVWSRNLHPKDFPTRGWETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHCSSRLLEREFSINFRDQKIRTIIKARGP-SYPNISSKTMASVRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTY--TSSDQPQVPPDVIRRMR----SDFPNDPRSPFYDISGTPMKP-----MAILTVKRQRIYERRCADEDSN---------------------NDPDVPRE----CFTHPWSSWSDCSSKCGVGMQYRRRVY---KQPELARVYNCNEAQYEERECQGEMCGQNNLMREPEEFEDLEPDPRRIGYQPSQQRRAECELSSWGSWSPCSVTC-GDGYEMRQRQYLNPQAEFDC--QGVHRMELQETRKCSGRDCLGSLPGSYSTDMDSPYGGASPGRIGGNMYGPQLEPEAENFGDYDDSRNGAVGGFEVGNLKGNIGNW 627          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG30046 (gene:FBgn0050046 transcript:FBtr0339627)

HSP 1 Score: 176.407 bits (446), Expect = 3.357e-45
Identity = 156/633 (24.64%), Postives = 262/633 (41.39%), Query Frame = 2
Query:  365 GESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF----IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNP-INCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDI-PDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCR----HLPLLESRTCEGR--------------------------KRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKK-----------DTALCDPVIICSEGLIMGSSCG---KPVMKYF--YDAAKHSCV-PFEYLGCKGSLNNF 2104
            G+ Y + LN A  G  +  F +        +L+ E+     ++ LG F    +I  +F      C N +   +    T++  TW+AP  P   C+   A V +   + +   G L K IC      + S+      +  P          CCAC  A Y++ F G+WS+  HPKD+P +     +  L+GA H+ DY  + +G  AS A++    +  S +L+++F+       +++     G  +   I       + V+  HH  SF + + PSPDW  GV  +++C+ +CTW ++  ++L+P+D G  +G TY   +SD+  + PD IR +     + FP     P   +    +KP        +  K+ + ++   ++++ N                     +DP +       C T PWS W+ CS  CG+G + R R      + EL R    +    E R C+G                           + S    A C L SW  W PC+ TC   GY+ R R +   + +  C      R ++ E ++C              T +  P    S G I G+  G   +P  + F  YD +++  V  FE    KG++ N+
Sbjct:   60 GQEYNVSLN-AFNGHRYISFIM--------ALENENGDFSYNDDLGRFELSDLIETRFSP---NCINMVENTNTNSKTHMHLTWVAPSEPGSGCVLIRATVQQHREVWHMDDGGLTKRICEEVTDDVESQPTAPAAVDVP----------CCACDEARYELIFEGVWSRNLHPKDFPTRGWETRFCELLGAAHSSDYRFWESGELASVAMKEYAEHCSSRLLEREFSINFRDQKIRTIIKARGP-SYPNISSKTMASVRVDPIHHMVSFASKIEPSPDWIVGVTGLELCLRNCTWMEEKVINLYPWDVGTDSGPTY--TSSDQPQVPPDVIRRMR----SDFPNDPRSPFYDISGTPMKP-----MAILTVKRQRIYERRCADEDSN---------------------NDPDVPRE----CFTHPWSSWSDCSSKCGVGMQYRRRVY---KQPELARVYNCNEAQYEERECQGEMCGQNNLMREPEEFEDLEPDPRRIGYQPSQQRRAECELSSWGSWSPCSVTC-GDGYEMRQRQYLNPQAEFDC--QGVHRMELQETRKCSGRDCLGSLPGSYSTDMDSPYGGASPGRIGGNMYGPQLEPEAENFGDYDDSRNGAVGGFEVGNLKGNIGNW 627          
BLAST of Spondin-1 vs. Ensembl Fly
Match: CG30203 (gene:FBgn0050203 transcript:FBtr0273303)

HSP 1 Score: 174.096 bits (440), Expect = 2.126e-44
Identity = 144/607 (23.72%), Postives = 246/607 (40.53%), Query Frame = 2
Query:  203 LCLHWMIQESFAMNTRTNCFKMHKKTYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMED-SLQMESHKMIPDEGLGHFIINKKFGLVDYK----CPNRMHGNDNMFLTYVESTWIAPHNP-INCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLK-NAKTELCRHLPLLESRTCEGRK--------------------RSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRC 1942
            +  H ++    +   R  C ++ +         D  F+I+I        + + P   Y + L+  +  M F  F++    E ED S       M      GHF +    G+ D +    C N +   +     Y+  +WIAP NP   C+  +A VV+   + +   G L K ICP ++ ++ S              +TP ++ CCAC  A Y++     W++ TH KD+P +        +IGA+H+  Y  +  GG+AS+ ++ +  +G +  L+ +  E T    +++     G+    +   +      ++  HH  S    + PSPDW  GVA +++C+++CTW +   ++L+P+D G  +G +Y   + + Q  PD +R I ++Y    P     P        +KP      T+     ++E +E                      + ++ PL+           C   PW+EWT CS  CG G   R R     N          L E R C+G +                     S    A C L +W  W PC  TC   G   R+R +   + +++CL     R  + E + C
Sbjct:    1 MLRHIVLLILLSSEVRGVCNRIPQGASGPRSPVDDNFKILI----DGNPETYVPEHQYNVSLSCPI-NMKFVSFTLVV--EAEDPSAAFGGQDMT-----GHFEL---LGVGDTRFSTSCENMVENTNTNAKIYIAVSWIAPRNPDSGCVLIKAGVVQHRDVWFLDDGFLTKRICPEEIDELNS--------------LTPPLETCCACDEAKYEIVLERKWARNTHWKDFPSEDWRTRLGEVIGASHSHSYRYWAYGGRASKGMKELAEHGATRTLENEIRENTQNGEVRTIIKAPGIPYRPKTFGTTLANARLDPVHHQISLAAKIDPSPDWILGVAGLELCLSNCTWLERKVLNLYPWDIGTDSGPSYM-SSDEPQVPPDVVRRITSSY----PSDHRSPFYDDTGAPMKPLATLYLTRKKL-YIRECEE----------------------VPQEGPLE-----------CAVHPWNEWTNCSTRCGQGYSHRQRSFKNPNLAANFNCDRRLEEFRQCQGTQCGAAEEELEGEEPGLGMENPPSSGSMAECQLTNWGEWSPCTKTC-GRGSSTRTRDYYNPQARQRCL--SVMRIPLEETREC 536          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 224.172 bits (570), Expect = 2.735e-61
Identity = 165/572 (28.85%), Postives = 264/572 (46.15%), Query Frame = 2
Query:  275 KTYQKVMMKDG--EFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMW---NEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKC-SVTCGIGTEMRSRDMLKNAKTELCRHLPLLESR---TCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARF-----------EEKEKCLKNKE 1909
            +T  +   +DG  EFR+ +        + ++PG +YR+ L  +     FR F++ A  E  + +        PD+  G F +I++        CP  +  +     T ++  W AP +   C+  +A VV+   + ++  G L K +C         E++      KP        +ECCACG A Y+VTF G WS+K HPKD+P++ +  HW+ LIGA+HT  Y ++  GG AS+ V+ +  YG    ++++  ++     + +   T   W       I  + S   SV+R  H  SFLTM+GPSPDW  G++  D+C  DC W      DL P+DAG  +G +Y  E+ ++  IP + IR + +    Q PF         P+ RV+ ++I  K   +C  +        D++ ++     + +G +  +                       CI S WS W+ C S TC  G  MR R ML   K +L  +LP L ++    C G   S + ++ C +  W  W PC+A+C M G + R R   +F           EE EKC+ N +
Sbjct:   44 RTQARSARRDGQNEFRLKVEGE----PETYQPGSTYRVSLYASSPSY-FRGFTLIALKEGREGVS-------PDDYAGTFKLIDESDTQFMTNCPPAVTESIPRRRTRIQVFWTAPPSGSGCVTLKASVVQRRIIFFQDEGSLTKRLC---------EKDPVAITEKP-------AQECCACGTAKYRVTFYGNWSEKLHPKDYPRRAN--HWSALIGASHTRSYVLWEYGGFASEGVKQVAEYGSPVKMEEEIRQK--GDDVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSY--ESPNKPSIPQERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIARKGE-QCNTVP----DTIDDIVADIAQEEKEEGDNTPE----------------------TCIYSNWSPWSACSSSTCDKGRRMRQR-ML---KAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGM-GMRSRERYVKQFPEDGSSCTLPTEETEKCVVNDD 549          

HSP 2 Score: 51.6026 bits (122), Expect = 4.366e-6
Identity = 32/90 (35.56%), Postives = 43/90 (47.78%), Query Frame = 2
Query: 1598 TFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
              +C+ SPWS+W +CSV+CG+G   R R +    K   C    L +   C   +   D    C L  WS W  CN +C   G+  RSRM 
Sbjct:  608 AVVCMLSPWSDWGECSVSCGVGMRTRQRMLKTPVKPGQCPD-ELEQVEKCMLPECPTD----CMLSEWSAWSECNKSC-GKGHMIRSRMV 691          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 223.787 bits (569), Expect = 4.120e-61
Identity = 165/572 (28.85%), Postives = 264/572 (46.15%), Query Frame = 2
Query:  275 KTYQKVMMKDG--EFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMW---NEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKC-SVTCGIGTEMRSRDMLKNAKTELCRHLPLLESR---TCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARF-----------EEKEKCLKNKE 1909
            +T  +   +DG  EFR+ +        + ++PG +YR+ L  +     FR F++ A  E  + +        PD+  G F +I++        CP  +  +     T ++  W AP +   C+  +A VV+   + ++  G L K +C         E++      KP        +ECCACG A Y+VTF G WS+K HPKD+P++ +  HW+ LIGA+HT  Y ++  GG AS+ V+ +  YG    ++++  ++     + +   T   W       I  + S   SV+R  H  SFLTM+GPSPDW  G++  D+C  DC W      DL P+DAG  +G +Y  E+ ++  IP + IR + +    Q PF         P+ RV+ ++I  K   +C  +        D++ ++     + +G +  +                       CI S WS W+ C S TC  G  MR R ML   K +L  +LP L ++    C G   S + ++ C +  W  W PC+A+C M G + R R   +F           EE EKC+ N +
Sbjct:   44 RTQARSARRDGQNEFRLKVEGE----PETYQPGSTYRVSLYASSPSY-FRGFTLIALKEGREGVS-------PDDYAGTFKLIDESDTQFMTNCPPAVTESIPRRRTRIQVFWTAPPSGSGCVTLKASVVQRRIIFFQDEGSLTKRLC---------EKDPVAITEKP-------AQECCACGTAKYRVTFYGNWSEKLHPKDYPRRAN--HWSALIGASHTRSYVLWEYGGFASEGVKQVSEYGSPVKMEEEIRQKGD--DVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSY--ESPNKPSIPQERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIARKGE-QCNTVP----DTIDDIVADIAQEEKEEGDNTPE----------------------TCIYSNWSPWSACSSSTCDKGRRMRQR-ML---KAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGM-GMRSRERYVKQFPEDGSSCTLPTEETEKCVVNDD 549          

HSP 2 Score: 51.2174 bits (121), Expect = 6.130e-6
Identity = 32/90 (35.56%), Postives = 43/90 (47.78%), Query Frame = 2
Query: 1598 TFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
              +C+ SPWS+W +CSV+CG+G   R R +    K   C    L +   C   +   D    C L  WS W  CN +C   G+  RSRM 
Sbjct:  608 AVVCMLSPWSDWGECSVSCGVGMRTRQRMLKTPVKPGQCPDE-LEQVEKCMLPECPTD----CMLSEWSAWSECNKSC-GKGHMIRSRMV 691          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 223.402 bits (568), Expect = 4.653e-61
Identity = 165/572 (28.85%), Postives = 264/572 (46.15%), Query Frame = 2
Query:  275 KTYQKVMMKDG--EFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMW---NEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKC-SVTCGIGTEMRSRDMLKNAKTELCRHLPLLESR---TCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARF-----------EEKEKCLKNKE 1909
            +T  +   +DG  EFR+ +        + ++PG +YR+ L  +     FR F++ A  E  + +        PD+  G F +I++        CP  +  +     T ++  W AP +   C+  +A VV+   + ++  G L K +C         E++      KP        +ECCACG A Y+VTF G WS+K HPKD+P++ +  HW+ LIGA+HT  Y ++  GG AS+ V+ +  YG    ++++  ++     + +   T   W       I  + S   SV+R  H  SFLTM+GPSPDW  G++  D+C  DC W      DL P+DAG  +G +Y  E+ ++  IP + IR + +    Q PF         P+ RV+ ++I  K   +C  +        D++ ++     + +G +  +                       CI S WS W+ C S TC  G  MR R ML   K +L  +LP L ++    C G   S + ++ C +  W  W PC+A+C M G + R R   +F           EE EKC+ N +
Sbjct:   44 RTQARSARRDGQNEFRLKVEGE----PETYQPGSTYRVSLYASSPSY-FRGFTLIALKEGREGVS-------PDDYAGTFKLIDESDTQFMTNCPPAVTESIPRRRTRIQVFWTAPPSGSGCVTLKASVVQRRIIFFQDEGSLTKRLC---------EKDPVAITEKP-------AQECCACGTAKYRVTFYGNWSEKLHPKDYPRRAN--HWSALIGASHTRSYVLWEYGGFASEGVKQVSEYGSPVKMEEEIRQKGD--DVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSY--ESPNKPSIPQERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIARKGE-QCNTVP----DTIDDIVADIAQEEKEEGDNTPE----------------------TCIYSNWSPWSACSSSTCDKGRRMRQR-ML---KAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGM-GMRSRERYVKQFPEDGSSCTLPTEETEKCVVNDD 549          

HSP 2 Score: 51.2174 bits (121), Expect = 6.232e-6
Identity = 32/90 (35.56%), Postives = 43/90 (47.78%), Query Frame = 2
Query: 1598 TFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
              +C+ SPWS+W +CSV+CG+G   R R +    K   C    L +   C   +   D    C L  WS W  CN +C   G+  RSRM 
Sbjct:  608 AVVCMLSPWSDWGECSVSCGVGMRTRQRMLKTPVKPGQCPDE-LEQVEKCMLPECPTD----CMLSEWSAWSECNKSC-GKGHMIRSRMV 691          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 218.009 bits (554), Expect = 2.671e-59
Identity = 168/572 (29.37%), Postives = 266/572 (46.50%), Query Frame = 2
Query:  275 KTYQKVMMKDG--EFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMW---NEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKC-SVTCGIGTEMRSRDMLKNAKTELCRHLPLLESR---TCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARF-----------EEKEKCLKNKE 1909
            +T  +   +DG  EFR+ +        + ++PG +YR+ L  +     FR F++ A  E  + +        PD+  G F +I++        CP  +  +     T ++  W AP +   C+  +A VV+   + ++  G L K +C         +E+ N       +  T  VK CCACG A Y+VTF G WS+K HPKD+P++ +  HW+ LIGA+HT  Y ++  GG AS+ V+ +  YG    ++++  ++     + +   T   W       I  + S   SV+R  H  SFLTM+GPSPDW  G++  D+C  DC W      DL P+DAG  +G +Y  E+ ++  IP + IR + +    Q PF         P+ RV+ ++I  K   +C  +        D++ ++                  I ++   +D T        CI S WS W+ C S TC  G  MR R ML   K +L  +LP L ++    C G   S + ++ C +  W  W PC+A+C M G + R R   +F           EE EKC+ N +
Sbjct:   29 RTQARSARRDGQNEFRLKVEGE----PETYQPGSTYRVSLYASSPSY-FRGFTLIALKEGREGVS-------PDDYAGTFKLIDESDTQFMTNCPPAVTESIPRRRTRIQVFWTAPPSGSGCVTLKASVVQRRIIFFQDEGSLTKRLC--------EKESLN-------EHCTNKVK-CCACGTAKYRVTFYGNWSEKLHPKDYPRRAN--HWSALIGASHTRSYVLWEYGGFASEGVKQVAEYGSPVKMEEEIRQK--GDDVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDRVRHLMSFLTMLGPSPDWNVGLSGEDLCTRDCGWVQKLVKDLVPWDAGTDSGVSY--ESPNKPSIPQERIRPLTSLDHPQSPFYDPSGGPMTPLGRVVVERIARKGE-QCNTVP----DTIDDIVAD------------------IAQEEKEEDNTPET-----CIYSNWSPWSACSSSTCDKGRRMRQR-ML---KAQLDPNLPCLHTQDFEPCMGPGCSEEEASTCMMSEWISWSPCSASCGM-GMRSRERYVKQFPEDGSSCTLPTEETEKCVVNDD 533          

HSP 2 Score: 51.6026 bits (122), Expect = 4.678e-6
Identity = 32/90 (35.56%), Postives = 43/90 (47.78%), Query Frame = 2
Query: 1598 TFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
              +C+ SPWS+W +CSV+CG+G   R R +    K   C    L +   C   +   D    C L  WS W  CN +C   G+  RSRM 
Sbjct:  592 AVVCMLSPWSDWGECSVSCGVGMRTRQRMLKTPVKPGQCPD-ELEQVEKCMLPECPTD----CMLSEWSAWSECNKSC-GKGHMIRSRMV 675          
BLAST of Spondin-1 vs. Ensembl Zebrafish
Match: spon1a (spondin 1a [Source:ZFIN;Acc:ZDB-GENE-000427-9])

HSP 1 Score: 216.083 bits (549), Expect = 1.834e-58
Identity = 166/589 (28.18%), Postives = 266/589 (45.16%), Query Frame = 2
Query:  308 EFRIVIRDMKGKMADRFEPGESYRIIL--NNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMT--PMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGM------WNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIK---------PKHNWECTKMNAKQVKEFDE-----MNSNKNGNSQFDGSSLTKKRR-----------------HINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF-----------ARFEEKEKCL 1897
            EFR+ +        + ++PG +YR+ L   N  Y   FR F++ A  E  +  Q E +        G+F II+++       CP  +  +     T ++  W AP +   C+  +A +V+   + ++  G L K +C          E +++     + E T  P++ +CCACG A Y+VTF G WS+K HPKD+P++ +  HW+ LIGA+H+ +Y ++  GG AS+ V+ +   G    +     EE I+           M      W    +  + S   SV+RT H  SFLTM+GPSPDW  G+++ D+C  +C W      DL P+DAG  +G +Y  E+ ++   P + IR + +    Q PF      A  PVAR++ ++I          P +  +     A++ KE D+     + SN +  S    S+  K +R                 H     P   P  ++  +  C+ S W  W+ CSV+CG G   R R + +          P  E+  C   +  C  S+ C +  W  W  C+ATC + G ++R RM            A   E EKC+
Sbjct:   60 EFRLRVEGD----PEHYQPGSTYRVTLYATNPAY---FRGFTLIALKEGHNGDQEEDYA-------GNFQIIDEEDTQFMTSCPPAVTESTPRRRTRIQVFWTAPPSGHGCVLLKASIVQRKIISFQDEGSLTKRMC----------EKESL-----YGETTDKPLL-DCCACGTAKYRVTFYGNWSEKLHPKDYPRRAN--HWSALIGASHSKNYILWEYGGYASEGVKQVAELGSPVKM-----EEEIRQKGDEVLTVIKMKAQWPAWQPLNVRAAPSAEFSVDRTRHLMSFLTMLGPSPDWNVGLSSEDLCTRECGWVQKVVQDLIPWDAGTDSGVSY--ESPNKSTAPQEKIRPLTSLDHPQSPFYDPEGGAITPVARLVVERIARKGEQCNIVPDNVDDIVADIAQEEKEEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPHTQDFEPCMGPGCSDEDSSTCMMSEWITWSPCSVSCGSGLRSRERYVKQFPDDGFACTHPTEETEPCTVNEE-CSPSS-CLVTEWGEWDACSATCGL-GMKRRERMVKMPPSDGSICGAEVVEVEKCM 606          

HSP 2 Score: 50.8322 bits (120), Expect = 6.977e-6
Identity = 36/93 (38.71%), Postives = 48/93 (51.61%), Query Frame = 2
Query: 1598 TFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSC---DFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            T  C+ SPWS+W+ CSVTCG GT +R R MLK+A  EL      LE      +   C   +    C +  WS W  C+ +C   G+  R+RM 
Sbjct:  612 TIPCLLSPWSDWSDCSVTCGKGTRVRQR-MLKSA-VELGECNEDLE------QMEKCMLPECPMDCIMSEWSEWSECSKSC-GKGHLLRTRMI 695          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 218.779 bits (556), Expect = 2.813e-59
Identity = 160/540 (29.63%), Postives = 253/540 (46.85%), Query Frame = 2
Query:  356 FEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAE--ETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKC-SVTCGIGTEMRSRDMLKNAKTELCRHLPLLES-RTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARF-----------EEKEKCLKNKE 1909
            ++PG +YR+ L  A     FR F++ A  E ++  + E H        G F II+ +       CP  +  +     T ++  W AP     C+  +A +V+   + ++  G L K +C   +    + E  N K           + +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG +H+ +Y ++  GGQAS  V+ +   G    ++++  +  + +   +K+       W    +  + S   SV+R+ H  SFL MMGPSPDW  G+++ D+C  +C W      DL P+DAG  +G TY  E+ ++  IP D IR + +    Q PF        +PVARV+ ++I                ++ D+ N   +         +T+++         DD          CI S WS W+ C S TC  G  MR R MLK A+ +L    P  +    C G   S D ++ C +  W  W PC+A+C M G + R R   +F           EE EKC+ N+E
Sbjct:   68 YKPGNTYRVTLLAASPAY-FRGFTLIALKEGKEGEKEEDHA-------GTFQIIDDEDTQFMSNCPVAVTESTPRRRTRIQVLWTAPPIGSGCVILKASIVQKKIIYFQDEGSLTKRMCEPDL----TLEGGNEKP----------IPDCCACGTAKYRLTFYGNWSEKTHPKDYPRRAN--HWSAIIGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKAKAQWPA-WQPLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTY--ESPNKPSIPQDKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERI---------------ARKGDQCNIVPDNVDDIVPDLVTEEKEE-------DD------TPETCIYSNWSPWSACSSATCDKGKRMRQR-MLK-AQLDLSVPCPDTQDFEPCMGPGCSDDEASTCMMSEWITWSPCSASCGM-GMRSRERYVKQFPEDGSMCKVPTEETEKCIVNEE 549          

HSP 2 Score: 60.4622 bits (145), Expect = 1.186e-8
Identity = 53/166 (31.93%), Postives = 67/166 (40.36%), Query Frame = 2
Query: 1535 KKRRHINKKSPLD------DPT------LANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFA-------------------RFEEKEKCLKNKERRFKIFEEKR 1939
            KKR  + K +P D      D T      +    T  C+ SPWSEW+ CSVTCG GT  R R +   A+   C    L +   C      C  S  C L  WS W  CN +C   G+  R+RM                     R  + +K   N+ RR K   EKR
Sbjct:  575 KKRHRMIKMTPADGSMCKADTTEVEKCMMPECHTIPCVLSPWSEWSDCSVTCGKGTRTRQRMLKSPAELGDCNE-ELKQVEKC--MLPECPIS--CELTEWSYWSECNKSC-GKGHMIRTRMITMEPQFGGAVCPETVQRKKCRLRKCQKSSGNERRRLKEAREKR 734          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 218.009 bits (554), Expect = 4.329e-59
Identity = 158/540 (29.26%), Postives = 250/540 (46.30%), Query Frame = 2
Query:  356 FEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAE--ETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKC-SVTCGIGTEMRSRDMLKNAKTELCRHLPLLES-RTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARF-----------EEKEKCLKNKE 1909
            ++PG +YR+ L  A     FR F++ A  E ++  + E H        G F II+ +       CP  +  +     T ++  W AP     C+  +A +V+   + ++  G L K +C      +     K              + +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG +H+ +Y ++  GGQAS  V+ +   G    ++++  +  + +   +K+       W    +  + S   SV+R+ H  SFL MMGPSPDW  G+++ D+C  +C W      DL P+DAG  +G TY  E+ ++  IP D IR + +    Q PF        +PVARV+ ++I                ++ D+ N   +         +T+++         DD          CI S WS W+ C S TC  G  MR R MLK A+ +L    P  +    C G   S D ++ C +  W  W PC+A+C M G + R R   +F           EE EKC+ N+E
Sbjct:   64 YKPGNTYRVTLLAASPAY-FRGFTLIALKEGKEGEKEEDHA-------GTFQIIDDEDTQFMSNCPVAVTESTPRRRTRIQVLWTAPPIGSGCVILKASIVQKKIIYFQDEGSLTKRMCEPDRLGLTGGNEKP-------------IPDCCACGTAKYRLTFYGNWSEKTHPKDYPRRAN--HWSAIIGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKAKAQWPA-WQPLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTY--ESPNKPSIPQDKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERI---------------ARKGDQCNIVPDNVDDIVPDLVTEEKEE-------DD------TPETCIYSNWSPWSACSSATCDKGKRMRQR-MLK-AQLDLSVPCPDTQDFEPCMGPGCSDDEASTCMMSEWITWSPCSASCGM-GMRSRERYVKQFPEDGSMCKVPTEETEKCIVNEE 546          

HSP 2 Score: 60.4622 bits (145), Expect = 1.334e-8
Identity = 53/166 (31.93%), Postives = 67/166 (40.36%), Query Frame = 2
Query: 1535 KKRRHINKKSPLD------DPT------LANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFA-------------------RFEEKEKCLKNKERRFKIFEEKR 1939
            KKR  + K +P D      D T      +    T  C+ SPWSEW+ CSVTCG GT  R R +   A+   C    L +   C      C  S  C L  WS W  CN +C   G+  R+RM                     R  + +K   N+ RR K   EKR
Sbjct:  572 KKRHRMIKMTPADGSMCKADTTEVEKCMMPECHTIPCVLSPWSEWSDCSVTCGKGTRTRQRMLKSPAELGDCNE-ELKQVEKC--MLPECPIS--CELTEWSYWSECNKSC-GKGHMIRTRMITMEPQFGGAVCPETVQRKKCRLRKCQKSSGNERRRLKEAREKR 731          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 215.312 bits (547), Expect = 2.104e-58
Identity = 161/540 (29.81%), Postives = 252/540 (46.67%), Query Frame = 2
Query:  356 FEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAE--ETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKC-SVTCGIGTEMRSRDMLKNAKTELCRHLPLLES-RTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARF-----------EEKEKCLKNKE 1909
            ++PG +YR+ L  A     FR F++ A  E ++  + E H        G F II+ +       CP  +  +     T ++  W AP     C+  +A +V+   + ++  G L K +C   +    + E  N K           + +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG +H+ +Y ++  GGQAS  V+ +   G    ++++  +  + +   +K+       W    +  + S   SV+R+ H  SFL MMGPSPDW  G+++ D+C  +C W      DL P+DAG  +G TY  E+ ++  IP D IR + +    Q PF        +PVARV+ ++I                ++ D+ N   +         +T+++         DD          CI S WS W+ C S TC  G  MR R MLK A+ +L    P  +    C G   S D S  C +  W  W PC+A+C M G + R R   +F           EE EKC+ N+E
Sbjct:   68 YKPGNTYRVTLLAASPAY-FRGFTLIALKEGKEGEKEEDHA-------GTFQIIDDEDTQFMSNCPVAVTESTPRRRTRIQVLWTAPPIGSGCVILKASIVQKKIIYFQDEGSLTKRMCEPDL----TLEGGNEK----------PIPDCCACGTAKYRLTFYGNWSEKTHPKDYPRRAN--HWSAIIGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKAKAQWPA-WQPLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTY--ESPNKPSIPQDKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERI---------------ARKGDQCNIVPDNVDDIVPDLVTEEKEE-------DD------TPETCIYSNWSPWSACSSATCDKGKRMRQR-MLK-AQLDLSVPCPDTQDFEPCMGPGCSDDAST-CMMSEWITWSPCSASCGM-GMRSRERYVKQFPEDGSMCKVPTEETEKCIVNEE 548          

HSP 2 Score: 60.077 bits (144), Expect = 1.408e-8
Identity = 45/133 (33.83%), Postives = 56/133 (42.11%), Query Frame = 2
Query: 1598 TFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFA-------------------RFEEKEKCLKNKERRFKIFEEKR 1939
            T  C+ SPWSEW+ CSVTCG GT  R R +   A+   C    L +   C      C  S  C L  WS W  CN +C   G+  R+RM                     R  + +K   N+ RR K   EKR
Sbjct:  551 TIPCVLSPWSEWSDCSVTCGKGTRTRQRMLKSPAELGDCNE-ELKQVEKC--MLPECPIS--CELTEWSYWSECNKSC-GKGHMIRTRMITMEPQFGGAVCPETVQRKKCRLRKCQKSSGNERRRLKEAREKR 677          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 216.083 bits (549), Expect = 2.580e-58
Identity = 162/540 (30.00%), Postives = 252/540 (46.67%), Query Frame = 2
Query:  356 FEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAE--ETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKC-SVTCGIGTEMRSRDMLKNAKTELCRHLPLLES-RTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARF-----------EEKEKCLKNKE 1909
            ++PG +YR+ L  A     FR F++ A  E ++  + E H        G F II+ +       CP  +  +     T ++  W AP     C+  +A +V+   + ++  G L K +C         EE+      KP       + +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG +H+ +Y ++  GGQAS  V+ +   G    ++++  +  + +   +K+       W    +  + S   SV+R+ H  SFL MMGPSPDW  G+++ D+C  +C W      DL P+DAG  +G TY  E+ ++  IP D IR + +    Q PF        +PVARV+ ++I                ++ D+ N   +         +T+++         DD          CI S WS W+ C S TC  G  MR R MLK A+ +L    P  +    C G   S D S  C +  W  W PC+A+C M G + R R   +F           EE EKC+ N+E
Sbjct:   68 YKPGNTYRVTLLAASPAY-FRGFTLIALKEGKEGEKEEDH-------AGTFQIIDDEDTQFMSNCPVAVTESTPRRRTRIQVLWTAPPIGSGCVILKASIVQKKIIYFQDEGSLTKRMCE-------PEESIYWGNEKP-------IPDCCACGTAKYRLTFYGNWSEKTHPKDYPRRAN--HWSAIIGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKAKAQWPA-WQPLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTY--ESPNKPSIPQDKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERI---------------ARKGDQCNIVPDNVDDIVPDLVTEEKEE-------DD------TPETCIYSNWSPWSACSSATCDKGKRMRQR-MLK-AQLDLSVPCPDTQDFEPCMGPGCSDDAST-CMMSEWITWSPCSASCGM-GMRSRERYVKQFPEDGSMCKVPTEETEKCIVNEE 548          

HSP 2 Score: 60.4622 bits (145), Expect = 1.280e-8
Identity = 53/166 (31.93%), Postives = 67/166 (40.36%), Query Frame = 2
Query: 1535 KKRRHINKKSPLD------DPT------LANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFA-------------------RFEEKEKCLKNKERRFKIFEEKR 1939
            KKR  + K +P D      D T      +    T  C+ SPWSEW+ CSVTCG GT  R R +   A+   C    L +   C      C  S  C L  WS W  CN +C   G+  R+RM                     R  + +K   N+ RR K   EKR
Sbjct:  574 KKRHRMIKMTPADGSMCKADTTEVEKCMMPECHTIPCVLSPWSEWSDCSVTCGKGTRTRQRMLKSPAELGDCNE-ELKQVEKC--MLPECPIS--CELTEWSYWSECNKSC-GKGHMIRTRMITMEPQFGGAVCPETVQRKKCRLRKCQKSSGNERRRLKEAREKR 733          
BLAST of Spondin-1 vs. Ensembl Xenopus
Match: spon1 (spondin 1, extracellular matrix protein [Source:NCBI gene;Acc:100036727])

HSP 1 Score: 215.698 bits (548), Expect = 3.514e-58
Identity = 161/540 (29.81%), Postives = 252/540 (46.67%), Query Frame = 2
Query:  356 FEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAE--ETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKC-SVTCGIGTEMRSRDMLKNAKTELCRHLPLLES-RTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARF-----------EEKEKCLKNKE 1909
            ++PG +YR+ L  A     FR F++ A  E ++  + E H        G F II+ +       CP  +  +     T ++  W AP     C+  +A +V+   + ++  G L K +C   +    + E  N K           + +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG +H+ +Y ++  GGQAS  V+ +   G    ++++  +  + +   +K+       W    +  + S   SV+R+ H  SFL MMGPSPDW  G+++ D+C  +C W      DL P+DAG  +G TY  E+ ++  IP D IR + +    Q PF        +PVARV+ ++I                ++ D+ N   +         +T+++         DD          CI S WS W+ C S TC  G  MR R MLK A+ +L    P  +    C G   S D S  C +  W  W PC+A+C M G + R R   +F           EE EKC+ N+E
Sbjct:   75 YKPGNTYRVTLLAASPAY-FRGFTLIALKEGKEGEKEEDHA-------GTFQIIDDEDTQFMSNCPVAVTESTPRRRTRIQVLWTAPPIGSGCVILKASIVQKKIIYFQDEGSLTKRMCEPDL----TLEGGNEK----------PIPDCCACGTAKYRLTFYGNWSEKTHPKDYPRRAN--HWSAIIGGSHSKEYVLWEYGGQASDGVKQVAELGSPVKMEEEIRQKGDEVLTVIKAKAQWPA-WQPLNVRAAPSAEFSVDRSRHLMSFLAMMGPSPDWNVGLSSEDLCTKECGWVQKVIQDLIPWDAGTDSGVTY--ESPNKPSIPQDKIRPLTSLDHPQSPFYDPEGGPIIPVARVVIERI---------------ARKGDQCNIVPDNVDDIVPDLVTEEKEE-------DD------TPETCIYSNWSPWSACSSATCDKGKRMRQR-MLK-AQLDLSVPCPDTQDFEPCMGPGCSDDAST-CMMSEWITWSPCSASCGM-GMRSRERYVKQFPEDGSMCKVPTEETEKCIVNEE 555          

HSP 2 Score: 60.077 bits (144), Expect = 1.411e-8
Identity = 53/166 (31.93%), Postives = 67/166 (40.36%), Query Frame = 2
Query: 1535 KKRRHINKKSPLD------DPT------LANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFA-------------------RFEEKEKCLKNKERRFKIFEEKR 1939
            KKR  + K +P D      D T      +    T  C+ SPWSEW+ CSVTCG GT  R R +   A+   C    L +   C      C  S  C L  WS W  CN +C   G+  R+RM                     R  + +K   N+ RR K   EKR
Sbjct:  581 KKRHRMIKMTPADGSMCKADTTEVEKCMMPECHTIPCVLSPWSEWSDCSVTCGKGTRTRQRMLKSPAELGDCNE-ELKQVEKC--MLPECPIS--CELTEWSYWSECNKSC-GKGHMIRTRMITMEPQFGGAVCPETVQRKKCRLRKCQKSSGNERRRLKEAREKR 740          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Spon1 (spondin 1, (f-spondin) extracellular matrix protein [Source:MGI Symbol;Acc:MGI:2385287])

HSP 1 Score: 219.935 bits (559), Expect = 8.947e-60
Identity = 160/549 (29.14%), Postives = 260/549 (47.36%), Query Frame = 2
Query:  350 DRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHK---MIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPM-VKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEET--IKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIK---------PKHNWECTKMNAKQVKEFDE-----MNSNKNGNSQFDGSSLTKKRRHINK--KSPLD---------------DPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            D ++PG SYR+ L+ A     FR F++ A  E ++  + E H     I DE    F+ N         CP  +  +     T ++  WIAP     C+  +A +V+   + ++  G L K +C         E++  +      D +T   + +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG +H+ +Y ++  GG AS+ V+ +   G    ++++  +++  +   +K+       W    +  + S   SV+RT H  SFLTMMGPSPDW  G++A D+C  +C W      DL P+DAG  +G TY  E+ ++  IP + IR + +    Q PF      +   VARV+ ++I          P +  +     A + K+ D+     + SN +  S    S+  K +R   +  K+ LD                P  ++     C  S W  W+ CSV+CG+G   R R + +  +      LP  E+  C   +  C  S+ C +  W  W  C+ATC M G ++R RM 
Sbjct:   70 DFYKPGSSYRVTLSAAPPSY-FRGFTLIALKENQEGDKEEDHAGTFQIIDEEETQFMSN---------CPVAVTESTPRRRTRIQVFWIAPPTGTGCVILKASIVQKRIIYFQDEGSLTKKLC---------EQDPTL------DGVTDRPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRAN--HWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPA-WQPVNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTY--ESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSVSCGMGMRSRERYVKQFPEDGSVCMLPTEETEKCTVNEE-CSPSS-CLVTEWGEWDDCSATCGM-GMKKRHRMV 585          

HSP 2 Score: 53.5286 bits (127), Expect = 1.416e-6
Identity = 40/123 (32.52%), Postives = 53/123 (43.09%), Query Frame = 2
Query: 1535 KKRRHINKKSPLDDPT------------LANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            KKR  + K SP D               +    T  C+ SPWSEW+ CSVTCG G   R R +   A+   C    L ++  C   +   D    C L  WS+W  CN +C   G+  R+R  
Sbjct:  579 KKRHRMVKMSPADGSMCKAETSQAEKCMMPECHTIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSLAELGDCNE-DLEQAEKCMLPECPID----CELSEWSQWSECNKSC-GKGHMIRTRTI 695          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Spon1 (spondin 1, (f-spondin) extracellular matrix protein [Source:MGI Symbol;Acc:MGI:2385287])

HSP 1 Score: 117.087 bits (292), Expect = 1.858e-28
Identity = 72/242 (29.75%), Postives = 122/242 (50.41%), Query Frame = 2
Query:  350 DRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHK---MIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPM-VKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSY 1063
            D ++PG SYR+ L+ A     FR F++ A  E ++  + E H     I DE    F+ N         CP  +  +     T ++  WIAP     C+  +A +V+   + ++  G L K +C         E++  +      D +T   + +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG +H+ +Y ++  GG AS+ V+ +   G    +     EE I+  +++Y
Sbjct:   70 DFYKPGSSYRVTLSAAPPSY-FRGFTLIALKENQEGDKEEDHAGTFQIIDEEETQFMSN---------CPVAVTESTPRRRTRIQVFWIAPPTGTGCVILKASIVQKRIIYFQDEGSLTKKLC---------EQDPTL------DGVTDRPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRAN--HWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKM-----EEEIRQQVRAY 279          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Spon2 (spondin 2, extracellular matrix protein [Source:MGI Symbol;Acc:MGI:1923724])

HSP 1 Score: 102.449 bits (254), Expect = 4.071e-23
Identity = 76/303 (25.08%), Postives = 128/303 (42.24%), Query Frame = 2
Query:  800 CCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPEN--SDRQDI------PDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCG-IGTEMRSR 1681
            C A  +A Y +TF+G WS+   PK +P  +    W++L+GA H+ DY ++      S  ++     G++  L ++   E     L+S                 S  + V+  H   SF+  + PSPDW  G+ ++D+C     WK+   +DL+P DAG  +GFT+   N  +  QD         P    N+ Y  +    +  P+A+V + +++           + +      ++    GN   D  S+         ++PLD           C  S WS W  C   CG +G + R+R
Sbjct:   34 CTARPLARYSITFIGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAERGEAWALMKEI--EAAGEKLQSVHAVFSAPAIPSGTGQTSTELEVHPRHSLVSFVVRIVPSPDWFVGIDSLDLCEGG-RWKEQVVLDLYPHDAGTDSGFTFSSPNFATIPQDTVTEITASSPSHPANSFYYPRL--KSLPPIAKVTFVRLQ----------QSPRAFAPPSLDLASRGNEIVDSLSV--------PETPLD-----------CEVSLWSSWGLCGGPCGKLGAKSRTR 302          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Spon2 (spondin 2, extracellular matrix protein [Source:MGI Symbol;Acc:MGI:1923724])

HSP 1 Score: 72.7886 bits (177), Expect = 3.404e-14
Identity = 40/147 (27.21%), Postives = 68/147 (46.26%), Query Frame = 2
Query:  800 CCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKD 1240
            C A  +A Y +TF+G WS+   PK +P  +    W++L+GA H+ DY ++      S  ++     G++  L ++   E     L+S                 S  + V+  H   SF+  + PSPDW  G+ ++D+C     WK+
Sbjct:   34 CTARPLARYSITFIGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAERGEAWALMKEI--EAAGEKLQSVHAVFSAPAIPSGTGQTSTELEVHPRHSLVSFVVRIVPSPDWFVGIDSLDLCEGG-RWKE 177          
BLAST of Spondin-1 vs. Ensembl Mouse
Match: Tfpi (tissue factor pathway inhibitor [Source:MGI Symbol;Acc:MGI:1095418])

HSP 1 Score: 64.3142 bits (155), Expect = 8.310e-11
Identity = 48/165 (29.09%), Postives = 75/165 (45.45%), Query Frame = 2
Query: 2009 CGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCST 2503
            C   +  YF++   H C  F Y GC+G+ N F +   C+KTC+      P + K  +     ++ S +++        + C LE   G   C G M    RY Y+N+  +C +F Y GC GN NNF +   C K C   +      +P+   Q+S++   G   T
Sbjct:   59 CKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCI------PGYEKTAV-----KAASGAER-------PDFCFLEEDPGL--CRGYMK---RYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKIC---ENPVHSPSPVNEVQMSDYVTDGNTVT 197          
BLAST of Spondin-1 vs. UniProt/SwissProt
Match: sp|Q9HCB6|SPON1_HUMAN (Spondin-1 OS=Homo sapiens OX=9606 GN=SPON1 PE=1 SV=2)

HSP 1 Score: 220.32 bits (560), Expect = 4.656e-59
Identity = 160/549 (29.14%), Postives = 259/549 (47.18%), Query Frame = 2
Query:  350 DRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHK---MIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPM-VKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEET--IKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIK---------PKHNWECTKMNAKQVKEFDE-----MNSNKNGNSQFDGSSLTKKRRHINK--KSPLD---------------DPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            D ++PG SYR+ L+ A     FR F++ A  E  +  + E H     I DE    F+ N         CP  +  +     T ++  WIAP     C+  +A +V+   + ++  G L K +C         E++        FD +T   + +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG +H+ +Y ++  GG AS+ V+ +   G    ++++  +++  +   +K+       W    +  + S   SV+RT H  SFLTMMGPSPDW  G++A D+C  +C W      DL P+DAG  +G TY  E+ ++  IP + IR + +    Q PF      +   VARV+ ++I          P +  +     A + K+ D+     + SN +  S    S+  K +R   +  K+ LD                P  ++     C  S W  W+ CS++CG+G   R R + +  +      LP  E+  C   +  C  S+ C +  W  W  C+ATC M G ++R RM 
Sbjct:   70 DFYKPGTSYRVTLSAAPPSY-FRGFTLIALRENREGDKEEDHAGTFQIIDEEETQFMSN---------CPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLC---------EQDST------FDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRAN--HWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPA-WQPLNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTY--ESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGMGMRSRERYVKQFPEDGSVCTLPTEETEKCTVNE-ECSPSS-CLMTEWGEWDECSATCGM-GMKKRHRMI 585          

HSP 2 Score: 53.9138 bits (128), Expect = 6.578e-6
Identity = 34/90 (37.78%), Postives = 44/90 (48.89%), Query Frame = 2
Query: 1598 TFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            T  C+ SPWSEW+ CSVTCG G   R R +   A+   C    L +   C   +   D    C L  WS+W  CN +C   G+  R+RM 
Sbjct:  612 TIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSLAELGDCNE-DLEQVEKCMLPECPID----CELTEWSQWSECNKSC-GKGHVIRTRMI 695          
BLAST of Spondin-1 vs. UniProt/SwissProt
Match: sp|Q9GLX9|SPON1_BOVIN (Spondin-1 OS=Bos taurus OX=9913 GN=SPON1 PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 5.689e-59
Identity = 161/549 (29.33%), Postives = 258/549 (46.99%), Query Frame = 2
Query:  350 DRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHK---MIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPM-VKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEET--IKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIK---------PKHNWECTKMNAKQVKEFDE-----MNSNKNGNSQFDGSSLTKKRRHINK--KSPLD---------------DPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            D ++PG SYR+ L+ A     FR F++ A  E  +  + E H     I DE    F+ N         CP  +  +     T ++  WIAP     C+  +A +V+   + ++  G L K +C         E++        FD +T   + +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG +H+ +Y ++  GG AS+ V+ +   G    ++++  +++  +   +K+       W    +  + S   SV+RT H  SFLTMMGPSPDW  G++A D+C  +C W      DL P+DAG  +G TY  E+ ++  IP + IR + +    Q PF      +   VARV+ ++I          P +  +     A + K+ D+     + SN +  S    S+  K +R   +  K+ LD                P  ++     C  S W  W+ CS++CG GT  R R + +  +      LP  E+  C   +  C  S+ C    W  W  C+ATC M G ++R RM 
Sbjct:   70 DFYKPGTSYRVTLSAAPPSY-FRGFTLIALKENREGDKEEDHAGTFQIIDEEETQFMSN---------CPVAVTESTPRRRTRIQVFWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLC---------EQDST------FDGVTDKPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRAN--HWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPA-WQPLNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTY--ESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSISCGTGTRSRERYVKQFPEDGSVCTLPTEETEKCTVNEE-CSPSS-CLTTEWGEWDECSATCGM-GMKKRHRMV 585          
BLAST of Spondin-1 vs. UniProt/SwissProt
Match: sp|Q8VCC9|SPON1_MOUSE (Spondin-1 OS=Mus musculus OX=10090 GN=Spon1 PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 6.259e-59
Identity = 160/549 (29.14%), Postives = 260/549 (47.36%), Query Frame = 2
Query:  350 DRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHK---MIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPM-VKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEET--IKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIK---------PKHNWECTKMNAKQVKEFDE-----MNSNKNGNSQFDGSSLTKKRRHINK--KSPLD---------------DPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            D ++PG SYR+ L+ A     FR F++ A  E ++  + E H     I DE    F+ N         CP  +  +     T ++  WIAP     C+  +A +V+   + ++  G L K +C         E++  +      D +T   + +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG +H+ +Y ++  GG AS+ V+ +   G    ++++  +++  +   +K+       W    +  + S   SV+RT H  SFLTMMGPSPDW  G++A D+C  +C W      DL P+DAG  +G TY  E+ ++  IP + IR + +    Q PF      +   VARV+ ++I          P +  +     A + K+ D+     + SN +  S    S+  K +R   +  K+ LD                P  ++     C  S W  W+ CSV+CG+G   R R + +  +      LP  E+  C   +  C  S+ C +  W  W  C+ATC M G ++R RM 
Sbjct:   70 DFYKPGSSYRVTLSAAPPSY-FRGFTLIALKENQEGDKEEDHAGTFQIIDEEETQFMSN---------CPVAVTESTPRRRTRIQVFWIAPPTGTGCVILKASIVQKRIIYFQDEGSLTKKLC---------EQDPTL------DGVTDRPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRAN--HWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPA-WQPVNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTY--ESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSVSCGMGMRSRERYVKQFPEDGSVCMLPTEETEKCTVNEE-CSPSS-CLVTEWGEWDDCSATCGM-GMKKRHRMV 585          

HSP 2 Score: 53.5286 bits (127), Expect = 9.904e-6
Identity = 40/123 (32.52%), Postives = 53/123 (43.09%), Query Frame = 2
Query: 1535 KKRRHINKKSPLDDPT------------LANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            KKR  + K SP D               +    T  C+ SPWSEW+ CSVTCG G   R R +   A+   C    L ++  C   +   D    C L  WS+W  CN +C   G+  R+R  
Sbjct:  579 KKRHRMVKMSPADGSMCKAETSQAEKCMMPECHTIPCLLSPWSEWSDCSVTCGKGMRTRQRMLKSLAELGDCNE-DLEQAEKCMLPECPID----CELSEWSQWSECNKSC-GKGHMIRTRTI 695          
BLAST of Spondin-1 vs. UniProt/SwissProt
Match: sp|P35446|SPON1_RAT (Spondin-1 OS=Rattus norvegicus OX=10116 GN=Spon1 PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.109e-58
Identity = 160/549 (29.14%), Postives = 259/549 (47.18%), Query Frame = 2
Query:  350 DRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHK---MIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPM-VKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEET--IKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIK---------PKHNWECTKMNAKQVKEFDE-----MNSNKNGNSQFDGSSLTKKRRHINK--KSPLD---------------DPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            D ++PG SYR+ L+ A     FR F++ A  E  +  + E H     I DE    F+ N         CP  +  +     T ++  WIAP     C+  +A +V+   + ++  G L K +C         E++  +      D +T   + +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG +H+ +Y ++  GG AS+ V+ +   G    ++++  +++  +   +K+       W    +  + S   SV+RT H  SFLTMMGPSPDW  G++A D+C  +C W      DL P+DAG  +G TY  E+ ++  IP + IR + +    Q PF      +   VARV+ ++I          P +  +     A + K+ D+     + SN +  S    S+  K +R   +  K+ LD                P  ++     C  S W  W+ CSV+CG+G   R R + +  +      LP  E+  C   +  C  S+ C +  W  W  C+ATC M G ++R RM 
Sbjct:   70 DFYKPGSSYRVTLSAAPPSY-FRGFTLIALKENREGDKEEDHAGTFQIIDEEETQFMSN---------CPVAVTESTPRRRTRIQVFWIAPPTGTGCVILKASIVQKRIIYFQDEGSLTKKLC---------EQDPTL------DGVTDRPILDCCACGTAKYRLTFYGNWSEKTHPKDYPRRAN--HWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPS-WQPVNVRAAPSAEFSVDRTRHLMSFLTMMGPSPDWNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTY--ESPNKPTIPQEKIRPLTSLDHPQSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMSEWITWSPCSVSCGMGMRSRERYVKQFPEDGSVCMLPTEETEKCTVNEE-CSPSS-CLVTEWGEWDDCSATCGM-GMKKRHRMV 585          
BLAST of Spondin-1 vs. UniProt/SwissProt
Match: sp|Q9W770|SPON1_CHICK (Spondin-1 OS=Gallus gallus OX=9031 GN=SPON1 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 9.389e-57
Identity = 157/542 (28.97%), Postives = 248/542 (45.76%), Query Frame = 2
Query:  356 FEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHK---MIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEET--IKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKC-SVTCGIGTEMRSRDMLKNAKTELCRHLPLLES-RTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARF-----------EEKEKCLKNKE 1909
            ++PG SYR+ L+ A     FR F++ A  E ++  + E H     I DE    F+ N         CP  +  +     T ++  W AP     C+  +A +V+   + ++  G L K IC         +        KP         +CCACG A Y++TF G WS+KTHPKD+P++ +  HW+ +IG++H+ +Y ++  GG AS+ V+ +   G    ++++  +++  +   +K+       W    +  + S   SV+R  H  SFLTM+GPSPDW  G++A D+C  DC W      DL P+DAG  +G TY  E+ ++  +P + IR + +    Q PF      +   VARV+ ++I                       + K     F   ++      +  +   +D T        CI S WS W+ C S TC  G  MR R MLK A+ +L    P  +  + C G   S +  + C +  W  W PC+ +C M G + R R   +F           EE EKC+ N+E
Sbjct:   67 YKPGNSYRVTLSAATPAY-FRGFTLIALKEGKEGDKEEDHAGTFQIIDEEETQFMSN---------CPVAVTESTPRRRTRIQVFWTAPPTGTGCVILKASIVQKRIIYFQDEGSLTKRICE-------QDSASEGVTDKP-------TLDCCACGTAKYRLTFYGNWSEKTHPKDFPRRTN--HWSAIIGSSHSKNYILWEYGGYASEGVKQVAELGSPVKMEEEIRQQSDEVLTVIKAKAQWPA-WQPLNVRAAPSAEFSVDRHRHLMSFLTMLGPSPDWNVGLSAEDLCTKDCGWVQKVVQDLIPWDAGTDSGVTY--ESPNKPTVPQEKIRPLTSLDHPQSPFYDPEGGSIKLVARVVLERI-----------------------ARKGEQCNFVPDNIDDIVADLAPEEKEEDDTPET-----CIYSNWSPWSACSSSTCEKGKRMRQR-MLK-AQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCMMSDWITWSPCSVSCGM-GTRSRERYVKQFPEDGSMCKVPTEETEKCIVNEE 548          

HSP 2 Score: 56.9954 bits (136), Expect = 6.848e-7
Identity = 36/90 (40.00%), Postives = 47/90 (52.22%), Query Frame = 2
Query: 1598 TFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            T  C+ SPWSEW+ CSVTCG G   R R MLK+A      +  L ++  C   +   D    C L  WS+W  CN +C   G+  R+RM 
Sbjct:  607 TIPCLLSPWSEWSDCSVTCGKGMRTRQR-MLKSAAELGDCNEELEQAEKCMLPECPID----CELTEWSQWSECNTSC-GKGHMIRTRMI 690          
BLAST of Spondin-1 vs. TrEMBL
Match: A0A1Z1R177 (F-spondin (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 291/295 (98.64%), Postives = 293/295 (99.32%), Query Frame = 2
Query: 1733 ESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 2617
            ESRTCEGRKRSCDFSA CSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEK CLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGN+NNFRSYHSCIKACMPDQIDFMKTAPIKACQVS+WSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC
Sbjct:    1 ESRTCEGRKRSCDFSALCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKACLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNNNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSQWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 295          
BLAST of Spondin-1 vs. TrEMBL
Match: A0A5J4P3I4 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0011300 PE=4 SV=1)

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 341/937 (36.39%), Postives = 471/937 (50.27%), Query Frame = 2
Query:  299 KDGEFRIVIRDMK-GKMADR-FEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCP------NRMHGNDNM-------------------FLTYVESTWIAPH-----------NP-INCIRFEAQVVKFDF--MVYESIGRLVKVICP--------------TKMYKMISEENK-------NMKISKP----FDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWP-KQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQ-------------------QFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFD---------------EMNSNKNGNS---QFDGSSLTKKRRH---------INKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATC-EMHGYQQRSRMFARFEEKEKC----LKNKERRFK-IFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQ---SNSDKRKKMPTM--ANKCRLEVKYGGMNCDGTMGPDI-RYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMP-----------------------------------DQI---DFMKT----APIKACQVSEWSHWGPCSTTCG--VGERFKWRSVLRPALNGGPACPELFLSEPC 2602
            +D  F + +R    G M    +EPG  Y + L N    + FRD  ++     +DS       ++ +   GH   NK+     Y         + + GN                      ++T +  +W AP            NP + CI  ++ V        VY + G L K +CP              T+  +++   +        +MK+S       D M PM  +CCACG A+Y +TF GLW+++THP+DWP     ++HWTNLIGA+H   + IY  G  AS  V ++C+YGD+TVLKQ                   Q     I P L S  +T GMW+E+ + +SRS  + VNRTH   SFL+M+GPSP+WC GVA+  +C  DCTW     +DLFP+DAG++NG TY P+ +DR+DIPDPIR I   +M   PFT N+PVARV  +++ P+  W+CT   +  V+ FD               E   ++  NS      G  + K R H         +   SPL DP+LA MATFLCIT  WS+W++CSVTCG+G   R R ML N K ELC+H+PL+E   CEGRKR+CDFS PCSLL W+ W PCNATC + +G Q R R   R EE+++C    +  KE++   +  +++C      CDPV IC EG   G +CG  V  ++Y A  HSC+PFEY GCKG  N F +K  CEKTCL  V +LP WR+++MA LQ+Q+    S+   R+KM  M  A  C  ++   G  C+ +    I  +Y+  R  RC +F Y GC GN N +  Y SCI  C+P                                   DQ+   D  +      P + CQV+ W  W PCS T    +G R +WR ++RPA +GG  C  LF  E C
Sbjct:   75 EDNGFELRVRRASDGVMVSGWYEPGREYVVTLTNRYQWVGFRDAILWLEVGRQDSHMKADPSLMKESNAGHIWTNKQGSQCQYHPSYLGAWIHHLTGNSATQSRFGCHSLTAERLNQARSWVTQLVLSWRAPSTFQTPVSGCPANPQLGCITIKSAVRARGGHNSVYAATGGLRKTLCPSVDRPPSPVLPAYMTEPEQLVGPSSTVSKRATGSMKLSSKDTMHMDNMQPM--DCCACGSATYNLTFQGLWTRETHPRDWPVHNPGLLHWTNLIGASHMPGFRIYQFGEPASAGVSAVCAYGDTTVLKQSLGIAASNTGSISSVPTGTQRGAMGIGP-LHSLISTPGMWSEETLTESRSTLVGVNRTHPLISFLSMLGPSPNWCAGVASQSVCQADCTWVKQLQIDLFPWDAGVRNGDTYIPKEADRKDIPDPIRYITADWMPNHPFTPNLPVARVTLERVLPREQWQCTSKLSDGVELFDSDGSTTVVGGRTAVKESERSQPVNSVVGDVTGGMMKKSRSHKSGSPSSGGLAGDSPLSDPSLAQMATFLCITDSWSQWSQCSVTCGVGRRERRRVMLVNKKNELCQHVPLVEEEPCEGRKRTCDFSLPCSLLPWTEWTPCNATCLDRNGQQTRRRYLVRPEERQQCEHLFVTTKEKQSNTVIAQRQCGPTDIECDPVTICGEGRKDGIACGNKVQSFYYSAVDHSCMPFEYSGCKGGRNRFATKQVCEKTCLGVVESLPAWRRERMALLQYQTSQIASDDTDREKMKYMKPAEHCG-QLMDPGEPCEYSRNQRIVAWYFSPRTRRCFEFVYLGCGGNKNRYADYKSCISDCLPQEWEKSQQMARALAATSKRSKYKADLDAHAPDSEVDQVTPTDLKRIDSLWGPKQDCQVTPWGGWSPCSVTRSYQIGMRMRWRHIVRPARHGGQPCGILFEQEHC 1007          
BLAST of Spondin-1 vs. TrEMBL
Match: A0A183AG11 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5896 PE=4 SV=1)

HSP 1 Score: 559.296 bits (1440), Expect = 0.000e+0
Identity = 305/751 (40.61%), Postives = 396/751 (52.73%), Query Frame = 2
Query:  719 MYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWP-KQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQ----------------------QFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEF--------------DEMNSNKNGNSQFDGSSLTKK-----------------------RRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATC-EMHGYQQRSRMFARFEEKEKC-----LKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQ-SQSNSDK----RKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQ-----------------IDFMKTA----------------------------PIKACQVSEWSHWGPCSTTC--GVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 2617
            M+K+  +   NM I +P D        CCACG A+Y +TF GLW+++THP+DWP     ++HWTNLIGA+H   Y IY  G  AS  V ++C+YGD+TVLKQ                      Q     I P L S  +T GMW+E  + +SRS  + VNRTH   SFLTM+GPSP+WC GVA+  +C  DCTW     +DLFP+DAG+++G TY P+N+DR+D+PDPIR I   +M   PFT N PVARV   +I PK +W+C     K V+ F              D   S   G      +SL                             +++ +PL DP+LA MATFLCIT  WS W++CSVTCG+G   R R ML N K ELC+H+PL E   CEGRKR+CDFS+PCSLL W+ W PCNATC   +G Q R R  AR  E+ +C     L ++     +FEE++C      CDPV IC EG   G  CGK V  Y Y A  H+C+PF+YLGCKG  N F +K  CE+TCL AV +LP WR+++MA LQ+Q SQ  SD+    RKK    A  C  ++  G    DG   P +R+YY  R  RC +F Y GC GN N + +Y +CI  CMP++                  D+   A                            P + CQ++ W  W PCS  C    G + +WR + RP  +GG  C  LF    C  T C
Sbjct:  290 MHKISPKSTMNMDIMQPQD--------CCACGTATYNLTFQGLWTRETHPRDWPVHNPGLLHWTNLIGASHMPSYRIYQFGEPASAGVSAVCAYGDTTVLKQSLTMAAATAGSSGSVSSVPTGTQRGAIGIGP-LHSLISTPGMWSEATLNESRSTLVGVNRTHPLISFLTMLGPSPNWCAGVASQSVCQADCTWVKHLEIDLFPWDAGVRHGDTYVPKNADRKDVPDPIRYITADWMPNHPFTPNKPVARVTLDRILPKESWQCVSDVEKCVEMFRADGNTEAVGCTKRDIAKSQDAGTGGRLDNSLAADISSGTLPKKSRSKSGGGGGGSGGSGGLDQGNPLSDPSLAQMATFLCITDGWSAWSQCSVTCGVGKRERRRTMLLNKKNELCQHVPLREEEPCEGRKRTCDFSSPCSLLPWTEWTPCNATCANRNGLQTRRRYLARPAERTECVHLFKLPDERAMGMVFEERQCGPTDNECDPVTICGEGRKDGIPCGKKVRVYHYSAVDHACMPFDYLGCKGGRNRFATKELCERTCLKAVESLPGWRRERMALLQYQTSQLASDEENGGRKKDMKPAKHCTEQMDTGVSCDDGVTQPSVRWYYSPRTRRCFEFVYLGCGGNGNRYDNYTTCIADCMPEEWERSQQMAKALAATSKATDYRDGASGYDAQREDVAEDPLSASDVKQLSSLWGPRQDCQLTAWGGWSPCSAECRHQTGTQIRWRHIERPPRHGGTPCGMLFEKRSCRGTMC 1031          
BLAST of Spondin-1 vs. TrEMBL
Match: A0A0R3U498 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1462 PE=4 SV=2)

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 302/795 (37.99%), Postives = 429/795 (53.96%), Query Frame = 2
Query:  581 LTYVESTWIAPH-NPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKM--ISEENKN------MKISKPFD-------EMTP----MVKECCACGVASYKVTFMGLWSKKTHPKDWP-KQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQ-------------------QFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMN----SNKNGNSQFDGSSLTKKRRH-----------------------------INKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEM-HGYQQRSRMFARFEEKEKC-----LKNKERRFK--IFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQ----SQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDF--------------------------------MKTAPIKACQVSEWSHWGPCSTTCGV--GERFKWRSVLRPALNGGPACPELFLSEPCFA 2608
            L +V + W  P  N  NC+   A +VK    V + +G L K +CP++M  M  +  EN+       +  S+ FD       EM P      K+CCACG A+YK+TF G+W+  THP+DWP K  +++HWTNLIGA+H   + IY  G  AS  VQS+C+YGD+T+L++                   Q A   + P L+S   T GMW E+ + + RS   SVNRTH   S LTM+GPSPDWCTG++   +C  DCTW ++ T+ L+P+DAGI+ G TY P+ SDR++IPDPIR I+ ++M   PF    PVA V  Q+++PK++W CT  +   V+ F        + K  + + D SSL +K R                              I   +PL DP+LA MATFLCIT  WS W+ CSVTCG+GT+ R+R ++ N K ELC+H+PL+   +CEGRKR+CD+SAPCSLL W+ W PC  TC+   G++ R R  AR EE  +C      +N+E R +  + E + C+  +  C+P  IC EG   G  CG  + +++Y A  H C+ FEYLGCKG  N F +K  CEK C+ AV ALP WR+++M  LQF+    + S+ D  +        C  EV   G  CD        +Y+ +R  RCR F Y GC G  N F ++ +C+ ACMP+++                                  +  +P + C+V++W  WGPCS  C    G++ + R++ RP+  GG AC  L+    C+ 
Sbjct:  186 LPHVVAIWRTPSTNTSNCVTIHA-MVKSSTSVLKEVGDLTKTLCPSEMRPMEPVLSENRGSVDADAIDPSREFDRPAPDPVEMRPRDSMQPKDCCACGTATYKLTFQGVWNSTTHPQDWPYKHPNLLHWTNLIGASHAPSFQIYAIGQTASAGVQSVCAYGDTTILREALSLAASKAEGAAGVPTGSQSATTDVSP-LRSLITTPGMWGEETLMEERSTLFSVNRTHPLVSMLTMLGPSPDWCTGISGQSLCKADCTWVNNLTLHLYPWDAGIREGNTYMPKESDRREIPDPIRYIDESWMPGNPFRERKPVAVVKIQRVRPKYDWACTNTDEDGVQLFKMGGGIYVTGKKNDKESDESSLKEKAREQRCTTITAGKQKGKRTKSVGFGGPGASGTIGSNNPLSDPSLAQMATFLCITDEWSAWSACSVTCGVGTKTRTRRLIANKKPELCQHVPLVMEESCEGRKRTCDYSAPCSLLPWTLWSPCTGTCDSPRGHRSRKRALARPEEAAQCGHLWEGRNQEGREQGIMSEVEECQVPSETCEPATICGEGPKQGYPCGPKLRRFYYSAIDHECLEFEYLGCKGGRNMFETKQDCEKLCIPAVEALPAWRRERMGLLQFKTSQLTSSSPDDLEDSLKRDPVCYYEVNT-GYECDPPKELGNYWYFCSRTNRCRDFFYLGCGGTPNRFANHTACMAACMPNELRHSQLLAKVRSATASRKAAANATDADEEAPDGLEVGVSPRQDCRVTQWGAWGPCSVRCSSQRGQQIRLRAIERPSRYGGEACGPLYERRSCYG 977          
BLAST of Spondin-1 vs. TrEMBL
Match: A0A5K3F8X7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 557.37 bits (1435), Expect = 1.026e-180
Identity = 300/792 (37.88%), Postives = 428/792 (54.04%), Query Frame = 2
Query:  581 LTYVESTWIAPH-NPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKM--ISEENKN------MKISKPFD-------EMTP----MVKECCACGVASYKVTFMGLWSKKTHPKDWP-KQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQ-------------------QFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEF---------DEMNSNKNGNSQFDGSSLTKK---------------------RRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEM-HGYQQRSRMFARFEEKEKC-----LKNKERRFK--IFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQ----SQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDF--------------------------------MKTAPIKACQVSEWSHWGPCSTTCGV--GERFKWRSVLRPALNGGPACPELFLSEPCFA 2608
            L +V + W  P  N  NC+   A +VK    V + +G L K +CP++M  M  +  EN+       +  S+ FD       EM P      K+CCACG A+YK+TF G+W+  THP+DWP K  +++HWTNLIGA+H   + IY  G  AS  VQS+C+YGD+T+L++                   Q A   + P L+S   T GMW E+ + + RS   SVNRTH   S LTM+GPSPDWCTG++   +C  DCTW ++ T+ L+P+DAGI+ G TY P+ SDR++IPDPIR I+ ++M   PF    PVA V  Q+++PK++W CT  +   V+ F          + N  ++  S   G S T++                        I   +PL DP+LA MATFLCIT  WS W+ CSVTCG+GT+ R+R ++ N K ELC+H+PL+   +CEGRKR+CD+SAPCSLL W+ W PC  TC+   G++ R R  AR EE  +C      +N+E R +  + E + C+  +  C+P  IC EG   G  CG  + +++Y A  H C+ FEYLGCKG  N F +K  CEK C+ AV ALP WR+++M  LQF+    + S+ D  +        C  EV   G  CD        +Y+ +R  RCR F Y GC G  N F ++ +C+ ACMP+++                                  +  +P + C+V++W  WGPCS  C    G++ + R++ RP+  GG AC  L+    C+ 
Sbjct:  186 LPHVVAIWRTPSTNTSNCVTIHA-MVKSSTSVLKEVGDLTKTLCPSEMRPMEPVLSENRGSVDADAIDPSREFDRPAPDPVEMRPRDSMQPKDCCACGTATYKLTFQGVWNSTTHPQDWPYKHPNLLHWTNLIGASHAPSFQIYAIGQTASAGVQSVCAYGDTTILREALSLAASKAEGAAGVPTGSQSATTDVSP-LRSLITTPGMWGEETLMEERSTLFSVNRTHPLVSMLTMLGPSPDWCTGISGQSLCKADCTWVNNLTLHLYPWDAGIREGNTYMPKESDRREIPDPIRYIDESWMPGNPFRERKPVAVVKIQRVRPKYDWACTNTDEDGVQLFKMGGGIYVTGKKNDKESDESSLKGGSATQQITAGKQKGKRTKSVGFGGPGASGTIGSNNPLSDPSLAQMATFLCITDEWSAWSACSVTCGVGTKTRTRRLIANKKPELCQHVPLVMEESCEGRKRTCDYSAPCSLLPWTLWSPCTGTCDSPRGHRSRKRALARPEEAAQCGHLWEGRNQEGREQGIMSEVEECQVPSETCEPATICGEGPKQGYPCGPKLRRFYYSAIDHECLEFEYLGCKGGRNMFETKQDCEKLCIPAVEALPAWRRERMGLLQFKTSQLTSSSPDDLEDSLKRDPVCYYEVNT-GYECDPPKELGNYWYFCSRTNRCRDFFYLGCGGTPNRFANHTACMAACMPNELRHSQLLAKVRSATASRKAAANATDADEEAPDGLEVGVSPRQDCRVTQWGAWGPCSVRCSSQRGQQIRLRAIERPSRYGGEACGPLYERRSCYG 974          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: spon1b (spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10])

HSP 1 Score: 214.927 bits (546), Expect = 2.764e-58
Identity = 162/571 (28.37%), Postives = 269/571 (47.11%), Query Frame = 2
Query:  275 KTYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMT-PMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMW---NEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPFTAN-----VPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKC-SVTCGIGTEMRSRDMLKNAKTELCRHLPLLESR---TCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARF-----------EEKEKCLKNKE 1909
            +T ++   +DG     +R ++G   D ++PG +YR+ L  +     FR F++ A  E  + +        PD+  G+F II+++       CP  +  +     T ++  W AP +   C+  +A +V+   + ++  G L + +C         E  K++     F  +T   +++CCACG A Y+VTF G WS+K HPKD+P++ +  HW+ LIGA+H+ +Y ++  GG AS+ V+ +   G    ++++  ++     + +   T   W       I  + S   SV+R HH  SFLTM+GPSPDW  G++  ++C  +C W      DL P+DAG  +G TY  E+ ++   P + IR + +    Q PF +       P+ARV+ ++I                ++ ++ N            ++      I    P +D T  +     CI S WS W+ C S TC  G  MR R ML   K +L   +P L ++    C G     +  + C L  W  W PC+A+C M G + R R   +F           EE EKC+ N++
Sbjct:   37 RTQRRGARRDGHNDYRLR-VEGD-PDTYQPGSTYRVSLYASSPSY-FRGFTLIALKEGREGVS-------PDDYAGNFKIIDEEETQFMTSCPPAVTESIPRRRTRIQVFWTAPPSGSGCVILKASIVQRRIIFFQDEGSLTRRLC---------EVQKSI-----FGGITLKPLQDCCACGTAKYRVTFYGNWSEKVHPKDYPRRAN--HWSALIGASHSRNYVLWEYGGYASEGVRQVAELGSPVKMEEEIRQK--GDDVMTVIKTKAQWPAWQPLNIRAAPSAEFSVDRAHHLMSFLTMLGPSPDWNVGISGENLCTQECGWVQRLVKDLLPWDAGTDSGVTY--ESPNKPTNPQERIRPLTSLDHPQSPFYSPHGGPITPLARVVVERI---------------ARKGEQCN------------TVPDTVDDIVADIPPED-TEEDNTPETCIYSNWSPWSACSSSTCDKGRRMRQR-ML---KAQLDATVPCLHTQDFEPCMGPGCREEEPSTCMLSEWISWSPCSASCGM-GMRSRERYIKQFPEDGSSCREPTEETEKCVVNED 544          

HSP 2 Score: 58.151 bits (139), Expect = 3.237e-8
Identity = 37/87 (42.53%), Postives = 43/87 (49.43%), Query Frame = 2
Query: 1607 CITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            C+ SPWSEW  CSVTCG+G  +R R M   A    C   PL E   C   +   D    C L  WS W  CN +C   G+  RSRM 
Sbjct:  606 CMVSPWSEWGHCSVTCGVGMRIRRRMMKTPALPNQCGD-PLEEVEKCMLPECPVD----CMLSDWSDWSECNKSCG-KGHMIRSRMV 686          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: spon1a (spondin 1a [Source:ZFIN;Acc:ZDB-GENE-000427-9])

HSP 1 Score: 172.555 bits (436), Expect = 3.938e-44
Identity = 154/590 (26.10%), Postives = 248/590 (42.03%), Query Frame = 2
Query:  308 EFRIVIRDMKGKMADRFEPGESYRIIL--NNAMYGMDFRDFSIFAAYEMEDSLQMESHK---MIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMT--PMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGM------WNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPF-----TANVPVARVIYQKIK---------PKHNWECTKMNAKQVKEFDE-----MNSNKNGNSQFDGSSLTKKRR-----------------HINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF-----------ARFEEKEKCL 1897
            EFR+ +        + ++P  +YR+ L   N  Y   FR F++ A  E  +  + E +     I DE    F+ N         CP  +  +     T ++  W AP +   CI  +A +V+   + ++  G L K +C          E +++     + E T  P++ +CCACG A Y+VTF G WS+K HPKD+P++ +  HW+ +IG++H+ +Y ++  GG AS  V+ +   G    +     EE I+           M      W    +  + S   SV+R+ H  SFLTM+GPSPDW  G+ +    +  C W         P+++         P+          IR + +    Q PF      A   VARV+ ++I          P +  +     A++ KE D+     + SN +  S    S+  K +R                 H     P   P  ++     C+ S W  W+ CSV+CG+G   R R + +  +      LP  E+  C   +  C  S+ C +  W  W  C+ATC + G ++R RM            A   E EKC+
Sbjct:   66 EFRLRVEGD----PEHYQPASTYRVTLYATNPAY---FRGFTLIALKEGRNGEKEEDYAGNFQIIDEEDTQFMTN---------CPPAVTESTPRRRTRIQVFWTAPPSGSGCILLKASIVQRKIISFQDEGSLTKRMC----------EKESL-----YGESTDKPLL-DCCACGTAKYRVTFYGNWSEKLHPKDYPRRAN--HWSAIIGSSHSKNYVLWEYGGYASDGVKQVAELGSPVKM-----EEEIRQKGDEVLTVIKMKAQWPAWQPLNVRAAPSAEFSVDRSRHLMSFLTMLGPSPDWNVGLLSSP--VGRCGW---------PWNSICSPNKPTVPQEK--------IRPLTSLDHPQSPFYDPEGGAITQVARVVVERIARKGEQCNIVPDNVDDIVADIAQEEKEEDDTPETCIYSNWSPWSACSSSTCEKGKRMRQRMLKAQLDLSVPCPHTQDFEPCMGPGCSDEDATTCMMSEWITWSPCSVSCGLGMRSRERYVKQFPEDGFACTLPTEETEPCTVNE-DCSPSS-CLVTEWGEWDACSATCGL-GMKRRERMVKMPPSDGSICGAEVVEVEKCM 594          

HSP 2 Score: 53.5286 bits (127), Expect = 9.828e-7
Identity = 31/78 (39.74%), Postives = 41/78 (52.56%), Query Frame = 2
Query: 1598 TFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATC 1831
            T  C+ SPWS+W+ CSVTCG GT MR R +LK+      R L   +  T      S   ++ C +  WS W  CN +C
Sbjct:  600 TIPCLLSPWSDWSDCSVTCGKGTRMRQR-ILKSP-----RGLSKCDQTTLISFCPSVSAASDCMMSDWSEWSECNKSC 671          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: spon2b (spondin 2b, extracellular matrix protein [Source:ZFIN;Acc:ZDB-GENE-990415-161])

HSP 1 Score: 118.242 bits (295), Expect = 2.560e-28
Identity = 94/329 (28.57%), Postives = 152/329 (46.20%), Query Frame = 2
Query:  800 CCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDS-TVLKQ-QFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQ------FPFTANV-PVARVIYQKIKPKH--NWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCG-IGTEMRSRDMLKNAKTELCRHLPLLESRTC 1747
            C A   A Y +TF G WS+   PK +P  +    W+ LIG TH+ DY I+     AS  V+     G++ T++K+ + A E I+  +   F+T  +   D   Q+ + F  V   H F SF+  + PSPDW  GV ++++C  D  WK++ ++DLFP+DAG  +GFT+   + + + IP D +  I +++ +       +P   ++ P+A+V   KIK     +       + Q+   +E+N +                  IN  +PLD           C  S WS W  C   CG  G   R+R +  +         PL + + C
Sbjct:   51 CSAPSTAKYSLTFTGKWSQTAFPKQYPVYRPPAQWSPLIGVTHSSDYHIWQKNEYASNGVREFSEKGEAWTLIKEVEAAGERIQ-SVYGLFSTPAVL--DGTSQTTTEF-EVYARHSFLSFIMRLVPSPDWFVGVDSLNLCEGD-HWKENISLDLFPYDAGTDSGFTF--SSPNFETIPQDKVMQITSSFPSHPANSFYYPRLKHLPPIAKVTLTKIKSNQIFSLPIEPTQSNQIPTGNEINESL-----------------IN--TPLD-----------CEVSAWSPWGLCKGQCGEKGVRHRTRYIHIHPANNGAVCPPLEDEKPC 342          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: spon2a (spondin-2-like [Source:NCBI gene;Acc:103039648])

HSP 1 Score: 104.76 bits (260), Expect = 5.575e-24
Identity = 72/236 (30.51%), Postives = 107/236 (45.34%), Query Frame = 2
Query:  761 SKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYF--------PENSDRQDIPDPIRTINTTY---MTQFPFTANVPVARVIYQKIKPKHN 1435
            S  F   T  V  C A G ASY + F G WS +T PK +P  +    W+ L+  TH   Y ++  G  AS  VQ+    G +  L ++  E      + S + T+G+     I  S +  I ++  +   S L  + PSPDW  GV ++++C     WK + T DL PFDAG  +GFT+         PEN        P    N+ Y   + Q P  A + + R     ++ +HN
Sbjct:   25 SSAFPLRTSNVTTCSARGPASYILVFTGHWSPQTFPKQYPLFRPPAQWSKLVAVTHNDQYRLWQEGSPASPGVQNFAELGVTVELVKEAKEARKTRAVGSMYRTAGI--PSGIGHSSTELI-LHPRNPLLSLLVKVIPSPDWFVGVDSLNLCEGG-QWKQEVTFDLHPFDAGTDSGFTFSSPNFPTMPPENITMITSQKPNHPANSFYYPRLPQLPPLATIWLRRQARSPVR-QHN 255          
BLAST of Spondin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000041207.1 (pep primary_assembly:Astyanax_mexicanus-2.0:11:5185373:5196079:-1 gene:ENSAMXG00000033686.1 transcript:ENSAMXT00000041207.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 2.111e-14
Identity = 51/170 (30.00%), Postives = 75/170 (44.12%), Query Frame = 2
Query: 1955 ALCDPVIICSEGLIM--GSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGT--MGP----DIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFM 2440
            A C   I  +  L+M  G+ CG+ V +++YD A  +C PF Y GC G+ N F ++  C  TC+          K  ++H     + N      M T  N C  E     M    T   GP     ++++YD +   C +F Y GC GN N F S   C   C+  Q  ++
Sbjct:   14 ATCFSHIPTTHLLVMDSGTPCGQYVQRWYYDKAVGACSPFWYGGCSGNSNRFKTEFECINTCILT-------SKSSVSHRHHSIRDNQCYYLDMTTGLNGCLNERNLFRMTLINTNDQGPCRAYLLKWFYDTQQNECARFWYGGCKGNGNRFDSQEECEDRCVTLQTPWV 176          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: spon2b (spondin 2b, extracellular matrix protein [Source:ZFIN;Acc:ZDB-GENE-990415-161])

HSP 1 Score: 87.0409 bits (214), Expect = 9.708e-19
Identity = 69/306 (22.55%), Postives = 133/306 (43.46%), Query Frame = 2
Query:  797 ECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDS-TVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQS---RSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHIN----KKSPLDDPTLANMATFLCITSPWSEWTKCSV-TCG-IGTEMRSR 1681
            +C A G   Y++ F G WS+ + PK +P  +    W++L+   H   + ++     AS  V+ +   G++  ++++  A    +         +G+++   +       S  +         S +  + PSPDW  GV ++++C  +  WK+  ++DL P+DAG  +GFT+   + +   IP +PI  + ++       + + P     Y K+K        ++          M    + +   D + +T++    +    K++PLD           C  + WS W  CSV TCG  G + R+R
Sbjct:    9 KCSAGGHPKYQLVFTGRWSQTSFPKQYPLFRPPAQWSSLVAVVHGRPFQMWRASRFASPGVREMSERGEAWGIMREVDAHAQARTAAARPPAVAGVFSAPALPNGTGQSSTELEFTAKQPLLSLMVRLVPSPDWFVGVDSLNLCEGE-RWKERLSLDLQPYDAGTDSGFTF--SSPNYATIPQEPITQMTSS-------SPSHPANSFYYPKLK--------QLPPLARLVLTRMGKRPHSSKHPDANLVTRQNEPASGVYIKQTPLD-----------CEVAKWSPWGLCSVDTCGQPGVKRRTR 285          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005038.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 1.073e-11
Identity = 40/148 (27.03%), Postives = 69/148 (46.62%), Query Frame = 2
Query: 2009 CGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQS---NSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMK 2443
            C   + +YF++    SC  F Y GC+G+LNNF    SC + C+     L   ++ K  +    +++   N +   +   +   C ++   G   C   +    R++Y+ +   C  F Y GC GN NNF S  SC+  C   Q+ +++
Sbjct:   84 CRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHCVHRAVPLKIKKRSKQTNNNNNNKAARCNGESNSEQFVLPRICLMKADPG--ECTAVI---PRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVC--GQVGYVQ 224          

HSP 2 Score: 63.929 bits (154), Expect = 1.344e-11
Identity = 43/131 (32.82%), Postives = 60/131 (45.80%), Query Frame = 2
Query: 2027 KYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACM 2419
            + FY+     C PF Y GC G+ NNF S        LA  NA   W  D    L         +RK+       CRL+++ G   C   +    RY+++  +G C +F Y GC GN NNF+   SC + C+
Sbjct:   18 RVFYNRYTQRCEPFHYGGCFGNGNNFES--------LAECNAKCAWIPDHRLQL---------RRKQTDIAPKACRLDMEVG--VCRALL---RRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHCV 126          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005043.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.193e-11
Identity = 40/148 (27.03%), Postives = 69/148 (46.62%), Query Frame = 2
Query: 2009 CGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQS---NSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMK 2443
            C   + +YF++    SC  F Y GC+G+LNNF    SC + C+     L   ++ K  +    +++   N +   +   +   C ++   G   C   +    R++Y+ +   C  F Y GC GN NNF S  SC+  C   Q+ +++
Sbjct:   83 CRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHCVHRAVPLKIKKRSKQTNNNNNNKAARCNGESNSEQFVLPRICLMKADPG--ECTAVI---PRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVC--GQVGYVQ 223          

HSP 2 Score: 58.9214 bits (141), Expect = 7.158e-10
Identity = 44/132 (33.33%), Postives = 60/132 (45.45%), Query Frame = 2
Query: 2027 KYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANK-CRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACM 2419
            + FY+     C PF Y GC G+ NNF S        LA  NA   W  D           N       P +A K CRL+++ G   C   +    RY+++  +G C +F Y GC GN NNF+   SC + C+
Sbjct:   18 RVFYNRYTQRCEPFHYGGCFGNGNNFES--------LAECNAKCAWIPD-----------NKRLASPCPLVAPKACRLDMEVG--VCRALL---RRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHCV 125          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009465.1 (pep scaffold:Pmarinus_7.0:GL478507:22936:25713:-1 gene:ENSPMAG00000008558.1 transcript:ENSPMAT00000009465.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 2.519e-11
Identity = 42/148 (28.38%), Postives = 65/148 (43.92%), Query Frame = 2
Query: 2009 CGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQS-----NSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC-MPDQID 2434
            C     ++ YDA   +C  F Y GC G+ NNF  +  C  TC  ++  L   R  +  +    + S     +    +++  + + C LE       C G+     R+ YD  +G C++F Y GC GN NNF     C+  C + D  D
Sbjct:   81 CRGSFTRWIYDAESSNCKEFTYGGCGGNFNNFLEETECMVTCGRSLGTLRTCRYHRTLNYLVVNNSCFLISSCWMTRRLFHVQDVCLLEAVTS--PCRGSF---TRWTYDAESGHCKEFTYGGCGGNFNNFLEETECVAMCGLQDGFD 223          

HSP 2 Score: 53.9138 bits (128), Expect = 4.507e-8
Identity = 45/137 (32.85%), Postives = 59/137 (43.07%), Query Frame = 2
Query: 2009 CGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKD-KMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC 2416
            C     ++ YDAA  +C  F Y GC+G+ NNF  +  C   C          R D KMA   +Q  S        P +   C LE   G   C G+     R+ YD  +  C++F Y GC GN NNF     C+  C
Sbjct:   10 CRGSFTRWTYDAATSTCKEFTYGGCRGNQNNFLEEAECLMDC---------GRSDVKMAVYCWQFGS-------WPYI---CLLEEAVG--PCRGSF---TRWIYDAESSNCKEFTYGGCGGNFNNFLEETECMVTC 122          
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Match: spon2a (spondin 2a, extracellular matrix protein [Source:ZFIN;Acc:ZDB-GENE-990415-160])

HSP 1 Score: 58.9214 bits (141), Expect = 3.394e-10
Identity = 24/52 (46.15%), Postives = 32/52 (61.54%), Query Frame = 2
Query: 2462 CQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 2617
            C+VS+W+ WG CS TCG+G +   R V++   NGG  CPEL + E C    C
Sbjct:  134 CEVSDWAAWGFCSRTCGIGVKRSTRFVIQTPANGGRPCPELHMEESCVDRAC 185          

HSP 2 Score: 51.9878 bits (123), Expect = 9.208e-8
Identity = 46/177 (25.99%), Postives = 70/177 (39.55%), Query Frame = 2
Query: 1151 SFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSR 1681
            S +  + PSPDW  GV+++D+C N   W    + DL P+D G  +GF +   N   +   +PI  I          TA  P          P +++   ++ A     F E +     ++      L  K   I +         A      C  S W+ W  CS TCGIG +  +R
Sbjct:    2 SIVVRLIPSPDWFVGVSSLDLCSNAGGWAPLVSHDLQPWDGGTDSGFAFSSPNYASEP-QEPISLI----------TAQRPS--------HPANSFYYPRLQALPRIGFLEFHLQPADHAFQRPDDLICKHCQIVRSDSGQREEAAG-TPLDCEVSDWAAWGFCSRTCGIGVKRSTR 158          
BLAST of Spondin-1 vs. Ensembl Nematostella
Match: EDO49895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF43])

HSP 1 Score: 170.629 bits (431), Expect = 1.083e-46
Identity = 115/362 (31.77%), Postives = 176/362 (48.62%), Query Frame = 2
Query:  797 ECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNK---NGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFAR 1873
            ECCACG A+YK+TF G WS++TH +  P    M  W+ LIG +H+  Y ++  GG AS+AVQ +  +G +  L ++   +  + ++ S   T  +W    + +S S    V+ T H  S ++ M PSPDW  GV  V++C  +CTWK + T+DL P+DAG  +G T+   N+ R     PI  I TT +   P  +        Y                 Q++ F  +   +   +G    D         HI  K+P    +    A   C  + WS+WT CSVTCG+G ++R RD+++  + +      L E R C  R+R C  +  C +  WS W  C  +C + G + R+R   R
Sbjct:    1 ECCACGKATYKLTFKGKWSQETHARHHPG--PMARWSPLIGCSHSNKYVMWRYGGIASRAVQMMSEWGATEYLDEEMRNQ--QENVMSIIQTPSLWYG--VGES-SAVFRVDSTRHLLSMISRMIPSPDWNVGVDRVNLCTTNCTWKHEETIDLIPWDAGTDDGITFKSPNA-RSTPKQPISRI-TTRLHDHPRAS-------FYLNTN------------DQIRPFASLKLERLAVSGGCSNDA--------HIAPKNPYPPKS----ARIDCQLTHWSKWTSCSVTCGVGEQIRGRDIIRVPEHDGIPCPNLYEHRPC-ARQR-CSSTKKCEVTPWSAWSSCRGSCGV-GRKVRTRRIIR 319          

HSP 2 Score: 53.1434 bits (126), Expect = 2.759e-7
Identity = 22/52 (42.31%), Postives = 30/52 (57.69%), Query Frame = 2
Query: 2462 CQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 2617
            CQ++ WS W  CS TCGVGE+ + R ++R   + G  CP L+   PC    C
Sbjct:  234 CQLTHWSKWTSCSVTCGVGEQIRGRDIIRVPEHDGIPCPNLYEHRPCARQRC 285          
BLAST of Spondin-1 vs. Ensembl Nematostella
Match: EDO47504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLY4])

HSP 1 Score: 59.3066 bits (142), Expect = 1.582e-9
Identity = 34/87 (39.08%), Postives = 42/87 (48.28%), Query Frame = 2
Query: 2441 KTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVL-RPALNGGPACPELFLSEPCFATTC*KIYINFVSIFDDIYNNFMGKYILVLP 2698
            K   ++ C VS WS W PCS  CGVG R + R V+ RP+  GG  CP L     CF   C K      +I   IY     +Y  +LP
Sbjct:   86 KLQGVQDCVVSTWSRWSPCSHRCGVGMRKRSRRVIVRPSQRGGKECPPLRQKRGCFLEHCGK-ESGLANILPKIYKRLPNQYEEILP 171          
BLAST of Spondin-1 vs. Ensembl Nematostella
Match: EDO48831 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIN8])

HSP 1 Score: 58.151 bits (139), Expect = 7.129e-9
Identity = 36/90 (40.00%), Postives = 44/90 (48.89%), Query Frame = 2
Query: 1622 WSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEG---RKRSCDFSAPCSLL--SWSRWGPCNATCEMHGYQQRSRMFARF 1876
            W EW+ CSVTCG GT MR R+         C +   L   +C G      SC  +  C  +   WSRWGPCNATC   G + R+  F  F
Sbjct:   12 WGEWSACSVTCGTGTRMRMRN---------CTNPAPLYGDSCHGDDKESESCSVTPSCKGIFSEWSRWGPCNATCG-PGVKMRTMNFTSF 91          
BLAST of Spondin-1 vs. Ensembl Nematostella
Match: EDO38466 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCV3])

HSP 1 Score: 48.521 bits (114), Expect = 2.101e-7
Identity = 20/41 (48.78%), Postives = 27/41 (65.85%), Query Frame = 2
Query: 2294 MGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC 2416
            M   IR++YD R+  C+ F Y GC GN+NNF S  +C+K C
Sbjct:   25 MARFIRWHYDMRSSECKMFTYGGCQGNANNFESKAACLKKC 65          
BLAST of Spondin-1 vs. Ensembl Nematostella
Match: EDO26072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCY8])

HSP 1 Score: 48.1358 bits (113), Expect = 2.386e-7
Identity = 20/41 (48.78%), Postives = 27/41 (65.85%), Query Frame = 2
Query: 2294 MGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC 2416
            M   IR++YD R+  C+ F Y GC GN+NNF S  +C+K C
Sbjct:   25 MARFIRWHYDMRSSECKMFTYGGCQGNANNFESKAACLKKC 65          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: spon1a (spondin 1 [Source:NCBI gene;Acc:101161963])

HSP 1 Score: 217.624 bits (553), Expect = 4.730e-59
Identity = 199/791 (25.16%), Postives = 325/791 (41.09%), Query Frame = 2
Query:  302 DGEFRIVIRDMKGKMADRFEPGESYRI--ILNNAMYGMDFRDFSIFAAYEMEDSLQMESHK---MIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGM------WNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIK---------PKHNWECTKMNAKQVKEFDE-----MNSNKNGNSQFDGSSLTKKRR-----------------HINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIIC--SEGLIMGSSCGKPVMKYFYDAAKHSCV--PFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCGVG 2518
            + EFR+ +        D ++PG +YR+  I ++  Y   FR F++ A  E     + + +     I DE    F+ N         CP+ +  +       ++  W AP     C+  +A +V+   + ++  G L K +C               K S   D     + +CCACG A Y+VTF G WS+K HPKD+P++ +  HW+ +IGA+H+ +Y ++  GG AS  V+ +   G    +     EE I+           M      W    +  + S   SV+R  H  SFLTMMGPSPDW  G++A ++C  +C W      DL P+DAG  +G +Y  E+S++  +P + IR + +    Q PF      A  PVARV+ ++I          P +  +     A++ KE D+     + SN +  S    ++  K +R                 H     P   P  ++     C+ S W  W+ CS++CG G   R R + +         LP  E+  C   +  C  S+ C +  W  W  C+ATC + G ++R RM  +    +  +   E    + E ++C        P ++   SE      +CGK          +H  +  P E   C   L      M  E     A++   +W           S+ N    K          +E ++GG  C  T+          +  +C+  K +   GNS++ +      +     Q+    T+    C++  WS W  C+  CG G
Sbjct:   56 NNEFRLRVEGD----PDSYQPGSTYRVNVIASSPSY---FRGFTLIALKEGAGGDKDDDYAGNFRIIDEDETQFMTN---------CPHAVTESTPRRRNNIQVFWTAPPTGSGCVLLKASIVQKKIIFFQDEGPLTKQMC--------------EKESLYGDATDKPLLDCCACGTAKYRVTFYGNWSEKIHPKDYPRRAN--HWSAIIGASHSKNYVLWEYGGSASDGVKQVAELGSPVKM-----EEEIRQKGDDVLTVIKMKAQWPAWQPLNVRAAPSAEFSVDRIRHLMSFLTMMGPSPDWNVGLSAENLCTKECGWVQKVVQDLIPWDAGTDSGVSY--ESSNKPTVPQEKIRPLTSLDHPQSPFYDPEGGAITPVARVVVERIARKGEQCNIVPDNVDDIVADIAQEEKEEDDTPETCIYSNWSPWSACSSATCEKGKRMRQRMLKAQLDLSVPCPHTQDFEPCMGPGCSDEDGSTCMMSEWITWSPCSMSCGAGIRSRERYVKQFPDDGSICTLPTEETENCVVNEE-CSPSS-CLVTEWGEWDACSATCGL-GMKRRERMV-KMPPADGSICGAE----VLEVEKCMMPECHTIPCLLTPWSEWSDCSVTCGK------GSRTRHRVLKSPLELGECTEDLEQVEKCMLPECPIDCAMSDWTEW-----------SECNKSCGKGHTIRTRVVTMEPQFGGDPCPETI----------QRKKCKVRKCSRGQGNSDDKKRRKEQREKRRSKQVKTEVTSEHPGCKMRPWSSWTECTKQCGGG 772          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: spon1b (spondin-1 [Source:NCBI gene;Acc:101161803])

HSP 1 Score: 214.542 bits (545), Expect = 2.831e-58
Identity = 163/607 (26.85%), Postives = 270/607 (44.48%), Query Frame = 2
Query:  188 ILWMLLCLHWMIQESFAMNTRTNCFKMHKKTYQKVMMKDG--EFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHF-IINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMW---NEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPF-----TANVPVARVIYQKIKPKHNWECTKMN----------AKQVKEFDE-----MNSNKNGNSQFDGSSLTKKRR-----------------HINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTE---LCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            +L  + C    ++E     +   C ++ +   Q+   K+G  EFR+ +   +    + + PG +Y+++L  A     FR F++ A       L+  +    PD+ +G F I++K        CP  +        T ++  W AP +   C+  +A +V+   + ++  G L   +C  +  ++              D  +    ECCACG A Y++TF G WS+K HPKD+P++ +  HW+ LIGA+H+ +Y ++  GG AS+ V+ +  +G    ++ +  ++     + +   T   W       +  + S   SV+R  H  SFLTM+GPSPDW  G++  D+C  DC W      DL P+DAG  +G TY  E+ ++  IP D IR + +    Q PF         P+ARV+ ++I  K   +C  +            ++ KE D+     + S  +  S    ++  K RR                 H     P   P  +      C+ S W  W+ CSV+CG+G  MRSR+       E   LC  L   E+  C          + C +  W  W PC+ TC + G ++R RM 
Sbjct:   11 VLSCVYCAVAFMEEPSGGRSDGFCERIPRAQIQRTR-KEGHHEFRLKVEGEQ----ENYNPGTTYKVLLL-ATSPAYFRGFTLIA-------LKEGTEGTTPDDYIGQFQIVDKDDTQFMTSCPPAVTETTPRRRTKIQVFWTAPPSGSGCVILKASIVQKRVIFFQDKGSLTVRLCEKEPVQL--------------DTTSAPPIECCACGTAKYRLTFYGNWSEKVHPKDYPRRAN--HWSALIGASHSRNYVLWEYGGYASEGVRQVAEFGSPIKMEGEIRQK--GDDVLTVIKTKAQWPAWQPLNLRAAPSAEFSVDRARHLMSFLTMLGPSPDWNVGLSGEDLCTKDCGWIQRLVADLIPWDAGTDSGVTY--ESPNKPTIPQDKIRPLTSFDHPQSPFYDPQGGPISPLARVVVERIARKGE-QCNVVPDNIDDIVADIGQEEKEEDDTPETCIYSAWSPWSACSSATCDKGRRMRQRMLKAQLDLSVPCPHTQDFQPCMAPGCSMEEPSTCMMSEWISWSACSVSCGMG--MRSRERYVKQYPEDGSLC-QLHTEETEKCVVNDEC--LPSSCVVTEWGEWDPCSVTCGL-GMRRRERMV 577          

HSP 2 Score: 55.0694 bits (131), Expect = 2.916e-7
Identity = 32/87 (36.78%), Postives = 44/87 (50.57%), Query Frame = 2
Query: 1607 CITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMF 1867
            C+ +PWSEW+KCS TCG G  +R+R  ++      CR     E+   E R   C     C +  WS W  CN +C   G+  R+RM 
Sbjct:  607 CVPTPWSEWSKCSATCGRG--IRTRQRMRKTNQADCRE----ETEQKECRLPECSID--CMVSEWSEWSECNKSC-GKGHTIRTRMV 684          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: spon2b (spondin 2 [Source:NCBI gene;Acc:101164320])

HSP 1 Score: 112.464 bits (280), Expect = 1.926e-26
Identity = 89/334 (26.65%), Postives = 145/334 (43.41%), Query Frame = 2
Query:  761 SKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGF---ISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIP-DPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCG-IGTEMRSRDMLKNAKTELCRHLPLLESRTC 1747
            S P     PM   C A   A Y +TF G W++   PK +P  +    W+NLIG TH+ DY ++     AS  V+      ++  L ++   ET    ++S +   G+ +   +            V   H   SF+  + PSPDW  GV ++++C  D  WK+  T++LFP+DAG  +GFT+   + + + IP D I  I ++Y +        P     Y ++  KH     K+   ++K+ +++ S     +Q +      +       +PLD           C  S WS W  C   CG  G + R+R ++ +          L E R C
Sbjct:   30 SVPVPTDLPM---CTASEPAQYSLTFSGKWTRAAFPKQYPVYRPPAQWSNLIGVTHSLDYHMWQRNEFASNGVREFAEKSEAWTLMKEV--ETAGERIQSVY---GILSAPAVVGGTGQMDTEFEVFARHSLMSFMVRIIPSPDWFVGVDSINLCNGD-KWKESVTLELFPYDAGTDSGFTF--SSPNFETIPQDRITQITSSYPSH-------PANSFFYPRL--KHLPPIAKVKLTKIKKTNQIISLPMEPTQSNLLPTGNEIEETLINTPLD-----------CEVSVWSPWGLCKGKCGESGVQHRTRYVIMHPANNGVACPLLEEERKC 332          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: spon2a (spondin-2 [Source:NCBI gene;Acc:101163419])

HSP 1 Score: 96.2857 bits (238), Expect = 4.309e-21
Identity = 84/311 (27.01%), Postives = 130/311 (41.80%), Query Frame = 2
Query:  797 ECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTY----FPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMAT--------FLCITSPWSEWTKCSVTCGI-GTEMRSRDML 1690
            EC A   ASY + F G WS ++ PK +P  +    W+ LI  +H   + ++  G  AS  VQ     G +  L +   E   K  + +   T+G+ N   I  S S  + +       S +  M PSPDW  GV ++++C  +  WK + T++L P+DAG  +GFT+    FP +      P+ I  I     +Q P   N P     Y ++                KE   + S K          +T++ R  N+++ L +  L N  +          C  S WS W  C   C   G   R+R +L
Sbjct:   37 ECTAKSPASYILVFTGHWSPQSFPKQYPLFRPPAQWSKLIAVSHNHHFRLWEEGAAASLGVQKFAELGLTVELMKAGKEARKKRTVGAMQRTAGIPN--GIGHS-STEVHMQPRSSLLSLMVKMIPSPDWFVGVNSLNLCEGN-HWKQEVTVNLQPYDAGTNSGFTFSSPKFPTSP-----PENISKIT----SQVP---NHPANSFYYPRL----------------KELPAIASIK----------ITRQHRSANRQTVLSNHILPNSISPRRFSETPLDCEVSLWSSWGLCLGPCSRGGIRHRTRYIL 305          
BLAST of Spondin-1 vs. Ensembl Medaka
Match: COL6A3 (collagen type VI alpha 3 chain [Source:NCBI gene;Acc:101161016])

HSP 1 Score: 75.0998 bits (183), Expect = 3.482e-13
Identity = 47/155 (30.32%), Postives = 75/155 (48.39%), Query Frame = 2
Query: 1952 TALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKAC 2416
            + L DP   CS G   G  C     K++Y+     C  F Y GC G+ N F S+  C K CL +   L   + ++   +Q ++Q  +++ +  P   + C+L  + G  +C       +++YYD  +  C +F Y GCDGN N F +   C +AC
Sbjct: 2545 SELADP---CSLGFDPGMPCKDYQAKWYYERQNGFCTQFWYGGCGGNDNRFDSEALCLKRCLRSEVQLAG-KPEEKPQMQPEAQ-QTEQVEIPPAPVDICQLPKQEG--SCAEFA---LKWYYDTTSKSCTRFWYGGCDGNQNRFDTQEECKEAC 2689          

HSP 2 Score: 51.2174 bits (121), Expect = 6.233e-6
Identity = 25/75 (33.33%), Postives = 37/75 (49.33%), Query Frame = 2
Query: 2213 DKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDF 2437
            D  + +  +A+ C L     GM C        ++YY+ +NG C QF Y GC GN N F S   C+K C+  ++  
Sbjct: 2539 DNPQTVSELADPCSLGFD-PGMPCKDYQA---KWYYERQNGFCTQFWYGGCGGNDNRFDSEALCLKRCLRSEVQL 2609          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000009946.1 (SMESG000009946.1)

HSP 1 Score: 1699.49 bits (4400), Expect = 0.000e+0
Identity = 807/807 (100.00%), Postives = 807/807 (100.00%), Query Frame = 2
Query:  197 MLLCLHWMIQESFAMNTRTNCFKMHKKTYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 2617
            MLLCLHWMIQESFAMNTRTNCFKMHKKTYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC
Sbjct:    1 MLLCLHWMIQESFAMNTRTNCFKMHKKTYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 807          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000009946.1 (SMESG000009946.1)

HSP 1 Score: 1684.08 bits (4360), Expect = 0.000e+0
Identity = 800/800 (100.00%), Postives = 800/800 (100.00%), Query Frame = 2
Query:  218 MIQESFAMNTRTNCFKMHKKTYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 2617
            MIQESFAMNTRTNCFKMHKKTYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC
Sbjct:    1 MIQESFAMNTRTNCFKMHKKTYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 800          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000009946.1 (SMESG000009946.1)

HSP 1 Score: 1651.34 bits (4275), Expect = 0.000e+0
Identity = 784/784 (100.00%), Postives = 784/784 (100.00%), Query Frame = 2
Query:  266 MHKKTYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 2617
            MHKKTYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC
Sbjct:    1 MHKKTYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFATTC 784          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000039905.1 (SMESG000039905.1)

HSP 1 Score: 263.848 bits (673), Expect = 2.637e-75
Identity = 223/781 (28.55%), Postives = 332/781 (42.51%), Query Frame = 2
Query:  236 AMNTRTNCFKMHKK---TYQKVMMKDGEFRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSLQMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFL----TYVESTWIAPHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMIS-EENKNMKISKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWP-KQKSMVHWTNLIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQF---AEETIKPHLKSYFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVDMCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTYMTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNSQFDGSSLTKKRRHINKKSPLDDPTLANM-ATFLCITSPWSEWTKCSVTCGIGTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTALCDPVIICSEGLIMGSSC--GKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMP-TMANKCRLEVKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIKACMPDQIDFMKTAPI-------KACQVSEWSHWGPCSTTC 2509
            A +TR N +  H+K   T     + D  + I +      M ++    E Y ++ N                 EME+   +  H     +  G  + N         CP R +     +L     +V   WIAP  P  CIR    +   D +           IC  K  KM   + ++    S    + T  VK+C     A Y++T    W+   H KDWP K       T  +GA+H+ ++ IY+ GG A++ V  +C  G  T L++QF       +   L    + S   N+      RS  I VN T H  SFL  + PSPDWCTG++  D+C   C W++ F + L+P+DAG+ +G TY  +N   +    PI  I +++    PFT       V+  KIK         +     +   E N N N   Q+  S  +  +    +  P      +N   T  C+ S WSEW+ CS +CG G + R R +LK  K+E C    L  + +C  +  +      CS   W +W PCNATC   G   R R+F   +EK +C++  E +  +     C   +  C P +IC E +  G SC    P  +++YD +  +C  F Y GC G LNNF +   C   C   +    Q                  +R   P T  N+C + + + G+ CD +  P  R+YYDN N  C +F++ GC GN+NNFR+   C   C+ ++     T  I       K C  S WS W  C   C
Sbjct:   35 AFSTRFNLYTNHEKEKLTKITSYIPDKTYDITVSLNDKAMHEKLTIKEIYVLVSN--------------VHTEMEE---LSEHDW---KNAGEVVFNVTHASKTEYCPQRAYV---QYLYTQPQHVTFYWIAPKIPNFCIRITVILKMNDLISESKFEERSHWICEQKRNKMDQMQADQYASTSCAMKQKTDPVKQCNIGSTAVYRMTIENKWNLLNHWKDWPGKDGYSPKITQYLGASHSNEFNIYHLGGMANEGVSQVCGNGSYTELQKQFYKAGNGIMTVILARSLDASSKTNK------RSALIVVNATQHLVSFLARLHPSPDWCTGLSRFDLCNGSCKWQEKFIVHLYPWDAGVYSGETYLNKNEKTRQT--PICPITSSWPKDNPFT-------VMNGKIK--------NIGVVTFQLIQEYNKNDN---QYCNSINSILQDEAYQNEPKSSALKSNPDKTRHCLLSEWSEWSSCSESCGKGEKTRYRKLLK-GKSEQCIESSLTNTESCSSKCSTAISFETCSFRLWGQWSPCNATCSQKGIIHRERVFINEQEKHECMQYSEMKASL----ECALASERCKPDVICKEYVYPGDSCSWSSPSQRFYYDFSSGTCNAFIYKGCYGGLNNFHTYEECILLCRPKLKETDQ------------------RRFNTPETYPNRCGVSMTW-GIFCD-SQSPSNRWYYDNINKECYRFRFGGCRGNANNFRTKTECQNVCLREKSTSTTTTTISQPVTVRKVCIYSNWSDWSSCDDNC 741          
BLAST of Spondin-1 vs. Planmine SMEST
Match: SMESG000032462.1 (SMESG000032462.1)

HSP 1 Score: 62.003 bits (149), Expect = 2.149e-9
Identity = 85/372 (22.85%), Postives = 132/372 (35.48%), Query Frame = 2
Query: 1607 CITSPWSEWTKCSVTCG--IGTEMRSRDMLKNAKTELC--RHLPLL-ESRTCEGRKRSCDFSAPCSLLSWSRWGPCNATCEMHGYQQRSRMFARFEE--KEKCLKNKER--RFKIFEEKRCKKDTALCDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKG-SLNNFPSKMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLEVKYGGMNCDGTMGP----DIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYH-----------SCIKAC-MP-----------DQIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALNGGPACPELFLSEPCFAT 2611
            C   PW  W+ C   CG   GT  RSR ++   KT  C  +  P L E+ +C      C  +  C    WS W  C+ +C   G  +R+R F +  E   E C+   E       F+ K C     + D     S  ++    CG  ++       KH         C G   +N    + C+  C      + QW +   +++                + N+ R         C G+  P    DIR Y  +    C    +T     SN+  S +           +C  +C MP           D +D         C VS WS W  C   C  G +++ R++++     G +CP L  +  C  +
Sbjct:   79 CEPDPWQSWSSCQGPCGNRTGTRNRSR-IVSPEKTNQCGGKGCPTLNETESC--LTNCCVVN--CQWTIWSVWSECSNSCG-DGESKRNRTFLKKAECGGEICVGETEELVNCSFFKNKDC-----IMDSWSEWSNCILANGKCGTGLVYRNRSIIKHE-------ECNGIPCSNIYESILCQGECCMQNCTISQWSEWSFSNVTC-------------GIGNQTRTRFILDKAECGGSSCPMDLIDIRQYEKSDYRNCSVSAWTNWSPCSNSCGSGYQVSSRYVVIDEACGGSCSMPLTRNQTCSSFADNLD---------CLVSPWSEWSECIKNCNNGIKYRTRNIIQLPKCKGISCPNLQDNSTCMES 410          
The following BLAST results are available for this feature:
BLAST of Spondin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPON19.695e-6029.14spondin 1 [Source:HGNC Symbol;Acc:HGNC:11252][more]
SPON28.089e-2527.06spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253][more]
SPON28.089e-2527.06spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253][more]
SPON28.089e-2527.06spondin 2 [Source:HGNC Symbol;Acc:HGNC:11253][more]
TFPI2.511e-1129.79tissue factor pathway inhibitor [Source:HGNC Symbo... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon-11.483e-7225.75SPONdin (Extracellular matrix glycoprotein) family... [more]
ZC84.16.433e-1630.59pep chromosome:WBcel235:III:9199450:9206285:-1 gen... [more]
F30H5.33.792e-1529.25pep chromosome:WBcel235:III:505241:512217:-1 gene:... [more]
ZC84.61.162e-1432.43pep chromosome:WBcel235:III:9192983:9199507:-1 gen... [more]
Y43F8B.32.043e-1325.19pep chromosome:WBcel235:V:19503108:19519950:1 gene... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fat-spondin2.749e-6524.41gene:FBgn0026721 transcript:FBtr0086975[more]
CG177392.120e-5123.80gene:FBgn0033710 transcript:FBtr0087893[more]
CG300463.357e-4524.64gene:FBgn0050046 transcript:FBtr0087895[more]
CG300463.357e-4524.64gene:FBgn0050046 transcript:FBtr0339627[more]
CG302032.126e-4423.72gene:FBgn0050203 transcript:FBtr0273303[more]
back to top
BLAST of Spondin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon1b2.735e-6128.85spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1b4.120e-6128.85spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1b4.653e-6128.85spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1b2.671e-5929.37spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1a1.834e-5828.18spondin 1a [Source:ZFIN;Acc:ZDB-GENE-000427-9][more]
back to top
BLAST of Spondin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon12.813e-5929.63spondin 1, extracellular matrix protein [Source:NC... [more]
spon14.329e-5929.26spondin 1, extracellular matrix protein [Source:NC... [more]
spon12.104e-5829.81spondin 1, extracellular matrix protein [Source:NC... [more]
spon12.580e-5830.00spondin 1, extracellular matrix protein [Source:NC... [more]
spon13.514e-5829.81spondin 1, extracellular matrix protein [Source:NC... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spon18.947e-6029.14spondin 1, (f-spondin) extracellular matrix protei... [more]
Spon11.858e-2829.75spondin 1, (f-spondin) extracellular matrix protei... [more]
Spon24.071e-2325.08spondin 2, extracellular matrix protein [Source:MG... [more]
Spon23.404e-1427.21spondin 2, extracellular matrix protein [Source:MG... [more]
Tfpi8.310e-1129.09tissue factor pathway inhibitor [Source:MGI Symbol... [more]
back to top
BLAST of Spondin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HCB6|SPON1_HUMAN4.656e-5929.14Spondin-1 OS=Homo sapiens OX=9606 GN=SPON1 PE=1 SV... [more]
sp|Q9GLX9|SPON1_BOVIN5.689e-5929.33Spondin-1 OS=Bos taurus OX=9913 GN=SPON1 PE=1 SV=1[more]
sp|Q8VCC9|SPON1_MOUSE6.259e-5929.14Spondin-1 OS=Mus musculus OX=10090 GN=Spon1 PE=1 S... [more]
sp|P35446|SPON1_RAT1.109e-5829.14Spondin-1 OS=Rattus norvegicus OX=10116 GN=Spon1 P... [more]
sp|Q9W770|SPON1_CHICK9.389e-5728.97Spondin-1 OS=Gallus gallus OX=9031 GN=SPON1 PE=2 S... [more]
back to top
BLAST of Spondin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z1R1770.000e+098.64F-spondin (Fragment) OS=Schmidtea mediterranea OX=... [more]
A0A5J4P3I40.000e+036.39Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A183AG110.000e+040.61Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A0R3U4980.000e+037.99Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3F8X71.026e-18037.88Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon1b2.764e-5828.37spondin 1b [Source:ZFIN;Acc:ZDB-GENE-000427-10][more]
spon1a3.938e-4426.10spondin 1a [Source:ZFIN;Acc:ZDB-GENE-000427-9][more]
spon2b2.560e-2828.57spondin 2b, extracellular matrix protein [Source:Z... [more]
spon2a5.575e-2430.51spondin-2-like [Source:NCBI gene;Acc:103039648][more]
ENSAMXT00000041207.12.111e-1430.00pep primary_assembly:Astyanax_mexicanus-2.0:11:518... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon2b9.708e-1922.55spondin 2b, extracellular matrix protein [Source:Z... [more]
ENSPMAT00000005038.11.073e-1127.03pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
ENSPMAT00000005043.11.193e-1127.03pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
ENSPMAT00000009465.12.519e-1128.38pep scaffold:Pmarinus_7.0:GL478507:22936:25713:-1 ... [more]
spon2a3.394e-1046.15spondin 2a, extracellular matrix protein [Source:Z... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spondin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498951.083e-4631.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475041.582e-939.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488317.129e-940.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384662.101e-748.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260722.386e-748.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Spondin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spon1a4.730e-5925.16spondin 1 [Source:NCBI gene;Acc:101161963][more]
spon1b2.831e-5826.85spondin-1 [Source:NCBI gene;Acc:101161803][more]
spon2b1.926e-2626.65spondin 2 [Source:NCBI gene;Acc:101164320][more]
spon2a4.309e-2127.01spondin-2 [Source:NCBI gene;Acc:101163419][more]
COL6A33.482e-1330.32collagen type VI alpha 3 chain [Source:NCBI gene;A... [more]
back to top
BLAST of Spondin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009946.10.000e+0100.00SMESG000009946.1[more]
SMESG000009946.10.000e+0100.00SMESG000009946.1[more]
SMESG000009946.10.000e+0100.00SMESG000009946.1[more]
SMESG000039905.12.637e-7528.55SMESG000039905.1[more]
SMESG000032462.12.149e-922.85SMESG000032462.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30012850 ID=SMED30012850|Name=Spondin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2699bp
GGTGAATGAAAGATTGAAAGTAAACAAATTTATGAGACATTGACATTATT
CATTTAACTTACATCACAGGACGACCAATATCACATAATACTTCTTCCTG
TTTACAAGGTTGAAGTCGTTTATATAAATCGTCAAAGTCTCAGTTAAGAT
CATTGATATTATGAAAATTTACATCTTAATTTGGAATATCCTTTGGATGT
TGCTATGTCTTCATTGGATGATCCAGGAAAGTTTTGCCATGAATACTAGA
ACCAATTGTTTTAAAATGCATAAAAAAACCTACCAAAAAGTCATGATGAA
AGATGGAGAATTTCGAATAGTAATTAGAGACATGAAAGGCAAAATGGCAG
ATAGATTCGAACCTGGTGAAAGCTATAGAATAATTTTGAATAATGCAATG
TATGGAATGGATTTCAGAGATTTTTCAATATTCGCGGCCTACGAGATGGA
GGATTCGTTGCAAATGGAAAGTCATAAAATGATTCCCGATGAAGGACTTG
GTCATTTTATTATAAATAAAAAATTTGGGTTGGTTGATTATAAATGTCCT
AACAGAATGCATGGAAATGATAATATGTTTCTAACTTATGTAGAGTCGAC
ATGGATAGCTCCGCATAATCCTATAAATTGTATTCGCTTTGAGGCTCAAG
TTGTAAAATTTGATTTTATGGTGTATGAAAGTATCGGACGTTTAGTAAAA
GTTATTTGTCCAACAAAAATGTATAAAATGATTAGTGAAGAAAATAAAAA
CATGAAAATATCTAAACCTTTTGATGAGATGACTCCTATGGTTAAAGAAT
GTTGCGCTTGTGGAGTAGCGTCTTATAAAGTAACATTTATGGGGTTATGG
TCAAAGAAAACTCATCCCAAAGATTGGCCAAAACAAAAGAGCATGGTTCA
TTGGACCAATCTTATAGGGGCCACACATACTGGCGATTACTTTATATATT
ATAACGGTGGTCAAGCAAGCCAGGCAGTTCAAAGTATTTGTTCATATGGA
GATAGCACGGTTTTGAAACAGCAGTTCGCAGAAGAGACAATAAAACCGCA
TTTGAAGAGTTATTTTAATACTTCAGGCATGTGGAATGAAGACGAAATTG
AACAGAGTAGATCGGGATTCATATCGGTTAATCGTACTCATCATTTCTTT
AGCTTTCTCACAATGATGGGCCCAAGTCCTGATTGGTGTACTGGAGTAGC
AGCTGTAGACATGTGTATGAATGATTGTACATGGAAGGATGATTTCACCA
TGGATCTATTCCCATTTGATGCTGGAATTAAAAACGGTTTCACATATTTC
CCAGAAAATTCGGACAGGCAAGACATTCCTGATCCAATTAGAACAATCAA
CACTACATATATGACCCAATTCCCTTTCACAGCAAATGTTCCAGTTGCCC
GGGTAATTTATCAAAAGATCAAACCAAAACACAATTGGGAGTGCACCAAG
ATGAATGCAAAACAAGTAAAAGAATTTGATGAAATGAATTCAAACAAAAA
CGGAAATTCTCAATTCGATGGAAGTAGTTTGACGAAAAAACGCCGACACA
TTAACAAGAAAAGTCCCCTTGATGATCCGACTTTGGCCAATATGGCTACA
TTTTTGTGTATAACATCTCCATGGAGTGAGTGGACTAAATGTTCAGTTAC
GTGTGGCATTGGGACAGAGATGAGATCTCGAGACATGTTGAAAAATGCTA
AAACAGAATTATGTCGTCACTTACCTTTGCTTGAAAGTCGGACATGCGAA
GGAAGAAAACGTTCGTGTGATTTCTCAGCACCATGTAGCCTTCTTTCCTG
GTCAAGATGGGGTCCATGCAATGCAACTTGTGAGATGCACGGATACCAAC
AGAGATCTCGAATGTTTGCAAGATTTGAAGAAAAAGAGAAATGTCTCAAA
AACAAAGAAAGACGATTTAAAATTTTTGAAGAAAAACGGTGCAAAAAAGA
CACAGCCTTGTGTGACCCAGTTATTATATGTAGTGAGGGCCTAATAATGG
GCAGCAGCTGTGGCAAGCCTGTTATGAAATATTTCTATGATGCTGCCAAA
CACAGTTGTGTGCCTTTTGAATACCTCGGTTGTAAAGGAAGTCTGAATAA
CTTTCCTTCTAAAATGTCTTGCGAAAAGACTTGCTTAGCAGCTGTCAATG
CGCTGCCTCAGTGGAGAAAAGACAAAATGGCTCACTTACAGTTTCAGTCT
CAGTCGAATTCAGATAAACGAAAGAAAATGCCAACAATGGCTAACAAATG
TCGGCTTGAAGTAAAATACGGCGGAATGAATTGCGATGGAACAATGGGAC
CGGACATTCGATATTATTATGATAACAGAAATGGACGCTGTAGACAATTT
AAATACACTGGCTGTGATGGGAATAGTAACAACTTCCGGTCTTATCACAG
CTGCATTAAGGCTTGCATGCCAGATCAAATCGACTTTATGAAAACTGCTC
CGATCAAAGCTTGTCAAGTATCTGAGTGGTCACATTGGGGTCCATGTTCT
ACGACCTGCGGTGTGGGAGAGAGATTCAAATGGCGATCTGTGCTTCGGCC
GGCATTGAATGGCGGTCCAGCTTGTCCAGAGTTATTTCTATCGGAACCTT
GTTTCGCGACAACTTGTTGAAAAATTTATATAAATTTTGTATCCATTTTT
GATGACATTTATAATAATTTTATGGGTAAATATATTTTAGTTCTTCCTC
back to top

protein sequence of SMED30012850-orf-1

>SMED30012850-orf-1 ID=SMED30012850-orf-1|Name=SMED30012850-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=820bp
MKIYILIWNILWMLLCLHWMIQESFAMNTRTNCFKMHKKTYQKVMMKDGE
FRIVIRDMKGKMADRFEPGESYRIILNNAMYGMDFRDFSIFAAYEMEDSL
QMESHKMIPDEGLGHFIINKKFGLVDYKCPNRMHGNDNMFLTYVESTWIA
PHNPINCIRFEAQVVKFDFMVYESIGRLVKVICPTKMYKMISEENKNMKI
SKPFDEMTPMVKECCACGVASYKVTFMGLWSKKTHPKDWPKQKSMVHWTN
LIGATHTGDYFIYYNGGQASQAVQSICSYGDSTVLKQQFAEETIKPHLKS
YFNTSGMWNEDEIEQSRSGFISVNRTHHFFSFLTMMGPSPDWCTGVAAVD
MCMNDCTWKDDFTMDLFPFDAGIKNGFTYFPENSDRQDIPDPIRTINTTY
MTQFPFTANVPVARVIYQKIKPKHNWECTKMNAKQVKEFDEMNSNKNGNS
QFDGSSLTKKRRHINKKSPLDDPTLANMATFLCITSPWSEWTKCSVTCGI
GTEMRSRDMLKNAKTELCRHLPLLESRTCEGRKRSCDFSAPCSLLSWSRW
GPCNATCEMHGYQQRSRMFARFEEKEKCLKNKERRFKIFEEKRCKKDTAL
CDPVIICSEGLIMGSSCGKPVMKYFYDAAKHSCVPFEYLGCKGSLNNFPS
KMSCEKTCLAAVNALPQWRKDKMAHLQFQSQSNSDKRKKMPTMANKCRLE
VKYGGMNCDGTMGPDIRYYYDNRNGRCRQFKYTGCDGNSNNFRSYHSCIK
ACMPDQIDFMKTAPIKACQVSEWSHWGPCSTTCGVGERFKWRSVLRPALN
GGPACPELFLSEPCFATTC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR036880Kunitz_BPTI_sf
IPR042307Reeler_sf
IPR038678Spondin_N_sf
IPR000884TSP1_rpt
IPR002223Kunitz_BPTI
IPR009465Spondin_N
IPR002861Reeler_dom
IPR020901Prtase_inh_Kunz-CS
Vocabulary: molecular function
TermDefinition
GO:0004867serine-type endopeptidase inhibitor activity
Vocabulary: biological process
TermDefinition
GO:0010951negative regulation of endopeptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 770..819
e-value: 3.3E-4
score: 30.0
coord: 485..537
e-value: 1.3E-8
score: 44.7
coord: 544..602
e-value: 0.11
score: 17.8
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 547..586
e-value: 7.7E-6
score: 26.0
coord: 486..530
e-value: 6.8E-8
score: 32.6
coord: 771..819
e-value: 8.2E-7
score: 29.1
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 767..818
score: 10.34
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 482..537
score: 10.426
IPR002223Pancreatic trypsin inhibitor Kunitz domainSMARTSM00131KU_2coord: 695..753
e-value: 6.2E-13
score: 59.0
coord: 605..659
e-value: 9.2E-14
score: 61.7
IPR002223Pancreatic trypsin inhibitor Kunitz domainPFAMPF00014Kunitz_BPTIcoord: 697..753
e-value: 2.1E-13
score: 50.3
coord: 607..658
e-value: 5.8E-13
score: 48.9
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 607..658
score: 13.097
IPR002223Pancreatic trypsin inhibitor Kunitz domainPROSITEPS50279BPTI_KUNITZ_2coord: 697..752
score: 14.66
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 616..659
e-value: 1.51015E-10
score: 54.9486
IPR002223Pancreatic trypsin inhibitor Kunitz domainCDDcd00109KUcoord: 697..753
e-value: 4.53952E-13
score: 62.2674
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 480..536
e-value: 9.5E-11
score: 43.7
coord: 539..599
e-value: 1.2E-6
score: 30.6
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 765..814
e-value: 1.4E-13
score: 52.9
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 483..530
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 540..580
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 768..814
IPR002861Reeler domainPFAMPF02014Reelercoord: 47..166
e-value: 8.4E-7
score: 29.8
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 676..753
e-value: 6.0E-15
score: 56.9
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilyGENE3DG3DSA:4.10.410.10coord: 603..660
e-value: 3.6E-14
score: 54.5
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 690..754
IPR036880Pancreatic trypsin inhibitor Kunitz domain superfamilySUPERFAMILYSSF57362BPTI-likecoord: 606..660
IPR042307Reeler domain superfamilyGENE3DG3DSA:2.60.40.4060coord: 28..186
e-value: 1.9E-14
score: 55.9
IPR038678Spondin, N-terminal domain superfamilyGENE3DG3DSA:2.60.40.2130coord: 204..404
e-value: 4.7E-61
score: 208.2
IPR009465Spondin, N-terminalPFAMPF06468Spond_Ncoord: 220..400
e-value: 3.6E-49
score: 167.5
IPR009465Spondin, N-terminalPROSITEPS51020SPONDINcoord: 210..405
score: 54.669
NoneNo IPR availablePANTHERPTHR11311F-SPONDINcoord: 480..662
NoneNo IPR availablePANTHERPTHR11311F-SPONDINcoord: 42..401
coord: 689..810
NoneNo IPR availablePANTHERPTHR11311:SF23FAT-SPONDINcoord: 480..662
NoneNo IPR availablePANTHERPTHR11311:SF23FAT-SPONDINcoord: 689..810
coord: 42..401
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..26
score: 0.894
NoneNo IPR availableTMHMMTMhelixcoord: 5..22
IPR020901Proteinase inhibitor I2, Kunitz, conserved sitePROSITEPS00280BPTI_KUNITZ_1coord: 636..654
IPR020901Proteinase inhibitor I2, Kunitz, conserved sitePROSITEPS00280BPTI_KUNITZ_1coord: 730..748